F441299

General Info

Members Datasets Scaffolds Average Seq Length
426 232 852 155

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0016871|Ga0496121_0016871_5684_6217
Length 177
Sequence MEQSAQLDFQQIRQPALASRETPMRLTVNGKEHVVNDVDDATPLLWVLRDSLGLVGTKYGCGVAQCGACTVHLNGTPVRSCSVPVAAVAGQQITTIEGLAGKDGKLHPLQAAWVEHDVPQCGYCQAGQIMSAAALLRQKPKPSDADIDAAMTGNICRCGTYLRIRKAIHAAAQTAGE

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
215 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
232 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.69
Nodule 0.23
Rhizoplane 2.35
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0016871 3300048924 Bacteria 7509
2 JGI24749J21850_1021640 3300002076 Bacteria 910
3 JGI25159J45721_1009546 3300002987 Bacteria 2551
4 rootH2_10024670 3300003320 Bacteria 13751
5 rootL2_10063930 3300003322 Bacteria 2334
6 rootH1_10177927 3300003323 Bacteria 5236
7 JGI25160J50197_1003223 3300003354 Bacteria 7368
8 Ga0065712_10079960 3300005290 Bacteria 3161
9 Ga0065715_10116328 3300005293 Bacteria 2385
10 Ga0065715_10182018 3300005293 Bacteria 1470
11 Ga0065707_10083220 3300005295 Bacteria 9947
12 Ga0070690_100000409 3300005330 Bacteria 21775
13 Ga0070670_100041071 3300005331 Bacteria 3976
14 Ga0070670_100198440 3300005331 Unclassified 1743
15 Ga0070670_100427216 3300005331 Bacteria 1172
16 Ga0070677_10006652 3300005333 Bacteria 3843
17 Ga0068869_100009254 3300005334 Bacteria 6386
18 Ga0070666_10020313 3300005335 Bacteria 4293
19 Ga0070682_100224088 3300005337 Bacteria 1340
20 Ga0068868_100280155 3300005338 Bacteria 1411
21 Ga0070660_100003207 3300005339 Bacteria 11240
22 Ga0070660_100641730 3300005339 Bacteria 889
23 Ga0070689_100003535 3300005340 Bacteria 10400
24 Ga0070661_100010770 3300005344 Bacteria 6367
25 Ga0070661_100734165 3300005344 Bacteria 806
26 Ga0070692_10295028 3300005345 Bacteria 988
27 Ga0070668_100008273 3300005347 Bacteria 7721
28 Ga0070668_100013484 3300005347 Bacteria 6102
29 Ga0070668_100087290 3300005347 Bacteria 2454
30 Ga0070668_100171579 3300005347 Bacteria 1766
31 Ga0070669_100001616 3300005353 Bacteria 16274
32 Ga0070669_100023048 3300005353 Bacteria 4457
33 Ga0070669_100434311 3300005353 Bacteria 1080
34 Ga0070669_101100770 3300005353 Bacteria 684
35 Ga0070675_100000847 3300005354 Bacteria 21709
36 Ga0070671_100006458 3300005355 Bacteria 9373
37 Ga0070671_100127744 3300005355 Bacteria 2140
38 Ga0070671_101374133 3300005355 Bacteria 624
39 Ga0070674_100630914 3300005356 Bacteria 909
40 Ga0070674_100902921 3300005356 Bacteria 770
41 Ga0070673_100001527 3300005364 Bacteria 13625
42 Ga0070688_100043436 3300005365 Bacteria 2769
43 Ga0070659_100464677 3300005366 Bacteria 1075
44 Ga0070659_100530490 3300005366 Bacteria 1006
45 Ga0070667_100033994 3300005367 Bacteria 4265
46 Ga0070667_100896237 3300005367 Bacteria 825
47 Ga0070701_10003732 3300005438 Bacteria 6079
48 Ga0070701_10012825 3300005438 Bacteria 3791
49 Ga0070705_100017842 3300005440 Bacteria 3711
50 Ga0070700_100041669 3300005441 Bacteria 2815
51 Ga0070700_100181070 3300005441 Bacteria 1467
52 Ga0070694_100122387 3300005444 Bacteria 1868
53 Ga0070663_100228650 3300005455 Bacteria 1464
54 Ga0070678_100009738 3300005456 Bacteria 5839
55 Ga0070678_100385871 3300005456 Bacteria 1213
56 Ga0070662_100006094 3300005457 Bacteria 7747
57 Ga0070662_100021160 3300005457 Bacteria 4439
58 Ga0070662_100037787 3300005457 Bacteria 3425
59 Ga0070681_10132766 3300005458 Bacteria 2421
60 Ga0068867_100032472 3300005459 Bacteria 3776
61 Ga0068867_100219677 3300005459 Bacteria 1531
62 Ga0068867_100530104 3300005459 Bacteria 1017
63 Ga0068867_100962745 3300005459 Bacteria 772
64 Ga0070685_10006119 3300005466 Bacteria 6128
65 Ga0070698_100049259 3300005471 Bacteria 4301
66 Ga0070698_100554059 3300005471 Bacteria 1089
67 Ga0070679_100079274 3300005530 Bacteria 3274
68 Ga0070684_100004422 3300005535 Bacteria 10697
69 Ga0068853_100179756 3300005539 Bacteria 1918
70 Ga0070672_100018337 3300005543 Bacteria 5058
71 Ga0070672_100049749 3300005543 Bacteria 3262
72 Ga0070672_100071061 3300005543 Bacteria 2768
73 Ga0070672_100116406 3300005543 Bacteria 2184
74 Ga0070672_100165448 3300005543 Bacteria 1837
75 Ga0070686_100008551 3300005544 Bacteria 5735
76 Ga0070696_100420290 3300005546 Bacteria 1049
77 Ga0070665_100026953 3300005548 Bacteria 5787
78 Ga0070664_100000952 3300005564 Bacteria 22625
79 Ga0068857_100044674 3300005577 Bacteria 3931
80 Ga0068857_100093725 3300005577 Bacteria 2689
81 Ga0068857_100144331 3300005577 Bacteria 2153
82 Ga0068854_100810258 3300005578 Bacteria 817
83 Ga0070702_100041757 3300005615 Bacteria 2574
84 Ga0068852_100091848 3300005616 Bacteria 2718
85 Ga0068859_100005095 3300005617 Bacteria 13351
86 Ga0068859_101146515 3300005617 Bacteria 856
87 Ga0068864_100000680 3300005618 Bacteria 28480
88 Ga0068866_10010777 3300005718 Bacteria 3931
89 Ga0068866_10713811 3300005718 Bacteria 689
90 Ga0068861_100000011 3300005719 Bacteria 82099
91 Ga0068861_100007883 3300005719 Bacteria 7328
92 Ga0068861_100015531 3300005719 Bacteria 5369
93 Ga0068861_100103594 3300005719 Bacteria 2268
94 Ga0068861_100156250 3300005719 Bacteria 1877
95 Ga0068861_101306075 3300005719 Bacteria 706
96 Ga0068870_10017933 3300005840 Bacteria 3409
97 Ga0068863_100006076 3300005841 Bacteria 11850
98 Ga0068863_100025585 3300005841 Bacteria 5628
99 Ga0068863_100089430 3300005841 Bacteria 2920
100 Ga0068863_100192977 3300005841 Bacteria 1958
101 Ga0068858_100198309 3300005842 Bacteria 1897
102 Ga0068858_101040659 3300005842 Bacteria 803
103 Ga0068860_100030672 3300005843 Bacteria 5170
104 Ga0068860_100038800 3300005843 Bacteria 4557
105 Ga0068860_100535430 3300005843 Bacteria 1172
106 Ga0068862_100000740 3300005844 Bacteria 32753
107 Ga0068862_100001544 3300005844 Bacteria 21055
108 Ga0068862_100004538 3300005844 Bacteria 11703
109 Ga0068862_100014870 3300005844 Bacteria 6464
110 Ga0081455_10168591 3300005937 Bacteria 1670
111 Ga0075363_100056091 3300006048 Bacteria 2111
112 Ga0075362_10035244 3300006177 Bacteria 2183
113 Ga0075367_10012156 3300006178 Bacteria 4579
114 Ga0075366_10047310 3300006195 Bacteria 2550
115 Ga0068871_100027539 3300006358 Bacteria 4447
116 Ga0068871_101449335 3300006358 Bacteria 648
117 Ga0075428_100000232 3300006844 Bacteria 54223
118 Ga0075428_100001159 3300006844 Bacteria 28229
119 Ga0075428_100148238 3300006844 Bacteria 2550
120 Ga0075428_100170948 3300006844 Bacteria 2356
121 Ga0075430_100000945 3300006846 Bacteria 22826
122 Ga0075430_100011263 3300006846 Bacteria 7587
123 Ga0075430_100045635 3300006846 Bacteria 3701
124 Ga0075430_100239364 3300006846 Bacteria 1504
125 Ga0075430_100374201 3300006846 Bacteria 1176
126 Ga0075431_100000356 3300006847 Bacteria 36283
127 Ga0075431_100001939 3300006847 Bacteria 19719
128 Ga0075431_100389586 3300006847 Bacteria 1396
129 Ga0075431_100589832 3300006847 Bacteria 1096
130 Ga0075431_100942561 3300006847 Bacteria 832
131 Ga0075433_10627247 3300006852 Bacteria 943
132 Ga0075434_100282874 3300006871 Bacteria 1678
133 Ga0075429_100000124 3300006880 Bacteria 45454
134 Ga0075429_100002687 3300006880 Bacteria 14975
135 Ga0075429_100758975 3300006880 Bacteria 850
136 Ga0068865_100030583 3300006881 Bacteria 3583
137 Ga0075436_100298182 3300006914 Bacteria 1155
138 Ga0097620_100005096 3300006931 Bacteria 13351
139 Ga0097620_101146581 3300006931 Bacteria 856
140 Ga0079104_1080687 3300006946 Bacteria 670
141 Ga0111539_10000664 3300009094 Bacteria 44364
142 Ga0111539_10033402 3300009094 Bacteria 6245
143 Ga0111539_10045107 3300009094 Bacteria 5278
144 Ga0111539_10223054 3300009094 Bacteria 2195
145 Ga0105245_12300495 3300009098 Bacteria 593
146 Ga0105247_10119598 3300009101 Bacteria 1705
147 Ga0114129_10000468 3300009147 Bacteria 48434
148 Ga0114129_10128310 3300009147 Bacteria 3485
149 Ga0114129_10369405 3300009147 Bacteria 1896
150 Ga0114129_10573664 3300009147 Bacteria 1465
151 Ga0105243_10411192 3300009148 Bacteria 1259
152 Ga0105241_11522030 3300009174 Bacteria 645
153 Ga0105242_10115778 3300009176 Bacteria 2292
154 Ga0105248_10001791 3300009177 Bacteria 23877
155 Ga0105248_11427236 3300009177 Bacteria 783
156 Ga0105248_11595831 3300009177 Bacteria 739
157 Ga0105249_10007113 3300009553 Bacteria 9768
158 Ga0105249_10010879 3300009553 Bacteria 7996
159 Ga0105249_10030522 3300009553 Bacteria 4873
160 Ga0157341_1023341 3300012494 Bacteria 625
161 Ga0157378_10193440 3300013297 Bacteria 1920
162 Ga0157378_10369699 3300013297 Bacteria 1405
163 Ga0157378_11358614 3300013297 Bacteria 753
164 Ga0163162_10036099 3300013306 Bacteria 4925
165 Ga0163162_10342438 3300013306 Bacteria 1628
166 Ga0157375_10055668 3300013308 Bacteria 3901
167 Ga0157375_10062190 3300013308 Bacteria 3709
168 Ga0157375_10257741 3300013308 Bacteria 1905
169 Ga0163163_10013883 3300014325 Bacteria 7388
170 Ga0157380_10004828 3300014326 Bacteria 9393
171 Ga0157380_10017314 3300014326 Bacteria 5331
172 Ga0157380_10301425 3300014326 Bacteria 1476
173 Ga0157380_10507612 3300014326 Bacteria 1173
174 Ga0157380_10717072 3300014326 Bacteria 1007
175 Ga0157380_11575110 3300014326 Bacteria 712
176 Ga0157377_10064213 3300014745 Bacteria 2105
177 Ga0157379_10937711 3300014968 Bacteria 823
178 Ga0157376_11101430 3300014969 Bacteria 820
179 Ga0163161_10104637 3300017792 Bacteria 2110
180 Ga0163161_10225798 3300017792 Bacteria 1452
181 Ga0163161_10313828 3300017792 Bacteria 1238
182 Ga0207425_1005108 3300025245 Bacteria 3800
183 Ga0209565_1004442 3300025263 Bacteria 4260
184 Ga0209758_1012801 3300025297 Bacteria 4648
185 Ga0207656_10007428 3300025321 Bacteria 3989
186 Ga0207682_10079894 3300025893 Bacteria 1400
187 Ga0207642_10008222 3300025899 Bacteria 3567
188 Ga0207680_10045203 3300025903 Bacteria 2595
189 Ga0207645_10322513 3300025907 Bacteria 1030
190 Ga0207643_10045806 3300025908 Bacteria 2471
191 Ga0207707_10116274 3300025912 Bacteria 2337
192 Ga0207660_10046622 3300025917 Bacteria 3059
193 Ga0207662_10002057 3300025918 Bacteria 9965
194 Ga0207657_10517257 3300025919 Bacteria 934
195 Ga0207649_10009959 3300025920 Bacteria 5208
196 Ga0207681_10004252 3300025923 Bacteria 8838
197 Ga0207681_10014813 3300025923 Bacteria 4856
198 Ga0207681_10019425 3300025923 Bacteria 4293
199 Ga0207650_10249548 3300025925 Bacteria 1436
200 Ga0207659_10003167 3300025926 Bacteria 9837
201 Ga0207659_10614608 3300025926 Unclassified 927
202 Ga0207644_10008866 3300025931 Bacteria 6588
203 Ga0207644_10717257 3300025931 Bacteria 834
204 Ga0207690_10425716 3300025932 Bacteria 1063
205 Ga0207690_10833031 3300025932 Bacteria 763
206 Ga0207706_10002212 3300025933 Bacteria 18978
207 Ga0207706_10010461 3300025933 Bacteria 8477
208 Ga0207706_10053760 3300025933 Bacteria 3555
209 Ga0207686_10102684 3300025934 Bacteria 1912
210 Ga0207709_10273063 3300025935 Bacteria 1245
211 Ga0207670_10008569 3300025936 Bacteria 5780
212 Ga0207669_10354983 3300025937 Bacteria 1134
213 Ga0207669_10359427 3300025937 Bacteria 1128
214 Ga0207669_10397466 3300025937 Bacteria 1079
215 Ga0207669_10471091 3300025937 Bacteria 999
216 Ga0207704_10024080 3300025938 Bacteria 3294
217 Ga0207704_10904525 3300025938 Bacteria 742
218 Ga0207691_10024065 3300025940 Bacteria 5728
219 Ga0207691_10058986 3300025940 Bacteria 3490
220 Ga0207691_10060916 3300025940 Bacteria 3429
221 Ga0207691_10065479 3300025940 Bacteria 3289
222 Ga0207691_10133449 3300025940 Bacteria 2192
223 Ga0207711_10006703 3300025941 Bacteria 9690
224 Ga0207689_10003354 3300025942 Bacteria 14654
225 Ga0207679_10022203 3300025945 Bacteria 4317
226 Ga0207679_10176632 3300025945 Bacteria 1763
227 Ga0207679_11735059 3300025945 Bacteria 571
228 Ga0207651_10006826 3300025960 Bacteria 6021
229 Ga0207651_10128928 3300025960 Bacteria 1933
230 Ga0207712_10000868 3300025961 Bacteria 22002
231 Ga0207712_10010192 3300025961 Bacteria 5961
232 Ga0207668_10008124 3300025972 Bacteria 6246
233 Ga0207668_10024262 3300025972 Bacteria 3911
234 Ga0207668_10060341 3300025972 Bacteria 2661
235 Ga0207668_10120203 3300025972 Bacteria 1988
236 Ga0207668_10863337 3300025972 Bacteria 804
237 Ga0207640_10236437 3300025981 Bacteria 1409
238 Ga0207658_10027199 3300025986 Bacteria 4017
239 Ga0207658_10179727 3300025986 Bacteria 1750
240 Ga0207658_10270736 3300025986 Bacteria 1452
241 Ga0207677_10259733 3300026023 Bacteria 1415
242 Ga0207677_11325127 3300026023 Bacteria 662
243 Ga0207703_10391749 3300026035 Bacteria 1287
244 Ga0207703_10866486 3300026035 Bacteria 864
245 Ga0207678_10255627 3300026067 Bacteria 1501
246 Ga0207708_10023274 3300026075 Bacteria 4680
247 Ga0207708_10141280 3300026075 Bacteria 1889
248 Ga0207708_10260709 3300026075 Bacteria 1399
249 Ga0207641_10008373 3300026088 Bacteria 8545
250 Ga0207641_10050990 3300026088 Bacteria 3504
251 Ga0207641_10067883 3300026088 Bacteria 3056
252 Ga0207641_10131856 3300026088 Bacteria 2245
253 Ga0207641_10521504 3300026088 Bacteria 1156
254 Ga0207641_11598651 3300026088 Bacteria 654
255 Ga0207648_10012439 3300026089 Bacteria 7968
256 Ga0207648_10029572 3300026089 Bacteria 4858
257 Ga0207648_10090478 3300026089 Bacteria 2674
258 Ga0207648_10093870 3300026089 Bacteria 2624
259 Ga0207648_10245996 3300026089 Bacteria 1594
260 Ga0207676_10391716 3300026095 Bacteria 1296
261 Ga0207674_10021543 3300026116 Bacteria 6939
262 Ga0207674_10038675 3300026116 Bacteria 4948
263 Ga0207674_10083239 3300026116 Bacteria 3199
264 Ga0207675_100000254 3300026118 Bacteria 51194
265 Ga0207675_100001541 3300026118 Bacteria 23084
266 Ga0207675_100005668 3300026118 Bacteria 11953
267 Ga0207675_100024377 3300026118 Bacteria 5626
268 Ga0207675_100033977 3300026118 Bacteria 4753
269 Ga0207675_100170139 3300026118 Bacteria 2082
270 Ga0207683_10030929 3300026121 Bacteria 4643
271 Ga0207683_11032154 3300026121 Bacteria 763
272 Ga0207698_10721960 3300026142 Bacteria 993
273 Ga0207428_10008694 3300027907 Bacteria 9166
274 Ga0207428_10017050 3300027907 Bacteria 6239
275 Ga0207428_10060530 3300027907 Bacteria 3000
276 Ga0207428_10458917 3300027907 Bacteria 928
277 Ga0207428_10589952 3300027907 Bacteria 801
278 Ga0268266_10476367 3300028379 Bacteria 1189
279 Ga0268265_10000512 3300028380 Bacteria 39796
280 Ga0268265_10002605 3300028380 Bacteria 13428
281 Ga0268265_10009178 3300028380 Bacteria 6683
282 Ga0268265_10213841 3300028380 Bacteria 1682
283 Ga0268265_11068187 3300028380 Bacteria 800
284 Ga0268264_10021712 3300028381 Bacteria 5241
285 Ga0268264_10027750 3300028381 Bacteria 4628
286 Ga0268264_10065419 3300028381 Bacteria 3063
287 Ga0307515_10000133 3300028794 Bacteria 176091
288 Ga0307515_10090174 3300028794 Unclassified 3849
289 Ga0307515_10134912 3300028794 Unclassified 2691
290 Ga0307515_10594523 3300028794 Unclassified 717
291 Ga0307408_100065910 3300031548 Bacteria 2658
292 Ga0307408_100133693 3300031548 Bacteria 1938
293 Ga0307408_100168974 3300031548 Bacteria 1744
294 Ga0307408_100574637 3300031548 Bacteria 998
295 Ga0307408_100950330 3300031548 Bacteria 789
296 Ga0307514_10025663 3300031649 Unclassified 4768
297 Ga0307405_10345723 3300031731 Bacteria 1145
298 Ga0307413_10191690 3300031824 Bacteria 1468
299 Ga0307413_10452931 3300031824 Bacteria 1019
300 Ga0307410_10072482 3300031852 Bacteria 2392
301 Ga0307410_10466376 3300031852 Bacteria 1033
302 Ga0307410_11126924 3300031852 Bacteria 681
303 Ga0307410_11284406 3300031852 Bacteria 640
304 Ga0307406_10061364 3300031901 Bacteria 2428
305 Ga0307406_10146621 3300031901 Bacteria 1678
306 Ga0307406_10230019 3300031901 Bacteria 1384
307 Ga0307406_10315627 3300031901 Bacteria 1207
308 Ga0307407_10169733 3300031903 Bacteria 1436
309 Ga0307407_10566075 3300031903 Bacteria 842
310 Ga0307412_10071035 3300031911 Bacteria 2375
311 Ga0307412_10979224 3300031911 Bacteria 746
312 Ga0307409_100216105 3300031995 Bacteria 1727
313 Ga0307409_100901228 3300031995 Bacteria 898
314 Ga0307409_101784012 3300031995 Bacteria 644
315 Ga0307416_100013299 3300032002 Bacteria 5589
316 Ga0307416_100027248 3300032002 Bacteria 4228
317 Ga0307416_100226463 3300032002 Bacteria 1798
318 Ga0307416_100284365 3300032002 Bacteria 1633
319 Ga0307416_100477863 3300032002 Bacteria 1305
320 Ga0307416_101277498 3300032002 Bacteria 840
321 Ga0307414_10056146 3300032004 Bacteria 2761
322 Ga0307414_10116215 3300032004 Bacteria 2048
323 Ga0307411_10030243 3300032005 Bacteria 3318
324 Ga0307411_10146785 3300032005 Bacteria 1747
325 Ga0307411_10466603 3300032005 Bacteria 1060
326 Ga0307411_10579030 3300032005 Bacteria 962
327 Ga0307411_11614283 3300032005 Bacteria 599
328 Ga0307415_100145294 3300032126 Bacteria 1817
329 Ga0373928_0115196 3300035084 Bacteria 715
330 Ga0373923_0293712 3300035111 Bacteria 768
331 Ga0373941_0085526 3300035115 Bacteria 1073
332 Ga0373962_0022539 3300035242 Bacteria 1671
333 Ga0373935_0025952 3300035692 Bacteria 3612
334 Ga0373937_0333423 3300036401 Bacteria 1436
335 Ga0395901_1330692 3300038443 Bacteria 679
336 Ga0436361_0800168 3300039447 Bacteria 1140
337 Ga0451804_0782721 3300041463 Bacteria 899
338 Ga0451807_0526950 3300041486 Bacteria 834
339 Ga0451853_1968806 3300041512 Bacteria 1299
340 Ga0439442_031482 3300042002 Bacteria 1108
341 Ga0439446_0291247 3300042156 Bacteria 571
342 Ga0439464_0020131 3300042439 Bacteria 1826
343 Ga0451577_0000001 3300042876 Bacteria 2461803
344 Ga0451577_0009586 3300042876 Bacteria 9299
345 Ga0451577_0032231 3300042876 Bacteria 4722
346 Ga0439440_0097713 3300042993 Bacteria 796
347 Ga0453683_0116477 3300044673 Bacteria 1681
348 Ga0466961_0225594 3300044693 Bacteria 1154
349 Ga0466963_0833050 3300044694 Bacteria 650
350 Ga0453684_0013089 3300044712 Bacteria 13543
351 Ga0453684_0026686 3300044712 Bacteria 8327
352 Ga0453684_0132505 3300044712 Bacteria 2989
353 Ga0466970_0278326 3300044765 Bacteria 941
354 Ga0451576_0017006 3300045051 Bacteria 8006
355 Ga0451576_0040606 3300045051 Bacteria 4923
356 Ga0451576_0113847 3300045051 Bacteria 2816
357 Ga0451576_0568077 3300045051 Bacteria 1192
358 Ga0466967_0064498 3300045976 Bacteria 3258
359 Ga0495638_0007909 3300046460 Bacteria 7583
360 Ga0495638_0468426 3300046460 Bacteria 640
361 Ga0495605_0022567 3300046474 Bacteria 3322
362 Ga0495631_0015222 3300046518 Bacteria 3693
363 Ga0495637_0098763 3300046520 Bacteria 1143
364 Ga0495633_0000298 3300046558 Bacteria 56626
365 Ga0495611_0175295 3300046648 Bacteria 1002
366 Ga0495625_0017598 3300046660 Bacteria 5593
367 Ga0495625_0189915 3300046660 Bacteria 1361
368 Ga0495661_0101929 3300046665 Bacteria 1614
369 Ga0495670_0011074 3300046691 Bacteria 4435
370 Ga0495649_0109666 3300046694 Bacteria 1464
371 Ga0495660_0027938 3300046810 Bacteria 3190
372 Ga0495672_0023689 3300047320 Bacteria 3969
373 Ga0495677_0136019 3300047445 Bacteria 942
374 Ga0495681_0011730 3300047470 Bacteria 5196
375 Ga0495626_0111874 3300048091 Bacteria 1182
376 Ga0496100_1085143 3300048903 Bacteria 631
377 Ga0496101_0565563 3300048904 Bacteria 899
378 Ga0496102_1942035 3300048905 Bacteria 505
379 Ga0496106_0164386 3300048909 Bacteria 1756
380 Ga0496108_1038264 3300048911 Bacteria 699
381 Ga0496110_0726860 3300048913 Bacteria 895
382 Ga0496112_0070753 3300048915 Bacteria 3448
383 Ga0496113_0032538 3300048916 Bacteria 3790
384 Ga0496117_0444840 3300048920 Bacteria 642
385 Ga0496118_0072823 3300048921 Bacteria 2465
386 Ga0501299_203966 3300049522 Bacteria 526
387 Ga0501042_0389238 3300049578 Bacteria 1010
388 Ga0501043_0754560 3300049579 Bacteria 707
389 Ga0501047_1037714 3300049581 Bacteria 633
390 Ga0501076_0720640 3300049592 Bacteria 823
391 Ga0501076_1306773 3300049592 Bacteria 596
392 Ga0501243_081243 3300049675 Bacteria 631
393 Ga0501283_108022 3300049779 Bacteria 547
394 nmdc:mga03683_79602_c1 3300050489 Bacteria 1413
395 nmdc:mga0k408_19886_c1 3300050493 Bacteria 3758
396 nmdc:mga0k408_57524_c1 3300050493 Bacteria 2257
397 nmdc:mga06z11_43572_c1 3300050494 Bacteria 2259
398 nmdc:mga05p37_108825_c1 3300050507 Bacteria 3409
399 nmdc:mga05p37_1205740_c1 3300050507 Bacteria 781
400 nmdc:mga05p37_694_c1 3300050507 Bacteria 37343
401 nmdc:mga09592_103029_c1 3300050508 Bacteria 2445
402 nmdc:mga09592_3545_c1 3300050508 Bacteria 12602
403 nmdc:mga09592_448_c1 3300050508 Bacteria 30561
404 nmdc:mga0qj67_217621_c1 3300050509 Bacteria 1551
405 nmdc:mga0qj67_228_c1 3300050509 Bacteria 38249
406 nmdc:mga0qj67_25290_c1 3300050509 Bacteria 4586
407 nmdc:mga0qj67_349627_c1 3300050509 Bacteria 1195
408 nmdc:mga0qj67_3774_c1 3300050509 Bacteria 10936
409 nmdc:mga06r32_1123_c1 3300050510 Bacteria 23971
410 nmdc:mga06r32_1243996_c1 3300050510 Bacteria 690
411 nmdc:mga06r32_31_c1 3300050510 Bacteria 84127
412 nmdc:mga06r32_5523_c1 3300050510 Bacteria 11394
413 nmdc:mga08y16_1280_c1 3300050511 Bacteria 24963
414 nmdc:mga08y16_23668_c1 3300050511 Bacteria 6485
415 nmdc:mga08y16_34826_c1 3300050511 Bacteria 5290
416 nmdc:mga08y16_80194_c1 3300050511 Bacteria 3403
417 nmdc:mga0a205_622825_c1 3300050515 Bacteria 931
418 Ga0500583_0142183 3300053092 Bacteria 1193
419 Ga0500651_0542738 3300053093 Bacteria 637
420 Ga0500654_065851 3300053099 Bacteria 1811
421 Ga0500573_0354629 3300053140 Bacteria 711
422 Ga0500616_0017397 3300053153 Bacteria 4078
423 Ga0500622_0001942 3300053156 Bacteria 15569
424 Ga0500622_0002692 3300053156 Bacteria 12590
425 2585268596 2582581306 Bacteria 6450535
426 2585389260 2582581865 Bacteria 6644329
427 Ga0496121_0016871
428 JGI24749J21850_1021640
429 JGI25159J45721_1009546
430 rootH2_10024670
431 rootL2_10063930
432 rootH1_10177927
433 JGI25160J50197_1003223
434 Ga0065712_10079960
435 Ga0065715_10116328
436 Ga0065715_10182018
437 Ga0065707_10083220
438 Ga0070690_100000409
439 Ga0070670_100041071
440 Ga0070670_100198440
441 Ga0070670_100427216
442 Ga0070677_10006652
443 Ga0068869_100009254
444 Ga0070666_10020313
445 Ga0070682_100224088
446 Ga0068868_100280155
447 Ga0070660_100003207
448 Ga0070660_100641730
449 Ga0070689_100003535
450 Ga0070661_100010770
451 Ga0070661_100734165
452 Ga0070692_10295028
453 Ga0070668_100008273
454 Ga0070668_100013484
455 Ga0070668_100087290
456 Ga0070668_100171579
457 Ga0070669_100001616
458 Ga0070669_100023048
459 Ga0070669_100434311
460 Ga0070669_101100770
461 Ga0070675_100000847
462 Ga0070671_100006458
463 Ga0070671_100127744
464 Ga0070671_101374133
465 Ga0070674_100630914
466 Ga0070674_100902921
467 Ga0070673_100001527
468 Ga0070688_100043436
469 Ga0070659_100464677
470 Ga0070659_100530490
471 Ga0070667_100033994
472 Ga0070667_100896237
473 Ga0070701_10003732
474 Ga0070701_10012825
475 Ga0070705_100017842
476 Ga0070700_100041669
477 Ga0070700_100181070
478 Ga0070694_100122387
479 Ga0070663_100228650
480 Ga0070678_100009738
481 Ga0070678_100385871
482 Ga0070662_100006094
483 Ga0070662_100021160
484 Ga0070662_100037787
485 Ga0070681_10132766
486 Ga0068867_100032472
487 Ga0068867_100219677
488 Ga0068867_100530104
489 Ga0068867_100962745
490 Ga0070685_10006119
491 Ga0070698_100049259
492 Ga0070698_100554059
493 Ga0070679_100079274
494 Ga0070684_100004422
495 Ga0068853_100179756
496 Ga0070672_100018337
497 Ga0070672_100049749
498 Ga0070672_100071061
499 Ga0070672_100116406
500 Ga0070672_100165448
501 Ga0070686_100008551
502 Ga0070696_100420290
503 Ga0070665_100026953
504 Ga0070664_100000952
505 Ga0068857_100044674
506 Ga0068857_100093725
507 Ga0068857_100144331
508 Ga0068854_100810258
509 Ga0070702_100041757
510 Ga0068852_100091848
511 Ga0068859_100005095
512 Ga0068859_101146515
513 Ga0068864_100000680
514 Ga0068866_10010777
515 Ga0068866_10713811
516 Ga0068861_100000011
517 Ga0068861_100007883
518 Ga0068861_100015531
519 Ga0068861_100103594
520 Ga0068861_100156250
521 Ga0068861_101306075
522 Ga0068870_10017933
523 Ga0068863_100006076
524 Ga0068863_100025585
525 Ga0068863_100089430
526 Ga0068863_100192977
527 Ga0068858_100198309
528 Ga0068858_101040659
529 Ga0068860_100030672
530 Ga0068860_100038800
531 Ga0068860_100535430
532 Ga0068862_100000740
533 Ga0068862_100001544
534 Ga0068862_100004538
535 Ga0068862_100014870
536 Ga0081455_10168591
537 Ga0075363_100056091
538 Ga0075362_10035244
539 Ga0075367_10012156
540 Ga0075366_10047310
541 Ga0068871_100027539
542 Ga0068871_101449335
543 Ga0075428_100000232
544 Ga0075428_100001159
545 Ga0075428_100148238
546 Ga0075428_100170948
547 Ga0075430_100000945
548 Ga0075430_100011263
549 Ga0075430_100045635
550 Ga0075430_100239364
551 Ga0075430_100374201
552 Ga0075431_100000356
553 Ga0075431_100001939
554 Ga0075431_100389586
555 Ga0075431_100589832
556 Ga0075431_100942561
557 Ga0075433_10627247
558 Ga0075434_100282874
559 Ga0075429_100000124
560 Ga0075429_100002687
561 Ga0075429_100758975
562 Ga0068865_100030583
563 Ga0075436_100298182
564 Ga0097620_100005096
565 Ga0097620_101146581
566 Ga0079104_1080687
567 Ga0111539_10000664
568 Ga0111539_10033402
569 Ga0111539_10045107
570 Ga0111539_10223054
571 Ga0105245_12300495
572 Ga0105247_10119598
573 Ga0114129_10000468
574 Ga0114129_10128310
575 Ga0114129_10369405
576 Ga0114129_10573664
577 Ga0105243_10411192
578 Ga0105241_11522030
579 Ga0105242_10115778
580 Ga0105248_10001791
581 Ga0105248_11427236
582 Ga0105248_11595831
583 Ga0105249_10007113
584 Ga0105249_10010879
585 Ga0105249_10030522
586 Ga0157341_1023341
587 Ga0157378_10193440
588 Ga0157378_10369699
589 Ga0157378_11358614
590 Ga0163162_10036099
591 Ga0163162_10342438
592 Ga0157375_10055668
593 Ga0157375_10062190
594 Ga0157375_10257741
595 Ga0163163_10013883
596 Ga0157380_10004828
597 Ga0157380_10017314
598 Ga0157380_10301425
599 Ga0157380_10507612
600 Ga0157380_10717072
601 Ga0157380_11575110
602 Ga0157377_10064213
603 Ga0157379_10937711
604 Ga0157376_11101430
605 Ga0163161_10104637
606 Ga0163161_10225798
607 Ga0163161_10313828
608 Ga0207425_1005108
609 Ga0209565_1004442
610 Ga0209758_1012801
611 Ga0207656_10007428
612 Ga0207682_10079894
613 Ga0207642_10008222
614 Ga0207680_10045203
615 Ga0207645_10322513
616 Ga0207643_10045806
617 Ga0207707_10116274
618 Ga0207660_10046622
619 Ga0207662_10002057
620 Ga0207657_10517257
621 Ga0207649_10009959
622 Ga0207681_10004252
623 Ga0207681_10014813
624 Ga0207681_10019425
625 Ga0207650_10249548
626 Ga0207659_10003167
627 Ga0207659_10614608
628 Ga0207644_10008866
629 Ga0207644_10717257
630 Ga0207690_10425716
631 Ga0207690_10833031
632 Ga0207706_10002212
633 Ga0207706_10010461
634 Ga0207706_10053760
635 Ga0207686_10102684
636 Ga0207709_10273063
637 Ga0207670_10008569
638 Ga0207669_10354983
639 Ga0207669_10359427
640 Ga0207669_10397466
641 Ga0207669_10471091
642 Ga0207704_10024080
643 Ga0207704_10904525
644 Ga0207691_10024065
645 Ga0207691_10058986
646 Ga0207691_10060916
647 Ga0207691_10065479
648 Ga0207691_10133449
649 Ga0207711_10006703
650 Ga0207689_10003354
651 Ga0207679_10022203
652 Ga0207679_10176632
653 Ga0207679_11735059
654 Ga0207651_10006826
655 Ga0207651_10128928
656 Ga0207712_10000868
657 Ga0207712_10010192
658 Ga0207668_10008124
659 Ga0207668_10024262
660 Ga0207668_10060341
661 Ga0207668_10120203
662 Ga0207668_10863337
663 Ga0207640_10236437
664 Ga0207658_10027199
665 Ga0207658_10179727
666 Ga0207658_10270736
667 Ga0207677_10259733
668 Ga0207677_11325127
669 Ga0207703_10391749
670 Ga0207703_10866486
671 Ga0207678_10255627
672 Ga0207708_10023274
673 Ga0207708_10141280
674 Ga0207708_10260709
675 Ga0207641_10008373
676 Ga0207641_10050990
677 Ga0207641_10067883
678 Ga0207641_10131856
679 Ga0207641_10521504
680 Ga0207641_11598651
681 Ga0207648_10012439
682 Ga0207648_10029572
683 Ga0207648_10090478
684 Ga0207648_10093870
685 Ga0207648_10245996
686 Ga0207676_10391716
687 Ga0207674_10021543
688 Ga0207674_10038675
689 Ga0207674_10083239
690 Ga0207675_100000254
691 Ga0207675_100001541
692 Ga0207675_100005668
693 Ga0207675_100024377
694 Ga0207675_100033977
695 Ga0207675_100170139
696 Ga0207683_10030929
697 Ga0207683_11032154
698 Ga0207698_10721960
699 Ga0207428_10008694
700 Ga0207428_10017050
701 Ga0207428_10060530
702 Ga0207428_10458917
703 Ga0207428_10589952
704 Ga0268266_10476367
705 Ga0268265_10000512
706 Ga0268265_10002605
707 Ga0268265_10009178
708 Ga0268265_10213841
709 Ga0268265_11068187
710 Ga0268264_10021712
711 Ga0268264_10027750
712 Ga0268264_10065419
713 Ga0307515_10000133
714 Ga0307515_10090174
715 Ga0307515_10134912
716 Ga0307515_10594523
717 Ga0307408_100065910
718 Ga0307408_100133693
719 Ga0307408_100168974
720 Ga0307408_100574637
721 Ga0307408_100950330
722 Ga0307514_10025663
723 Ga0307405_10345723
724 Ga0307413_10191690
725 Ga0307413_10452931
726 Ga0307410_10072482
727 Ga0307410_10466376
728 Ga0307410_11126924
729 Ga0307410_11284406
730 Ga0307406_10061364
731 Ga0307406_10146621
732 Ga0307406_10230019
733 Ga0307406_10315627
734 Ga0307407_10169733
735 Ga0307407_10566075
736 Ga0307412_10071035
737 Ga0307412_10979224
738 Ga0307409_100216105
739 Ga0307409_100901228
740 Ga0307409_101784012
741 Ga0307416_100013299
742 Ga0307416_100027248
743 Ga0307416_100226463
744 Ga0307416_100284365
745 Ga0307416_100477863
746 Ga0307416_101277498
747 Ga0307414_10056146
748 Ga0307414_10116215
749 Ga0307411_10030243
750 Ga0307411_10146785
751 Ga0307411_10466603
752 Ga0307411_10579030
753 Ga0307411_11614283
754 Ga0307415_100145294
755 Ga0373928_0115196
756 Ga0373923_0293712
757 Ga0373941_0085526
758 Ga0373962_0022539
759 Ga0373935_0025952
760 Ga0373937_0333423
761 Ga0395901_1330692
762 Ga0436361_0800168
763 Ga0451804_0782721
764 Ga0451807_0526950
765 Ga0451853_1968806
766 Ga0439442_031482
767 Ga0439446_0291247
768 Ga0439464_0020131
769 Ga0451577_0000001
770 Ga0451577_0009586
771 Ga0451577_0032231
772 Ga0439440_0097713
773 Ga0453683_0116477
774 Ga0466961_0225594
775 Ga0466963_0833050
776 Ga0453684_0013089
777 Ga0453684_0026686
778 Ga0453684_0132505
779 Ga0466970_0278326
780 Ga0451576_0017006
781 Ga0451576_0040606
782 Ga0451576_0113847
783 Ga0451576_0568077
784 Ga0466967_0064498
785 Ga0495638_0007909
786 Ga0495638_0468426
787 Ga0495605_0022567
788 Ga0495631_0015222
789 Ga0495637_0098763
790 Ga0495633_0000298
791 Ga0495611_0175295
792 Ga0495625_0017598
793 Ga0495625_0189915
794 Ga0495661_0101929
795 Ga0495670_0011074
796 Ga0495649_0109666
797 Ga0495660_0027938
798 Ga0495672_0023689
799 Ga0495677_0136019
800 Ga0495681_0011730
801 Ga0495626_0111874
802 Ga0496100_1085143
803 Ga0496101_0565563
804 Ga0496102_1942035
805 Ga0496106_0164386
806 Ga0496108_1038264
807 Ga0496110_0726860
808 Ga0496112_0070753
809 Ga0496113_0032538
810 Ga0496117_0444840
811 Ga0496118_0072823
812 Ga0501299_203966
813 Ga0501042_0389238
814 Ga0501043_0754560
815 Ga0501047_1037714
816 Ga0501076_0720640
817 Ga0501076_1306773
818 Ga0501243_081243
819 Ga0501283_108022
820 nmdc:mga03683_79602_c1
821 nmdc:mga0k408_19886_c1
822 nmdc:mga0k408_57524_c1
823 nmdc:mga06z11_43572_c1
824 nmdc:mga05p37_108825_c1
825 nmdc:mga05p37_1205740_c1
826 nmdc:mga05p37_694_c1
827 nmdc:mga09592_103029_c1
828 nmdc:mga09592_3545_c1
829 nmdc:mga09592_448_c1
830 nmdc:mga0qj67_217621_c1
831 nmdc:mga0qj67_228_c1
832 nmdc:mga0qj67_25290_c1
833 nmdc:mga0qj67_349627_c1
834 nmdc:mga0qj67_3774_c1
835 nmdc:mga06r32_1123_c1
836 nmdc:mga06r32_1243996_c1
837 nmdc:mga06r32_31_c1
838 nmdc:mga06r32_5523_c1
839 nmdc:mga08y16_1280_c1
840 nmdc:mga08y16_23668_c1
841 nmdc:mga08y16_34826_c1
842 nmdc:mga08y16_80194_c1
843 nmdc:mga0a205_622825_c1
844 Ga0500583_0142183
845 Ga0500651_0542738
846 Ga0500654_065851
847 Ga0500573_0354629
848 Ga0500616_0017397
849 Ga0500622_0001942
850 Ga0500622_0002692
851 2585268596
852 2585389260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

95

169

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

26

96

0.87

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

33

119

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9703 2 153
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9649 2 152
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9609 1 154
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9608 1 153
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9597 1 154
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9666 1 74 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9581 1 72 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9422 76 152 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9379 78 152 1.10.150.120
af_Q9VF51_1_82_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9356 2 72 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A829Y7S6-F1-model_v4 (2Fe-2S)-binding protein 0.9988 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A7Y3HLC7-F1-model_v4 (2Fe-2S)-binding protein 0.9974 2 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2E8WRM1-F1-model_v4 (2Fe-2S)-binding protein 0.9919 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A657AIJ1-F1-model_v4 (2Fe-2S)-binding protein 0.9916 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A0K1ERX2-F1-model_v4 (2Fe-2S)-binding protein 0.9916 1 151 GO:0016491
GO:0046872
GO:0051537

Map