F441348

General Info

Members Datasets Scaffolds Average Seq Length
426 274 363 557

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939631187|2939633201
Length 632
Sequence TLTASNTVRYSTLGLCVLVMILSLFSMIAFGRGGLWFLASGLLVALGVYDLRQTRHAILRNYPLLGHMRFALEFIRPEIRQYFIESDTEAQPFSRAQRSVVYQRSKGEPDNRPFGTQLDVGAEGYEWVNHSMSPTKIESHDFRIWIGGQPGVPNPGTQPCTQPYSASVFNVSAMSFGALSANAILALNQGAKIGGFAHDTGEGSISQYHRLHGGDLIWQIASGYFGCRDADGKFSPERFAKQALEPQVKMIELKLSQGAKPGHGGVLPGAKVTPEIAATRGVPVGVDCISPSAHSSFSTPVGLLRFLAELRRLSGGKPTGLKLCIGHPWEWFAIAKAMLETDITPDFIVVDGAEGGTGAAPVEFVDHVGTPLQEGLRLVHNTLIGIGLRERVKLGCAGKVVTAFDVVRMLALGADWCNSARGYMMALGCIQAQTCHTGRCPTGVTTQDPLRQKALVVADKAPRVAQFHANTLHALKELLQAAGLNHPDDVTSHHIVRRIDDTEVRLLSTLMPRLEHGAILNDLAHQPNVFRLYWPLASSHSFAPQHPAAGDTPPDLRDSRGVHKTRTPSSAREVAQELKSSHPPEPPPETPVNPEQASSPAATPVSPTEVPTDWGASDTGKGAAPAETQDRL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221652 Acidovorax sp. Root402 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842733646 Variovorax sp. R-72446 Isolate Unclassified
31 2842747753 Variovorax sp. R-72060 Isolate Unclassified
32 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
33 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
34 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
35 2858950400 Achromobacter sp. K91 Isolate Unclassified
36 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
37 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
38 2885198086 Variovorax sp. 679 Isolate Unclassified
39 2885211737 Variovorax sp. 553 Isolate Unclassified
40 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
41 2899924645 Variovorax sp. 369 Isolate Unclassified
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928070936 Variovorax gossypii 1167 Isolate Unclassified
52 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
53 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
54 2929520902 Variovorax beijingensis 502 Isolate Unclassified
55 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
56 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
57 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
58 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
59 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
60 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
61 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
68 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
69 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
202 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
268 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
274 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.21
Metatranscriptomes 0
Isolates 14.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.63
Nodule 1.88
Rhizoplane 0.94
Rhizosphere 43.66
Stem 0
Stem Tuber 0
Unclassified 20.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002437 3300001979 Bacteria 8441
2 JGI25155J39150_1000042 3300002704 Bacteria 88585
3 JGI25156J39149_1000053 3300002705 Bacteria 88796
4 JGI25154J39366_1000082 3300002738 Bacteria 88767
5 JGI25157J39369_1000072 3300002741 Bacteria 88796
6 JGI25150J39212_1000649 3300002774 Bacteria 12976
7 JGI25150J39212_1004227 3300002774 Bacteria 3223
8 JGI25159J45721_1001172 3300002987 Bacteria 11186
9 JGI25159J45721_1004516 3300002987 Bacteria 4600
10 JGI25159J45721_1006223 3300002987 Bacteria 3607
11 JGI25151J46595_10000316 3300003187 Bacteria 52522
12 JGI25151J46595_10002989 3300003187 Bacteria 9641
13 JGI25151J46595_10006986 3300003187 Bacteria 5587
14 JGI25151J46595_10015503 3300003187 Bacteria 3354
15 JGI25160J50197_1000188 3300003354 Bacteria 52036
16 JGI25160J50197_1002467 3300003354 Bacteria 8609
17 JGI25160J50197_1006588 3300003354 Bacteria 4679
18 JGI25161J50226_1000007 3300003374 Bacteria 256181
19 Ga0055535_1000460 3300003761 Bacteria 37464
20 Ga0055542_1000092 3300003762 Bacteria 121105
21 Ga0055526_1002015 3300003771 Bacteria 13974
22 Ga0055526_1003935 3300003771 Bacteria 9173
23 Ga0055537_1000127 3300003773 Bacteria 58289
24 Ga0055537_1000243 3300003773 Bacteria 39987
25 Ga0055524_1000213 3300003775 Bacteria 61225
26 Ga0055524_1000237 3300003775 Bacteria 57951
27 Ga0055524_1013149 3300003775 Bacteria 3135
28 Ga0055536_1000469 3300003781 Bacteria 28214
29 Ga0055536_1000526 3300003781 Bacteria 26477
30 Ga0055534_1000373 3300003784 Bacteria 28093
31 Ga0055534_1001447 3300003784 Bacteria 9452
32 Ga0055534_1002616 3300003784 Bacteria 6133
33 Ga0055528_1000316 3300003790 Bacteria 40688
34 Ga0055528_1001226 3300003790 Bacteria 16371
35 Ga0055528_1017894 3300003790 Bacteria 2431
36 Ga0055530_10001317 3300003791 Bacteria 18669
37 Ga0055530_10001521 3300003791 Bacteria 16748
38 Ga0055530_10003710 3300003791 Bacteria 8501
39 Ga0055530_10004518 3300003791 Bacteria 7125
40 Ga0055530_10010261 3300003791 Bacteria 3486
41 Ga0055540_1000018 3300003792 Bacteria 218360
42 Ga0055540_1000176 3300003792 Bacteria 63046
43 Ga0055540_1000697 3300003792 Bacteria 23157
44 Ga0055540_1001110 3300003792 Bacteria 16976
45 Ga0055540_1005319 3300003792 Bacteria 5465
46 Ga0055540_1018921 3300003792 Bacteria 1872
47 Ga0055531_10000850 3300003794 Bacteria 25221
48 Ga0055531_10001384 3300003794 Bacteria 17989
49 Ga0055531_10008380 3300003794 Bacteria 5465
50 Ga0055531_10018740 3300003794 Bacteria 2840
51 Ga0055543_1000842 3300004625 Bacteria 14843
52 Ga0070658_10009519 3300005327 Bacteria 7804
53 Ga0070658_10025947 3300005327 Bacteria 4701
54 Ga0070660_100042686 3300005339 Bacteria 3463
55 Ga0070661_100033803 3300005344 Bacteria 3706
56 Ga0070669_100010848 3300005353 Bacteria 6467
57 Ga0070659_100004997 3300005366 Bacteria 9501
58 Ga0070667_100072203 3300005367 Bacteria 2941
59 Ga0070700_100006303 3300005441 Bacteria 6334
60 Ga0070678_100030298 3300005456 Bacteria 3718
61 Ga0070662_100059179 3300005457 Bacteria 2790
62 Ga0070706_100002907 3300005467 Bacteria 17048
63 Ga0070679_100025459 3300005530 Bacteria 5806
64 Ga0068853_100028329 3300005539 Bacteria 4711
65 Ga0070672_100013188 3300005543 Bacteria 5829
66 Ga0068855_100002740 3300005563 Bacteria 21700
67 Ga0068855_100016022 3300005563 Bacteria 9017
68 Ga0068855_100032493 3300005563 Bacteria 6231
69 Ga0070664_100005695 3300005564 Bacteria 10028
70 Ga0068857_100119843 3300005577 Bacteria 2368
71 Ga0068861_100016885 3300005719 Bacteria 5173
72 Ga0068851_10004697 3300005834 Bacteria 6176
73 Ga0068858_100065041 3300005842 Bacteria 3375
74 Ga0068860_100033799 3300005843 Bacteria 4906
75 Ga0075365_10001209 3300006038 Bacteria 11409
76 Ga0075363_100008214 3300006048 Bacteria 4848
77 Ga0075363_100023851 3300006048 Bacteria 3105
78 Ga0075363_100045609 3300006048 Bacteria 2324
79 Ga0075364_10058247 3300006051 Bacteria 2531
80 Ga0075366_10006298 3300006195 Bacteria 6491
81 Ga0075370_10012790 3300006353 Bacteria 4445
82 Ga0075370_10026649 3300006353 Bacteria 3203
83 Ga0068865_100003574 3300006881 Bacteria 9338
84 Ga0079104_1000004 3300006946 Bacteria 444549
85 Ga0079104_1000012 3300006946 Bacteria 355143
86 Ga0099826_10000629 3300006948 Bacteria 18088
87 Ga0105244_10003449 3300009036 Bacteria 11273
88 Ga0105240_10003337 3300009093 Bacteria 24992
89 Ga0105243_10000352 3300009148 Bacteria 49052
90 Ga0105237_10032225 3300009545 Bacteria 5307
91 Ga0105237_10047376 3300009545 Bacteria 4321
92 Ga0105238_10049397 3300009551 Bacteria 4237
93 Ga0105249_10009715 3300009553 Bacteria 8431
94 Ga0105239_10021274 3300010375 Bacteria 7151
95 Ga0105246_10014735 3300011119 Bacteria 4922
96 Ga0157371_10021755 3300013102 Bacteria 4705
97 Ga0157378_10022757 3300013297 Bacteria 5515
98 Ga0163162_10017155 3300013306 Bacteria 7085
99 Ga0157375_10121441 3300013308 Bacteria 2722
100 Ga0157380_10007940 3300014326 Bacteria 7556
101 Ga0182007_10002585 3300015262 Bacteria 8912
102 Ga0182007_10003651 3300015262 Bacteria 7213
103 Ga0163161_10000076 3300017792 Bacteria 101523
104 Ga0163161_10013465 3300017792 Bacteria 5693
105 Ga0163161_10023369 3300017792 Bacteria 4361
106 Ga0213872_10000009 3300021361 Bacteria 221470
107 Ga0213872_10000723 3300021361 Bacteria 24633
108 Ga0213872_10002909 3300021361 Bacteria 9736
109 Ga0213872_10004337 3300021361 Bacteria 7559
110 Ga0213872_10005959 3300021361 Bacteria 6182
111 Ga0209435_100019 3300025206 Bacteria 260989
112 Ga0209436_106361 3300025208 Bacteria 2599
113 Ga0209258_100020 3300025242 Bacteria 565241
114 Ga0207425_1002808 3300025245 Bacteria 5880
115 Ga0207425_1002837 3300025245 Bacteria 5829
116 Ga0209646_1000038 3300025246 Bacteria 353982
117 Ga0209026_1000048 3300025250 Bacteria 257264
118 Ga0209148_1000031 3300025254 Bacteria 564601
119 Ga0209759_1000038 3300025256 Bacteria 257264
120 Ga0209129_1000136 3300025258 Bacteria 123804
121 Ga0209129_1001641 3300025258 Bacteria 12155
122 Ga0209565_1000026 3300025263 Bacteria 365910
123 Ga0209565_1000070 3300025263 Bacteria 168957
124 Ga0209565_1000312 3300025263 Bacteria 45181
125 Ga0209565_1002341 3300025263 Bacteria 6922
126 Ga0209565_1011815 3300025263 Bacteria 2109
127 Ga0209565_1011834 3300025263 Bacteria 2106
128 Ga0209455_1000453 3300025272 Bacteria 31372
129 Ga0209673_1000009 3300025273 Bacteria 620735
130 Ga0209673_1000234 3300025273 Bacteria 107514
131 Ga0209673_1000266 3300025273 Bacteria 98358
132 Ga0209673_1001437 3300025273 Bacteria 22664
133 Ga0209673_1002285 3300025273 Bacteria 13692
134 Ga0209130_1000289 3300025284 Bacteria 61485
135 Ga0209130_1001571 3300025284 Bacteria 14386
136 Ga0209675_1000069 3300025291 Bacteria 170538
137 Ga0209675_1000293 3300025291 Bacteria 46582
138 Ga0209675_1000473 3300025291 Bacteria 30855
139 Ga0209676_1000013 3300025292 Bacteria 816080
140 Ga0209676_1000195 3300025292 Bacteria 135920
141 Ga0209676_1001839 3300025292 Bacteria 17549
142 Ga0209676_1001955 3300025292 Bacteria 16570
143 Ga0209676_1008088 3300025292 Bacteria 4774
144 Ga0209025_1000057 3300025294 Bacteria 314601
145 Ga0209025_1000065 3300025294 Bacteria 300915
146 Ga0209025_1000325 3300025294 Bacteria 106131
147 Ga0209025_1000620 3300025294 Bacteria 63314
148 Ga0209025_1000728 3300025294 Bacteria 55852
149 Ga0209025_1002159 3300025294 Bacteria 21921
150 Ga0209025_1004012 3300025294 Bacteria 13194
151 Ga0209025_1006033 3300025294 Bacteria 9587
152 Ga0209025_1008809 3300025294 Bacteria 7173
153 Ga0209025_1012088 3300025294 Bacteria 5587
154 Ga0209564_1000101 3300025295 Bacteria 222879
155 Ga0209564_1000156 3300025295 Bacteria 165265
156 Ga0209564_1000579 3300025295 Bacteria 58010
157 Ga0209564_1000620 3300025295 Bacteria 54301
158 Ga0209758_1000127 3300025297 Bacteria 189368
159 Ga0209758_1010234 3300025297 Bacteria 5652
160 Ga0209050_1000008 3300025298 Bacteria 1144179
161 Ga0209050_1000021 3300025298 Bacteria 574406
162 Ga0209050_1000683 3300025298 Bacteria 50985
163 Ga0209050_1001049 3300025298 Bacteria 34100
164 Ga0209050_1002038 3300025298 Bacteria 18671
165 Ga0209256_1000003 3300025299 Bacteria 1661127
166 Ga0209256_1000045 3300025299 Bacteria 325506
167 Ga0209256_1000104 3300025299 Bacteria 189367
168 Ga0209256_1000137 3300025299 Bacteria 158814
169 Ga0207426_1000091 3300025302 Bacteria 280561
170 Ga0207426_1000149 3300025302 Bacteria 189367
171 Ga0207426_1000478 3300025302 Bacteria 61105
172 Ga0207426_1004353 3300025302 Bacteria 6957
173 Ga0209051_1000004 3300025303 Bacteria 1155596
174 Ga0209051_1000005 3300025303 Bacteria 1142353
175 Ga0209051_1000028 3300025303 Bacteria 404269
176 Ga0209051_1000182 3300025303 Bacteria 113251
177 Ga0209051_1000184 3300025303 Bacteria 112134
178 Ga0209051_1000437 3300025303 Bacteria 56466
179 Ga0209257_1000043 3300025304 Bacteria 512127
180 Ga0209257_1000048 3300025304 Bacteria 455536
181 Ga0209257_1000360 3300025304 Bacteria 92894
182 Ga0209257_1000397 3300025304 Bacteria 85732
183 Ga0207656_10001611 3300025321 Bacteria 7508
184 Ga0207655_1006176 3300025728 Bacteria 7985
185 Ga0207705_10045774 3300025909 Bacteria 3144
186 Ga0207671_10119673 3300025914 Bacteria 2012
187 Ga0207657_10054313 3300025919 Bacteria 3464
188 Ga0207649_10018754 3300025920 Bacteria 3942
189 Ga0207652_10089644 3300025921 Bacteria 2701
190 Ga0207681_10007974 3300025923 Bacteria 6475
191 Ga0207694_10018878 3300025924 Bacteria 5212
192 Ga0207694_10036105 3300025924 Bacteria 3792
193 Ga0207690_10045350 3300025932 Bacteria 2904
194 Ga0207706_10009462 3300025933 Bacteria 8951
195 Ga0207706_10017999 3300025933 Bacteria 6358
196 Ga0207709_10000138 3300025935 Bacteria 104006
197 Ga0207709_10000247 3300025935 Bacteria 66618
198 Ga0207709_10011772 3300025935 Bacteria 4823
199 Ga0207704_10002133 3300025938 Bacteria 8872
200 Ga0207691_10028965 3300025940 Bacteria 5182
201 Ga0207679_10019920 3300025945 Bacteria 4518
202 Ga0207679_10021758 3300025945 Bacteria 4354
203 Ga0207667_10017442 3300025949 Bacteria 8078
204 Ga0207667_10031876 3300025949 Bacteria 5684
205 Ga0207667_10042639 3300025949 Bacteria 4821
206 Ga0207708_10005130 3300026075 Bacteria 9662
207 Ga0207674_10074952 3300026116 Bacteria 3394
208 Ga0207675_100024840 3300026118 Bacteria 5576
209 Ga0207683_10027215 3300026121 Bacteria 4940
210 Ga0209281_1000005 3300027111 Bacteria 1242284
211 Ga0209281_1000039 3300027111 Bacteria 355150
212 Ga0209282_1000506 3300027666 Bacteria 18952
213 Ga0268264_10000909 3300028381 Bacteria 31074
214 Ga0265336_10000030 3300028666 Bacteria 169335
215 Ga0307515_10000058 3300028794 Bacteria 259680
216 Ga0307515_10001320 3300028794 Bacteria 56334
217 Ga0307515_10003119 3300028794 Bacteria 35049
218 Ga0307515_10021366 3300028794 Bacteria 11486
219 Ga0307515_10086010 3300028794 Bacteria 4015
220 Ga0265324_10001751 3300029957 Bacteria 11936
221 Ga0307512_10009127 3300030522 Bacteria 9589
222 Ga0316183_1155106 3300030742 Bacteria 2811
223 Ga0316182_1004888 3300030745 Bacteria 2542
224 Ga0265330_10025914 3300031235 Bacteria 2656
225 Ga0265332_10027721 3300031238 Bacteria 2480
226 Ga0265331_10011757 3300031250 Bacteria 4781
227 Ga0265327_10000412 3300031251 Bacteria 78684
228 Ga0265327_10007407 3300031251 Bacteria 8485
229 Ga0307513_10000246 3300031456 Bacteria 78455
230 Ga0307513_10000256 3300031456 Bacteria 76296
231 Ga0307513_10005219 3300031456 Bacteria 17204
232 Ga0307513_10007028 3300031456 Bacteria 14643
233 Ga0307513_10068351 3300031456 Bacteria 3722
234 Ga0307509_10000157 3300031507 Bacteria 106022
235 Ga0307408_100002072 3300031548 Bacteria 14440
236 Ga0307514_10006983 3300031649 Bacteria 9763
237 Ga0307514_10024580 3300031649 Bacteria 4874
238 Ga0307516_10001463 3300031730 Bacteria 32614
239 Ga0307406_10000837 3300031901 Bacteria 17272
240 Ga0307416_100007966 3300032002 Bacteria 6785
241 Ga0307411_10074409 3300032005 Bacteria 2314
242 Ga0307510_10025480 3300033180 Bacteria 6818
243 Ga0373933_0041809 3300035724 Bacteria 2707
244 Ga0373937_0019921 3300036401 Bacteria 6009
245 Ga0373925_0016557 3300037068 Bacteria 5340
246 Ga0395900_0019261 3300037418 Bacteria 6958
247 Ga0395898_0040048 3300037466 Bacteria 4636
248 Ga0395905_0075977 3300037471 Bacteria 3148
249 Ga0395901_0024773 3300038443 Bacteria 6161
250 Ga0395901_0034961 3300038443 Bacteria 5191
251 Ga0436361_0063474 3300039447 Bacteria 40373
252 Ga0436361_0239425 3300039447 Bacteria 40455
253 Ga0436361_0572581 3300039447 Bacteria 116104
254 Ga0436361_0919876 3300039447 Bacteria 112731
255 Ga0436361_1125703 3300039447 Bacteria 66289
256 Ga0450923_000687 3300042125 Bacteria 3968
257 Ga0450909_002908 3300042185 Bacteria 2432
258 Ga0439434_0017677 3300042435 Bacteria 2134
259 Ga0450918_003094 3300042531 Bacteria 3108
260 Ga0451577_0003782 3300042876 Bacteria 16481
261 Ga0466969_0011204 3300044656 Bacteria 4746
262 Ga0466959_0010501 3300045049 Bacteria 6623
263 Ga0451576_0000033 3300045051 Bacteria 393131
264 Ga0466958_0001040 3300045836 Bacteria 12689
265 Ga0495617_028717 3300046452 Bacteria 1869
266 Ga0495590_0025324 3300046457 Bacteria 2086
267 Ga0495638_0016957 3300046460 Bacteria 4869
268 Ga0495638_0080015 3300046460 Bacteria 1986
269 Ga0495650_0000712 3300046471 Bacteria 42514
270 Ga0495605_0016821 3300046474 Bacteria 3951
271 Ga0495584_0000881 3300046491 Bacteria 19333
272 Ga0495607_0000128 3300046501 Bacteria 80585
273 Ga0495607_0043730 3300046501 Bacteria 2646
274 Ga0495583_0000004 3300046506 Bacteria 655287
275 Ga0495610_0008922 3300046512 Bacteria 6420
276 Ga0495616_0001379 3300046513 Bacteria 16921
277 Ga0495616_0024175 3300046513 Bacteria 3261
278 Ga0495631_0000052 3300046518 Bacteria 71251
279 Ga0495643_0000040 3300046522 Bacteria 234837
280 Ga0495644_0002199 3300046523 Bacteria 7823
281 Ga0495644_0021616 3300046523 Bacteria 2453
282 Ga0495648_0006981 3300046524 Bacteria 9108
283 Ga0495609_0001810 3300046538 Bacteria 13719
284 Ga0495633_0003720 3300046558 Bacteria 10049
285 Ga0495633_0014409 3300046558 Bacteria 4136
286 Ga0495625_0000197 3300046660 Bacteria 95865
287 Ga0495625_0006244 3300046660 Bacteria 10672
288 Ga0495625_0008362 3300046660 Bacteria 8835
289 Ga0495625_0013407 3300046660 Bacteria 6587
290 Ga0495659_0007993 3300046664 Bacteria 3357
291 Ga0495658_0031733 3300046683 Bacteria 2879
292 Ga0495624_0007785 3300046690 Bacteria 7517
293 Ga0495671_0052870 3300046692 Bacteria 2017
294 Ga0495636_0000435 3300047318 Bacteria 15493
295 Ga0495676_0004178 3300047321 Bacteria 13185
296 Ga0495676_0093513 3300047321 Bacteria 2242
297 Ga0495683_0008102 3300047323 Bacteria 5641
298 Ga0495683_0021643 3300047323 Bacteria 3313
299 Ga0495687_000853 3300047443 Bacteria 32520
300 Ga0495677_0007475 3300047445 Bacteria 4081
301 Ga0495685_000140 3300047447 Bacteria 24726
302 Ga0495686_0000960 3300047472 Bacteria 35489
303 Ga0495593_0030889 3300047673 Bacteria 2929
304 Ga0496113_0122687 3300048916 Bacteria 2033
305 Ga0496116_0000003 3300048919 Bacteria 858374
306 Ga0496116_0010488 3300048919 Bacteria 7756
307 Ga0496116_0031010 3300048919 Bacteria 3835
308 Ga0496117_0071882 3300048920 Bacteria 2316
309 Ga0496118_0011223 3300048921 Bacteria 8770
310 Ga0496119_0051544 3300048922 Bacteria 2528
311 Ga0496120_0004720 3300048923 Bacteria 11221
312 Ga0496121_0000127 3300048924 Bacteria 168545
313 Ga0496121_0002908 3300048924 Bacteria 25115
314 Ga0496121_0009656 3300048924 Bacteria 11052
315 Ga0496122_0000528 3300048925 Bacteria 79201
316 Ga0496122_0000601 3300048925 Bacteria 74140
317 Ga0496122_0011863 3300048925 Bacteria 8758
318 Ga0496123_0000308 3300048926 Bacteria 94712
319 Ga0496123_0000411 3300048926 Bacteria 78453
320 Ga0496123_0014471 3300048926 Bacteria 6536
321 Ga0496124_0015334 3300048927 Bacteria 7354
322 Ga0496124_0025620 3300048927 Bacteria 5339
323 Ga0496124_0056479 3300048927 Bacteria 3310
324 Ga0496125_0000011 3300048928 Bacteria 655895
325 Ga0496125_0000049 3300048928 Bacteria 287250
326 Ga0496125_0000519 3300048928 Bacteria 66983
327 Ga0496125_0012250 3300048928 Bacteria 8527
328 Ga0496125_0017362 3300048928 Bacteria 6865
329 Ga0496126_0011258 3300048929 Bacteria 9280
330 Ga0496126_0085200 3300048929 Bacteria 2786
331 Ga0495678_001203 3300049459 Bacteria 21302
332 Ga0495682_0000768 3300049460 Bacteria 20542
333 Ga0495682_0001903 3300049460 Bacteria 10398
334 Ga0501032_0000583 3300049569 Bacteria 29496
335 Ga0501033_0098406 3300049570 Bacteria 2136
336 Ga0501038_0056696 3300049574 Bacteria 3365
337 Ga0501043_0039653 3300049579 Bacteria 3702
338 Ga0501047_0010255 3300049581 Bacteria 8864
339 Ga0501047_0060223 3300049581 Bacteria 3664
340 Ga0501048_0090315 3300049582 Bacteria 2161
341 Ga0501035_0008088 3300049822 Bacteria 9800
342 Ga0501035_0028154 3300049822 Bacteria 5131
343 Ga0501035_0073260 3300049822 Bacteria 3030
344 Ga0501035_0084777 3300049822 Bacteria 2794
345 Ga0501044_0000062 3300049823 Bacteria 131395
346 Ga0501044_0009758 3300049823 Bacteria 10443
347 Ga0501044_0013070 3300049823 Bacteria 8984
348 nmdc:mga03683_1045_c1 3300050489 Bacteria 8086
349 nmdc:mga00v17_58886_c1 3300050491 Bacteria 2355
350 nmdc:mga0yw44_2631_c1 3300050492 Bacteria 7730
351 nmdc:mga0k408_23287_c1 3300050493 Bacteria 3492
352 nmdc:mga0k408_40049_c1 3300050493 Bacteria 2695
353 nmdc:mga0k408_4416_c1 3300050493 Bacteria 7468
354 nmdc:mga0k408_5914_c1 3300050493 Bacteria 6525
355 nmdc:mga07m45_17327_c1 3300050496 Bacteria 3867
356 nmdc:mga07m45_819_c1 3300050496 Bacteria 13435
357 Ga0500651_0000026 3300053093 Bacteria 117323
358 Ga0500557_000019 3300053105 Bacteria 93216
359 Ga0500571_000121 3300053110 Bacteria 25770
360 Ga0500658_0000364 3300053134 Bacteria 19978
361 Ga0500559_0003626 3300053136 Bacteria 7552
362 Ga0500619_005047 3300053154 Bacteria 2903
363 Ga0500645_001378 3300053730 Bacteria 12439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0080015 Ga0495638_0080015_578_1960 459
2 3300049582 Ga0501048_0090315 Ga0501048_0090315_17_1564 486
3 3300005457 Ga0070662_100059179 Ga0070662_1000591792 501
4 3300009545 Ga0105237_10032225 Ga0105237_100322252 501
5 3300010375 Ga0105239_10021274 Ga0105239_100212743 501
6 3300025914 Ga0207671_10119673 Ga0207671_101196732 501
7 3300025933 Ga0207706_10017999 Ga0207706_100179997 501
8 3300046660 Ga0495625_0008362 Ga0495625_0008362_2214_3845 501
9 3300050493 nmdc:mga0k408_40049_c1 nmdc:mga0k408_40049_c1_824_2455 501
10 3300021361 Ga0213872_10002909 Ga0213872_100029095 504
11 3300039447 Ga0436361_0063474 Ga0436361_0063474_15345_16982 504
12 3300050491 nmdc:mga00v17_58886_c1 nmdc:mga00v17_58886_c1_150_1772 506
13 iso_pu_bacteria 2842747753 2842748150 508
14 3300031251 Ga0265327_10007407 Ga0265327_100074072 509
15 3300048919 Ga0496116_0010488 Ga0496116_0010488_1965_3605 510
16 3300048925 Ga0496122_0000601 Ga0496122_0000601_53877_55517 510
17 3300048926 Ga0496123_0000411 Ga0496123_0000411_64446_66086 510
18 3300048927 Ga0496124_0056479 Ga0496124_0056479_662_2302 510
19 3300048929 Ga0496126_0085200 Ga0496126_0085200_333_1973 510
20 3300053136 Ga0500559_0003626 Ga0500559_0003626_2058_3665 511
21 iso_pu_bacteria 2842733646 2842735373 511
22 3300048920 Ga0496117_0071882 Ga0496117_0071882_495_2141 512
23 3300048922 Ga0496119_0051544 Ga0496119_0051544_10_1650 512
24 3300048923 Ga0496120_0004720 Ga0496120_0004720_5877_7517 512
25 3300048924 Ga0496121_0000127 Ga0496121_0000127_128176_129816 512
26 3300048924 Ga0496121_0002908 Ga0496121_0002908_7622_9298 512
27 3300048926 Ga0496123_0014471 Ga0496123_0014471_4257_5897 512
28 3300048928 Ga0496125_0000011 Ga0496125_0000011_560745_562385 512
29 3300003187 JGI25151J46595_10000316 JGI25151J46595_100003162 513
30 3300003775 Ga0055524_1000237 Ga0055524_100023747 513
31 3300025294 Ga0209025_1000057 Ga0209025_100005775 513
32 3300025299 Ga0209256_1000045 Ga0209256_1000045310 513
33 3300031251 Ga0265327_10000412 Ga0265327_1000041210 513
34 3300031456 Ga0307513_10000256 Ga0307513_1000025628 513
35 3300046683 Ga0495658_0031733 Ga0495658_0031733_659_2296 513
36 3300049570 Ga0501033_0098406 Ga0501033_0098406_328_1989 513
37 3300049581 Ga0501047_0010255 Ga0501047_0010255_4606_6267 513
38 3300049822 Ga0501035_0008088 Ga0501035_0008088_723_2384 513
39 3300049823 Ga0501044_0013070 Ga0501044_0013070_586_2247 513
40 3300025272 Ga0209455_1000453 Ga0209455_100045326 514
41 3300025294 Ga0209025_1012088 Ga0209025_10120883 514
42 3300048925 Ga0496122_0011863 Ga0496122_0011863_234_1946 514
43 3300048928 Ga0496125_0000519 Ga0496125_0000519_6747_8459 514
44 3300048928 Ga0496125_0017362 Ga0496125_0017362_1286_2962 514
45 3300048929 Ga0496126_0011258 Ga0496126_0011258_7538_9250 514
46 3300028666 Ga0265336_10000030 Ga0265336_1000003081 515
47 3300028794 Ga0307515_10086010 Ga0307515_100860104 515
48 3300029957 Ga0265324_10001751 Ga0265324_100017519 515
49 3300044656 Ga0466969_0011204 Ga0466969_0011204_1080_2705 515
50 3300025263 Ga0209565_1002341 Ga0209565_10023413 516
51 3300047472 Ga0495686_0000960 Ga0495686_0000960_18149_19780 516
52 3300050496 nmdc:mga07m45_819_c1 nmdc:mga07m45_819_c1_2333_3964 516
53 3300006051 Ga0075364_10058247 Ga0075364_100582472 517
54 3300035724 Ga0373933_0041809 Ga0373933_0041809_542_2188 517
55 3300036401 Ga0373937_0019921 Ga0373937_0019921_2971_4617 517
56 iso_pu_bacteria 2919704043 2919705690 517
57 3300028794 Ga0307515_10021366 Ga0307515_100213669 518
58 3300031235 Ga0265330_10025914 Ga0265330_100259142 519
59 3300031238 Ga0265332_10027721 Ga0265332_100277211 519
60 3300031250 Ga0265331_10011757 Ga0265331_100117576 519
61 3300045049 Ga0466959_0010501 Ga0466959_0010501_1649_3268 519
62 3300006038 Ga0075365_10001209 Ga0075365_100012097 520
63 3300045051 Ga0451576_0000033 Ga0451576_0000033_240893_242527 520
64 3300048924 Ga0496121_0009656 Ga0496121_0009656_2437_4098 520
65 3300050492 nmdc:mga0yw44_2631_c1 nmdc:mga0yw44_2631_c1_3456_5093 520
66 3300006048 Ga0075363_100008214 Ga0075363_1000082143 521
67 3300006195 Ga0075366_10006298 Ga0075366_100062982 521
68 3300006353 Ga0075370_10026649 Ga0075370_100266493 521
69 3300009036 Ga0105244_10003449 Ga0105244_100034494 521
70 3300021361 Ga0213872_10004337 Ga0213872_100043375 521
71 3300039447 Ga0436361_0239425 Ga0436361_0239425_18668_20293 521
72 3300045836 Ga0466958_0001040 Ga0466958_0001040_7309_8937 521
73 3300046512 Ga0495610_0008922 Ga0495610_0008922_4746_6356 521
74 3300049581 Ga0501047_0060223 Ga0501047_0060223_1977_3602 521
75 3300049822 Ga0501035_0084777 Ga0501035_0084777_789_2414 521
76 3300005327 Ga0070658_10009519 Ga0070658_100095193 522
77 3300025909 Ga0207705_10045774 Ga0207705_100457743 522
78 3300037418 Ga0395900_0019261 Ga0395900_0019261_3262_4893 522
79 3300037466 Ga0395898_0040048 Ga0395898_0040048_1581_3212 522
80 3300038443 Ga0395901_0024773 Ga0395901_0024773_839_2470 522
81 3300038443 Ga0395901_0034961 Ga0395901_0034961_2785_4416 522
82 3300046471 Ga0495650_0000712 Ga0495650_0000712_37487_39100 522
83 3300046660 Ga0495625_0006244 Ga0495625_0006244_8682_10295 522
84 3300005530 Ga0070679_100025459 Ga0070679_1000254595 523
85 3300005563 Ga0068855_100016022 Ga0068855_1000160228 523
86 3300009093 Ga0105240_10003337 Ga0105240_1000333721 523
87 3300009551 Ga0105238_10049397 Ga0105238_100493974 523
88 3300025921 Ga0207652_10089644 Ga0207652_100896443 523
89 3300025924 Ga0207694_10036105 Ga0207694_100361054 523
90 3300025949 Ga0207667_10042639 Ga0207667_100426395 523
91 3300046558 Ga0495633_0003720 Ga0495633_0003720_5262_6881 523
92 3300048919 Ga0496116_0000003 Ga0496116_0000003_273560_275179 523
93 iso_pu_bacteria 2881412998 2881414739 523
94 iso_pu_bacteria 8019638758 8019639740 523
95 3300002987 JGI25159J45721_1001172 JGI25159J45721_10011729 524
96 3300003354 JGI25160J50197_1000188 JGI25160J50197_100018825 524
97 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000754 524
98 3300003771 Ga0055526_1003935 Ga0055526_10039354 524
99 3300004625 Ga0055543_1000842 Ga0055543_100084210 524
100 3300005367 Ga0070667_100072203 Ga0070667_1000722032 524
101 3300005456 Ga0070678_100030298 Ga0070678_1000302983 524
102 3300015262 Ga0182007_10003651 Ga0182007_100036516 524
103 3300025208 Ga0209436_106361 Ga0209436_1063612 524
104 3300025284 Ga0209130_1000289 Ga0209130_10002894 524
105 3300025295 Ga0209564_1000579 Ga0209564_10005794 524
106 3300025298 Ga0209050_1002038 Ga0209050_100203814 524
107 3300025302 Ga0207426_1000091 Ga0207426_1000091166 524
108 3300026121 Ga0207683_10027215 Ga0207683_100272152 524
109 3300037471 Ga0395905_0075977 Ga0395905_0075977_12_1652 524
110 3300046452 Ga0495617_028717 Ga0495617_028717_42_1661 524
111 3300046457 Ga0495590_0025324 Ga0495590_0025324_63_1682 524
112 3300046460 Ga0495638_0016957 Ga0495638_0016957_1304_2923 524
113 3300046474 Ga0495605_0016821 Ga0495605_0016821_594_2213 524
114 3300046491 Ga0495584_0000881 Ga0495584_0000881_337_1956 524
115 3300046501 Ga0495607_0043730 Ga0495607_0043730_554_2173 524
116 3300046506 Ga0495583_0000004 Ga0495583_0000004_587871_589490 524
117 3300046513 Ga0495616_0024175 Ga0495616_0024175_863_2482 524
118 3300046523 Ga0495644_0002199 Ga0495644_0002199_5674_7293 524
119 3300046523 Ga0495644_0021616 Ga0495644_0021616_433_2052 524
120 3300046524 Ga0495648_0006981 Ga0495648_0006981_44_1663 524
121 3300046538 Ga0495609_0001810 Ga0495609_0001810_474_2093 524
122 3300046558 Ga0495633_0014409 Ga0495633_0014409_416_2035 524
123 3300046660 Ga0495625_0013407 Ga0495625_0013407_2112_3731 524
124 3300046664 Ga0495659_0007993 Ga0495659_0007993_1466_3085 524
125 3300046692 Ga0495671_0052870 Ga0495671_0052870_62_1681 524
126 3300047318 Ga0495636_0000435 Ga0495636_0000435_3390_5009 524
127 3300047323 Ga0495683_0008102 Ga0495683_0008102_3531_5150 524
128 3300047443 Ga0495687_000853 Ga0495687_000853_2857_4476 524
129 3300047445 Ga0495677_0007475 Ga0495677_0007475_1174_2793 524
130 3300047447 Ga0495685_000140 Ga0495685_000140_20557_22176 524
131 3300048916 Ga0496113_0122687 Ga0496113_0122687_178_1827 524
132 3300049459 Ga0495678_001203 Ga0495678_001203_5641_7260 524
133 3300049460 Ga0495682_0000768 Ga0495682_0000768_5080_6699 524
134 3300049460 Ga0495682_0001903 Ga0495682_0001903_5137_6756 524
135 iso_pu_bacteria 2643221621 2644122497 524
136 iso_pu_bacteria 2857537821 2857540816 524
137 iso_pu_bacteria 2857542790 2857543226 524
138 iso_pu_bacteria 2857576091 2857576530 524
139 iso_pu_bacteria 2858950400 2858956463 524
140 iso_pu_bacteria 2881927736 2881927957 524
141 iso_pu_bacteria 2887375801 2887379111 524
142 iso_pu_bacteria 8002392321 8002393739 524
143 3300003354 JGI25160J50197_1006588 JGI25160J50197_10065882 525
144 3300005327 Ga0070658_10025947 Ga0070658_100259471 525
145 3300005563 Ga0068855_100002740 Ga0068855_1000027407 525
146 3300021361 Ga0213872_10005959 Ga0213872_100059595 525
147 3300028794 Ga0307515_10003119 Ga0307515_1000311935 525
148 3300039447 Ga0436361_0919876 Ga0436361_0919876_102234_103862 525
149 3300046690 Ga0495624_0007785 Ga0495624_0007785_1103_2746 525
150 3300047321 Ga0495676_0093513 Ga0495676_0093513_22_1665 525
151 3300053105 Ga0500557_000019 Ga0500557_000019_42666_44387 525
152 iso_pu_bacteria 2945984333 2945988802 525
153 3300006048 Ga0075363_100045609 Ga0075363_1000456092 526
154 3300049823 Ga0501044_0000062 Ga0501044_0000062_123722_125374 526
155 iso_pu_bacteria 2513020051 2513227461 526
156 iso_pu_bacteria 2643221628 2644161036 526
157 iso_pu_bacteria 2643221658 2644326350 526
158 iso_pu_bacteria 2643221672 2644397161 526
159 iso_pu_bacteria 2643221683 2644469616 526
160 iso_pu_bacteria 2738541277 2738719571 526
161 iso_pu_bacteria 2738541307 2738884434 526
162 iso_pu_bacteria 2738543012 2739243127 526
163 iso_pu_bacteria 2738543019 2739283607 526
164 iso_pu_bacteria 2816332133 2816473699 526
165 iso_pu_bacteria 2831265667 2831270675 526
166 iso_pu_bacteria 2838054893 2838058716 526
167 iso_pu_bacteria 2842677519 2842682753 526
168 iso_pu_bacteria 2885198086 2885202571 526
169 iso_pu_bacteria 2885211737 2885216224 526
170 iso_pu_bacteria 2899924645 2899929709 526
171 iso_pu_bacteria 2904449895 2904455555 526
172 iso_pu_bacteria 2904456579 2904462166 526
173 iso_pu_bacteria 2904541872 2904548971 526
174 iso_pu_bacteria 2919462493 2919464690 526
175 iso_pu_bacteria 2928037797 2928042351 526
176 iso_pu_bacteria 2928044640 2928050120 526
177 iso_pu_bacteria 2928051484 2928054701 526
178 iso_pu_bacteria 2928064002 2928070290 526
179 iso_pu_bacteria 2928070936 2928074025 526
180 iso_pu_bacteria 2928084124 2928086308 526
181 iso_pu_bacteria 2929160207 2929160910 526
182 iso_pu_bacteria 2929520902 2929526745 526
183 iso_pu_bacteria 2945909444 2945915764 526
184 iso_pu_bacteria 2945945610 2945950242 526
185 3300042876 Ga0451577_0003782 Ga0451577_0003782_14503_16131 527
186 3300049822 Ga0501035_0028154 Ga0501035_0028154_1101_2762 527
187 iso_pu_bacteria 2721755523 2722884299 527
188 iso_pu_bacteria 2839138175 2839140466 527
189 3300006946 Ga0079104_1000004 Ga0079104_1000004288 528
190 3300009148 Ga0105243_10000352 Ga0105243_100003527 528
191 3300025245 Ga0207425_1002837 Ga0207425_10028372 528
192 3300025294 Ga0209025_1002159 Ga0209025_10021594 528
193 3300025935 Ga0207709_10000138 Ga0207709_1000013894 528
194 3300027111 Ga0209281_1000005 Ga0209281_1000005496 528
195 3300046501 Ga0495607_0000128 Ga0495607_0000128_25888_27585 528
196 3300048927 Ga0496124_0025620 Ga0496124_0025620_1847_3520 528
197 3300049569 Ga0501032_0000583 Ga0501032_0000583_26411_28105 528
198 3300049574 Ga0501038_0056696 Ga0501038_0056696_1463_3148 528
199 3300049579 Ga0501043_0039653 Ga0501043_0039653_94_1779 528
200 3300049822 Ga0501035_0073260 Ga0501035_0073260_1293_2978 528
201 3300049823 Ga0501044_0009758 Ga0501044_0009758_8349_10034 528
202 iso_pu_bacteria 2547132374 2548501474 528
203 iso_pu_bacteria 2643221596 2643994406 528
204 iso_pu_bacteria 2643221609 2644061431 528
205 iso_pu_bacteria 2643221611 2644074962 528
206 iso_pu_bacteria 2643221652 2644295243 528
207 iso_pu_bacteria 2643221717 2644648979 528
208 iso_pu_bacteria 2990710928 2990715331 528
209 3300031456 Ga0307513_10005219 Ga0307513_100052195 529
210 3300031649 Ga0307514_10006983 Ga0307514_100069837 529
211 3300047323 Ga0495683_0021643 Ga0495683_0021643_637_2367 529
212 iso_pu_bacteria 2511231002 2511245328 529
213 3300003187 JGI25151J46595_10015503 JGI25151J46595_100155032 530
214 3300003761 Ga0055535_1000460 Ga0055535_100046010 530
215 3300003762 Ga0055542_1000092 Ga0055542_100009261 530
216 3300003773 Ga0055537_1000127 Ga0055537_100012712 530
217 3300003781 Ga0055536_1000469 Ga0055536_100046911 530
218 3300003784 Ga0055534_1000373 Ga0055534_100037312 530
219 3300003790 Ga0055528_1001226 Ga0055528_10012268 530
220 3300003790 Ga0055528_1017894 Ga0055528_10178942 530
221 3300003791 Ga0055530_10010261 Ga0055530_100102612 530
222 3300003792 Ga0055540_1000697 Ga0055540_100069715 530
223 3300003792 Ga0055540_1001110 Ga0055540_100111010 530
224 3300003792 Ga0055540_1005319 Ga0055540_10053192 530
225 3300003794 Ga0055531_10008380 Ga0055531_100083805 530
226 3300005564 Ga0070664_100005695 Ga0070664_1000056952 530
227 3300005577 Ga0068857_100119843 Ga0068857_1001198432 530
228 3300006048 Ga0075363_100023851 Ga0075363_1000238512 530
229 3300006948 Ga0099826_10000629 Ga0099826_100006293 530
230 3300009545 Ga0105237_10047376 Ga0105237_100473763 530
231 3300017792 Ga0163161_10000076 Ga0163161_1000007650 530
232 3300017792 Ga0163161_10013465 Ga0163161_100134653 530
233 3300025263 Ga0209565_1000070 Ga0209565_100007092 530
234 3300025273 Ga0209673_1000234 Ga0209673_100023467 530
235 3300025273 Ga0209673_1002285 Ga0209673_10022858 530
236 3300025291 Ga0209675_1000069 Ga0209675_100006992 530
237 3300025292 Ga0209676_1001839 Ga0209676_100183910 530
238 3300025292 Ga0209676_1001955 Ga0209676_100195512 530
239 3300025294 Ga0209025_1000065 Ga0209025_1000065222 530
240 3300025294 Ga0209025_1000325 Ga0209025_100032562 530
241 3300025294 Ga0209025_1008809 Ga0209025_10088092 530
242 3300025298 Ga0209050_1001049 Ga0209050_10010495 530
243 3300025303 Ga0209051_1000182 Ga0209051_100018252 530
244 3300025303 Ga0209051_1000184 Ga0209051_100018414 530
245 3300025303 Ga0209051_1000437 Ga0209051_100043738 530
246 3300025304 Ga0209257_1000397 Ga0209257_100039715 530
247 3300025728 Ga0207655_1006176 Ga0207655_10061765 530
248 3300025924 Ga0207694_10018878 Ga0207694_100188782 530
249 3300025933 Ga0207706_10009462 Ga0207706_100094624 530
250 3300025935 Ga0207709_10000247 Ga0207709_1000024740 530
251 3300025935 Ga0207709_10011772 Ga0207709_100117724 530
252 3300025945 Ga0207679_10021758 Ga0207679_100217584 530
253 3300025949 Ga0207667_10031876 Ga0207667_100318768 530
254 3300026116 Ga0207674_10074952 Ga0207674_100749523 530
255 3300027666 Ga0209282_1000506 Ga0209282_100050612 530
256 3300030742 Ga0316183_1155106 Ga0316183_11551062 530
257 3300030745 Ga0316182_1004888 Ga0316182_10048882 530
258 3300031649 Ga0307514_10024580 Ga0307514_100245803 530
259 3300031901 Ga0307406_10000837 Ga0307406_100008378 530
260 3300032002 Ga0307416_100007966 Ga0307416_1000079666 530
261 3300032005 Ga0307411_10074409 Ga0307411_100744092 530
262 3300042125 Ga0450923_000687 Ga0450923_000687_303_2000 530
263 3300042185 Ga0450909_002908 Ga0450909_002908_449_2146 530
264 3300042435 Ga0439434_0017677 Ga0439434_0017677_39_1736 530
265 3300046660 Ga0495625_0000197 Ga0495625_0000197_42582_44279 530
266 3300050489 nmdc:mga03683_1045_c1 nmdc:mga03683_1045_c1_5873_7600 530
267 3300050493 nmdc:mga0k408_23287_c1 nmdc:mga0k408_23287_c1_88_1875 530
268 3300050493 nmdc:mga0k408_4416_c1 nmdc:mga0k408_4416_c1_4695_6356 530
269 3300050496 nmdc:mga07m45_17327_c1 nmdc:mga07m45_17327_c1_53_1840 530
270 iso_pu_bacteria 2939631187 2939633201 530
271 3300005353 Ga0070669_100010848 Ga0070669_1000108483 531
272 3300005441 Ga0070700_100006303 Ga0070700_1000063033 531
273 3300005543 Ga0070672_100013188 Ga0070672_1000131883 531
274 3300005719 Ga0068861_100016885 Ga0068861_1000168854 531
275 3300005842 Ga0068858_100065041 Ga0068858_1000650411 531
276 3300005843 Ga0068860_100033799 Ga0068860_1000337994 531
277 3300006881 Ga0068865_100003574 Ga0068865_1000035747 531
278 3300009553 Ga0105249_10009715 Ga0105249_100097157 531
279 3300013297 Ga0157378_10022757 Ga0157378_100227573 531
280 3300013306 Ga0163162_10017155 Ga0163162_100171554 531
281 3300013308 Ga0157375_10121441 Ga0157375_101214411 531
282 3300017792 Ga0163161_10023369 Ga0163161_100233693 531
283 3300025923 Ga0207681_10007974 Ga0207681_100079746 531
284 3300025938 Ga0207704_10002133 Ga0207704_100021334 531
285 3300025940 Ga0207691_10028965 Ga0207691_100289654 531
286 3300026075 Ga0207708_10005130 Ga0207708_100051307 531
287 3300026118 Ga0207675_100024840 Ga0207675_1000248404 531
288 3300028381 Ga0268264_10000909 Ga0268264_100009098 531
289 3300031456 Ga0307513_10000246 Ga0307513_1000024623 531
290 3300031456 Ga0307513_10068351 Ga0307513_100683512 531
291 3300031730 Ga0307516_10001463 Ga0307516_1000146320 531
292 3300037068 Ga0373925_0016557 Ga0373925_0016557_552_2192 531
293 3300046522 Ga0495643_0000040 Ga0495643_0000040_182373_184037 531
294 3300048928 Ga0496125_0000049 Ga0496125_0000049_242549_244201 531
295 3300050493 nmdc:mga0k408_5914_c1 nmdc:mga0k408_5914_c1_473_2164 531
296 3300053730 Ga0500645_001378 Ga0500645_001378_3600_5360 531
297 iso_pu_bacteria 2599185214 2599622130 531
298 iso_pu_bacteria 2599185226 2599676435 531
299 iso_pu_bacteria 2599185227 2599680463 531
300 iso_pu_bacteria 2599185229 2599692479 531
301 iso_pu_bacteria 2945972063 2945975108 531
302 3300006353 Ga0075370_10012790 Ga0075370_100127903 532
303 3300030522 Ga0307512_10009127 Ga0307512_100091273 532
304 3300031507 Ga0307509_10000157 Ga0307509_100001579 532
305 3300033180 Ga0307510_10025480 Ga0307510_100254805 532
306 3300053154 Ga0500619_005047 Ga0500619_005047_968_2596 532
307 iso_pu_bacteria 2818991446 2819598891 532
308 iso_pu_bacteria 2954767861 2954770289 532
309 3300002704 JGI25155J39150_1000042 JGI25155J39150_100004254 533
310 3300002705 JGI25156J39149_1000053 JGI25156J39149_100005327 533
311 3300002738 JGI25154J39366_1000082 JGI25154J39366_100008227 533
312 3300002741 JGI25157J39369_1000072 JGI25157J39369_100007254 533
313 3300002774 JGI25150J39212_1004227 JGI25150J39212_10042272 533
314 3300002987 JGI25159J45721_1004516 JGI25159J45721_10045164 533
315 3300003187 JGI25151J46595_10002989 JGI25151J46595_100029896 533
316 3300003187 JGI25151J46595_10006986 JGI25151J46595_100069864 533
317 3300003771 Ga0055526_1002015 Ga0055526_10020154 533
318 3300003773 Ga0055537_1000243 Ga0055537_100024333 533
319 3300003775 Ga0055524_1000213 Ga0055524_100021354 533
320 3300003781 Ga0055536_1000526 Ga0055536_10005266 533
321 3300003784 Ga0055534_1001447 Ga0055534_10014472 533
322 3300003784 Ga0055534_1002616 Ga0055534_10026163 533
323 3300003790 Ga0055528_1000316 Ga0055528_100031633 533
324 3300003791 Ga0055530_10001317 Ga0055530_100013176 533
325 3300003791 Ga0055530_10001521 Ga0055530_100015214 533
326 3300003791 Ga0055530_10003710 Ga0055530_100037104 533
327 3300003792 Ga0055540_1000176 Ga0055540_100017633 533
328 3300003792 Ga0055540_1018921 Ga0055540_10189211 533
329 3300003794 Ga0055531_10000850 Ga0055531_1000085020 533
330 3300003794 Ga0055531_10001384 Ga0055531_100013844 533
331 3300003794 Ga0055531_10018740 Ga0055531_100187402 533
332 3300005467 Ga0070706_100002907 Ga0070706_10000290712 533
333 3300005539 Ga0068853_100028329 Ga0068853_1000283296 533
334 3300011119 Ga0105246_10014735 Ga0105246_100147355 533
335 3300015262 Ga0182007_10002585 Ga0182007_100025853 533
336 3300025206 Ga0209435_100019 Ga0209435_100019159 533
337 3300025245 Ga0207425_1002808 Ga0207425_10028084 533
338 3300025246 Ga0209646_1000038 Ga0209646_1000038160 533
339 3300025250 Ga0209026_1000048 Ga0209026_1000048159 533
340 3300025256 Ga0209759_1000038 Ga0209759_100003885 533
341 3300025258 Ga0209129_1000136 Ga0209129_100013651 533
342 3300025263 Ga0209565_1000026 Ga0209565_10000264 533
343 3300025263 Ga0209565_1000312 Ga0209565_100031244 533
344 3300025263 Ga0209565_1011834 Ga0209565_10118342 533
345 3300025273 Ga0209673_1000009 Ga0209673_100000913 533
346 3300025273 Ga0209673_1000266 Ga0209673_100026613 533
347 3300025284 Ga0209130_1001571 Ga0209130_10015714 533
348 3300025291 Ga0209675_1000293 Ga0209675_100029348 533
349 3300025291 Ga0209675_1000473 Ga0209675_10004733 533
350 3300025292 Ga0209676_1000013 Ga0209676_1000013232 533
351 3300025292 Ga0209676_1000195 Ga0209676_100019510 533
352 3300025292 Ga0209676_1008088 Ga0209676_10080884 533
353 3300025294 Ga0209025_1000620 Ga0209025_100062046 533
354 3300025294 Ga0209025_1000728 Ga0209025_100072820 533
355 3300025294 Ga0209025_1006033 Ga0209025_10060334 533
356 3300025295 Ga0209564_1000156 Ga0209564_100015679 533
357 3300025295 Ga0209564_1000620 Ga0209564_100062047 533
358 3300025297 Ga0209758_1000127 Ga0209758_1000127108 533
359 3300025297 Ga0209758_1010234 Ga0209758_10102346 533
360 3300025298 Ga0209050_1000008 Ga0209050_1000008232 533
361 3300025298 Ga0209050_1000021 Ga0209050_1000021401 533
362 3300025299 Ga0209256_1000003 Ga0209256_1000003168 533
363 3300025299 Ga0209256_1000104 Ga0209256_1000104108 533
364 3300025302 Ga0207426_1000149 Ga0207426_1000149108 533
365 3300025302 Ga0207426_1004353 Ga0207426_10043534 533
366 3300025303 Ga0209051_1000005 Ga0209051_1000005232 533
367 3300025303 Ga0209051_1000028 Ga0209051_1000028111 533
368 3300025304 Ga0209257_1000043 Ga0209257_1000043396 533
369 3300025304 Ga0209257_1000048 Ga0209257_1000048232 533
370 3300028794 Ga0307515_10000058 Ga0307515_10000058146 533
371 3300028794 Ga0307515_10001320 Ga0307515_1000132018 533
372 3300031456 Ga0307513_10007028 Ga0307513_100070282 533
373 3300031548 Ga0307408_100002072 Ga0307408_1000020725 533
374 3300046513 Ga0495616_0001379 Ga0495616_0001379_1375_3105 533
375 3300046518 Ga0495631_0000052 Ga0495631_0000052_21843_23573 533
376 3300047321 Ga0495676_0004178 Ga0495676_0004178_4136_5866 533
377 3300047673 Ga0495593_0030889 Ga0495593_0030889_29_1759 533
378 3300048919 Ga0496116_0031010 Ga0496116_0031010_897_2627 533
379 3300048921 Ga0496118_0011223 Ga0496118_0011223_3375_5105 533
380 3300048927 Ga0496124_0015334 Ga0496124_0015334_2995_4722 533
381 3300048928 Ga0496125_0012250 Ga0496125_0012250_1618_3348 533
382 3300053093 Ga0500651_0000026 Ga0500651_0000026_112849_114579 533
383 3300053110 Ga0500571_000121 Ga0500571_000121_12374_14104 533
384 3300053134 Ga0500658_0000364 Ga0500658_0000364_13964_15694 533
385 iso_pu_bacteria 2643221644 2644246733 533
386 3300002774 JGI25150J39212_1000649 JGI25150J39212_10006492 534
387 3300002987 JGI25159J45721_1006223 JGI25159J45721_10062232 534
388 3300003354 JGI25160J50197_1002467 JGI25160J50197_10024675 534
389 3300003775 Ga0055524_1013149 Ga0055524_10131493 534
390 3300005834 Ga0068851_10004697 Ga0068851_100046974 534
391 3300013102 Ga0157371_10021755 Ga0157371_100217557 534
392 3300025242 Ga0209258_100020 Ga0209258_10002096 534
393 3300025254 Ga0209148_1000031 Ga0209148_100003196 534
394 3300025258 Ga0209129_1001641 Ga0209129_10016417 534
395 3300025263 Ga0209565_1011815 Ga0209565_10118151 534
396 3300025273 Ga0209673_1001437 Ga0209673_100143718 534
397 3300025294 Ga0209025_1004012 Ga0209025_100401210 534
398 3300025295 Ga0209564_1000101 Ga0209564_100010194 534
399 3300025299 Ga0209256_1000137 Ga0209256_1000137101 534
400 3300025302 Ga0207426_1000478 Ga0207426_100047815 534
401 3300025321 Ga0207656_10001611 Ga0207656_100016113 534
402 3300048925 Ga0496122_0000528 Ga0496122_0000528_68866_70617 534
403 3300048926 Ga0496123_0000308 Ga0496123_0000308_39560_41311 534
404 3300014326 Ga0157380_10007940 Ga0157380_100079406 536
405 3300021361 Ga0213872_10000009 Ga0213872_10000009112 536
406 3300039447 Ga0436361_0572581 Ga0436361_0572581_88535_90178 536
407 3300003791 Ga0055530_10004518 Ga0055530_100045187 537
408 3300003792 Ga0055540_1000018 Ga0055540_1000018154 537
409 3300005339 Ga0070660_100042686 Ga0070660_1000426861 537
410 3300005344 Ga0070661_100033803 Ga0070661_1000338032 537
411 3300005366 Ga0070659_100004997 Ga0070659_10000499710 537
412 3300006946 Ga0079104_1000012 Ga0079104_1000012280 537
413 3300021361 Ga0213872_10000723 Ga0213872_100007234 537
414 3300025298 Ga0209050_1000683 Ga0209050_10006833 537
415 3300025303 Ga0209051_1000004 Ga0209051_1000004884 537
416 3300025304 Ga0209257_1000360 Ga0209257_100036055 537
417 3300025919 Ga0207657_10054313 Ga0207657_100543133 537
418 3300025920 Ga0207649_10018754 Ga0207649_100187542 537
419 3300025932 Ga0207690_10045350 Ga0207690_100453502 537
420 3300025945 Ga0207679_10019920 Ga0207679_100199202 537
421 3300027111 Ga0209281_1000039 Ga0209281_100003947 537
422 3300039447 Ga0436361_1125703 Ga0436361_1125703_14713_16359 537
423 3300042531 Ga0450918_003094 Ga0450918_003094_1043_2701 537
424 3300001979 JGI24740J21852_10002437 JGI24740J21852_100024373 539
425 3300005563 Ga0068855_100032493 Ga0068855_1000324934 539
426 3300025949 Ga0207667_10017442 Ga0207667_100174424 539

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01645

Glu_synthase

Conserved region in glutamate synthase

157

485

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s6s-assembly1.cif.gz_B structure of azospirillum brasilense glutamate synthase in a4b4 oligomeric state. 0.8062 88 483
1ofd-assembly2.cif.gz_B glutamate synthase from synechocystis sp in complex with 2-oxoglutarate at 2.0 angstrom resolution 0.7987 122 493
7mfm-assembly1.cif.gz_G glutamate synthase, glutamate dehydrogenase counter-enzyme complex 0.7961 93 501
1lm1-assembly1.cif.gz_A structural studies on the synchronization of catalytic centers in glutamate synthase: native enzyme 0.7952 122 502
1ea0-assembly1.cif.gz_A alpha subunit of a. brasilense glutamate synthase 0.7893 88 512
ID Description Score Start End Superfamily
af_Q2FVF4_136_524_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9141 125 496 3.20.20.70
af_Q2FVF4_136_524_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8732 125 496 3.20.20.70
af_Q58746_138_506_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8408 124 486 3.20.20.70
1ea0A03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8066 78 485 3.20.20.70
af_Q58746_138_506_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7792 124 486 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3N5PTR3-F1-model_v4 FMN-binding glutamate synthase family protein 0.969 144 539 GO:0006537
GO:0015930
AF-A0A2W5NYA7-F1-model_v4 FMN-binding glutamate synthase family protein 0.9686 90 532 GO:0006537
GO:0015930
AF-A0A3B9IGI7-F1-model_v4 FMN-binding glutamate synthase family protein 0.9683 157 532 GO:0006537
GO:0015930
AF-A0A4Q6DUA9-F1-model_v4 FMN-binding glutamate synthase family protein 0.968 156 496 GO:0006537
GO:0015930
AF-A0A661NDG4-F1-model_v4 FMN-binding glutamate synthase family protein 0.9678 139 526 GO:0006537
GO:0015930

Feature Viewer

pLDDT pTM Quality
85.14 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map