F441178

General Info

Members Datasets Scaffolds Average Seq Length
426 290 852 125

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001270|Ga0111539_1000127024
Length 143
Sequence LPRTFSGAIMSEDKWRRRMSFGSGELDPSQPVGGGGSQVRSAPSNQVTFSRRELNRILDLYGRKVAAGEWRDYAIDFLKDRAVFSVFRRTSEVPIYRIEKNPKLERRQGTYSVISATGLVVRRGHELERVLRSIDRSLALVPN

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
274 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
275 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
276 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
277 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
278 2904699407
279 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
280 2906610324
281 2922425934
282 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
283 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
284 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
285 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
286 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
287 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
288 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
289 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
290 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0.95
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 2.58
Rhizoplane 3.29
Rhizosphere 83.1
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10001270 3300009094 Bacteria 33682
2 JGI25404J52841_10059738 3300003659 Bacteria 799
3 Ga0070690_100204869 3300005330 Unclassified 1374
4 Ga0070677_10913477 3300005333 Unclassified 508
5 Ga0070666_10459982 3300005335 Bacteria 920
6 Ga0070680_100139362 3300005336 Bacteria 2033
7 Ga0070680_100213839 3300005336 Bacteria 1627
8 Ga0070680_100276002 3300005336 Bacteria 1423
9 Ga0070660_100352211 3300005339 Bacteria 1213
10 Ga0070660_100526519 3300005339 Bacteria 985
11 Ga0070691_10130523 3300005341 Bacteria 1273
12 Ga0070687_100214603 3300005343 Bacteria 1175
13 Ga0070669_100568993 3300005353 Bacteria 946
14 Ga0070669_101155370 3300005353 Bacteria 668
15 Ga0070671_100840239 3300005355 Bacteria 801
16 Ga0070673_102185434 3300005364 Bacteria 526
17 Ga0070688_100355929 3300005365 Bacteria 1073
18 Ga0070659_100218199 3300005366 Unclassified 1573
19 Ga0070659_101385947 3300005366 Bacteria 625
20 Ga0070667_100061098 3300005367 Bacteria 3190
21 Ga0070713_100605120 3300005436 Unclassified 1041
22 Ga0070710_11544363 3300005437 Bacteria 500
23 Ga0070701_10483571 3300005438 Bacteria 801
24 Ga0070711_100319706 3300005439 Bacteria 1240
25 Ga0070700_100587350 3300005441 Bacteria 871
26 Ga0070700_100949304 3300005441 Bacteria 703
27 Ga0070694_100131107 3300005444 Bacteria 1811
28 Ga0070708_100244289 3300005445 Bacteria 1686
29 Ga0070663_100723889 3300005455 Bacteria 847
30 Ga0070678_100474747 3300005456 Bacteria 1099
31 Ga0070662_100208544 3300005457 Bacteria 1554
32 Ga0070662_100223840 3300005457 Bacteria 1502
33 Ga0070681_10001300 3300005458 Bacteria 21788
34 Ga0070681_10097886 3300005458 Bacteria 2880
35 Ga0070681_10162578 3300005458 Bacteria 2156
36 Ga0070681_10479471 3300005458 Bacteria 1157
37 Ga0070707_101206731 3300005468 Unclassified 723
38 Ga0070679_100087018 3300005530 Bacteria 3112
39 Ga0070679_101280490 3300005530 Bacteria 679
40 Ga0070684_100665752 3300005535 Bacteria 969
41 Ga0070684_100837390 3300005535 Bacteria 861
42 Ga0070695_100089359 3300005545 Bacteria 2053
43 Ga0070696_100909206 3300005546 Bacteria 731
44 Ga0070693_100078639 3300005547 Bacteria 1960
45 Ga0070704_100610381 3300005549 Bacteria 959
46 Ga0068856_100094639 3300005614 Bacteria 2974
47 Ga0070702_100475893 3300005615 Bacteria 912
48 Ga0068852_102010358 3300005616 Unclassified 600
49 Ga0068859_102217503 3300005617 Bacteria 606
50 Ga0068866_10348154 3300005718 Unclassified 940
51 Ga0068858_100201439 3300005842 Bacteria 1882
52 Ga0068858_102365936 3300005842 Bacteria 525
53 Ga0068860_101167737 3300005843 Unclassified 790
54 Ga0081455_10017267 3300005937 Bacteria 6926
55 Ga0081540_1009755 3300005983 Bacteria 6579
56 Ga0081540_1076019 3300005983 Bacteria 1532
57 Ga0070717_10052875 3300006028 Bacteria 3347
58 Ga0075365_10158190 3300006038 Bacteria 1578
59 Ga0075365_10191093 3300006038 Bacteria 1433
60 Ga0075363_100015573 3300006048 Bacteria 3739
61 Ga0075364_10047887 3300006051 Bacteria 2785
62 Ga0070712_101159699 3300006175 Unclassified 672
63 Ga0070712_101975756 3300006175 Bacteria 511
64 Ga0075367_10093438 3300006178 Bacteria 1832
65 Ga0075369_10187509 3300006186 Bacteria 952
66 Ga0075427_10000389 3300006194 Bacteria 4930
67 Ga0097621_100134396 3300006237 Bacteria 2108
68 Ga0075370_10166610 3300006353 Bacteria 1294
69 Ga0075428_100004407 3300006844 Bacteria 15544
70 Ga0075428_100007998 3300006844 Bacteria 11727
71 Ga0075430_100000032 3300006846 Bacteria 72679
72 Ga0075430_100000276 3300006846 Bacteria 36027
73 Ga0075430_100010806 3300006846 Bacteria 7734
74 Ga0075430_100717573 3300006846 Bacteria 824
75 Ga0075431_100000787 3300006847 Bacteria 27635
76 Ga0075431_100000903 3300006847 Bacteria 26158
77 Ga0075433_10019599 3300006852 Bacteria 5639
78 Ga0075434_100000271 3300006871 Bacteria 36857
79 Ga0075434_100100972 3300006871 Bacteria 2891
80 Ga0075434_101041508 3300006871 Bacteria 832
81 Ga0075429_100000561 3300006880 Bacteria 28469
82 Ga0075429_100008560 3300006880 Bacteria 8901
83 Ga0068865_100398675 3300006881 Unclassified 1126
84 Ga0097620_102218117 3300006931 Bacteria 606
85 Ga0075435_100049397 3300007076 Bacteria 3383
86 Ga0075435_100068983 3300007076 Bacteria 2881
87 Ga0105240_10409995 3300009093 Bacteria 1524
88 Ga0111539_10001373 3300009094 Bacteria 32376
89 Ga0114129_10001730 3300009147 Bacteria 29754
90 Ga0114129_11580094 3300009147 Bacteria 804
91 Ga0114129_11794677 3300009147 Bacteria 746
92 Ga0105241_10215635 3300009174 Bacteria 1610
93 Ga0105241_11976667 3300009174 Bacteria 573
94 Ga0105248_11151803 3300009177 Bacteria 877
95 Ga0105237_10062793 3300009545 Bacteria 3714
96 Ga0105237_11009768 3300009545 Bacteria 839
97 Ga0105238_10063705 3300009551 Bacteria 3687
98 Ga0105238_12161678 3300009551 Bacteria 591
99 Ga0105249_11799692 3300009553 Bacteria 685
100 Ga0105239_10080594 3300010375 Bacteria 3582
101 Ga0105239_10439925 3300010375 Bacteria 1478
102 Ga0157373_10168926 3300013100 Bacteria 1539
103 Ga0157371_10912033 3300013102 Bacteria 667
104 Ga0157370_10057496 3300013104 Bacteria 3698
105 Ga0157369_10686194 3300013105 Bacteria 1055
106 Ga0157369_10995756 3300013105 Bacteria 858
107 Ga0157374_10126685 3300013296 Bacteria 2469
108 Ga0157375_12173163 3300013308 Bacteria 661
109 Ga0163163_10751662 3300014325 Bacteria 1038
110 Ga0157379_10501228 3300014968 Unclassified 1125
111 Ga0163161_10493278 3300017792 Unclassified 996
112 Ga0213876_10143026 3300021384 Bacteria 1272
113 Ga0213871_10122728 3300021441 Bacteria 775
114 Ga0247553_107698 3300023672 Bacteria 589
115 Ga0209564_1000671 3300025295 Bacteria 50518
116 Ga0207692_10841725 3300025898 Bacteria 601
117 Ga0207680_10082925 3300025903 Bacteria 2019
118 Ga0207699_10672028 3300025906 Bacteria 757
119 Ga0207645_10677963 3300025907 Bacteria 700
120 Ga0207705_11190463 3300025909 Bacteria 585
121 Ga0207654_10196576 3300025911 Bacteria 1325
122 Ga0207707_10318871 3300025912 Bacteria 1342
123 Ga0207707_10393416 3300025912 Bacteria 1190
124 Ga0207707_10589851 3300025912 Bacteria 941
125 Ga0207695_10654386 3300025913 Bacteria 931
126 Ga0207695_11101460 3300025913 Bacteria 674
127 Ga0207671_11244268 3300025914 Bacteria 581
128 Ga0207693_10024624 3300025915 Bacteria 4774
129 Ga0207693_11355098 3300025915 Bacteria 530
130 Ga0207660_10075949 3300025917 Bacteria 2456
131 Ga0207660_10106853 3300025917 Bacteria 2099
132 Ga0207660_10162790 3300025917 Bacteria 1723
133 Ga0207660_10177563 3300025917 Bacteria 1652
134 Ga0207657_10206783 3300025919 Bacteria 1577
135 Ga0207652_10062836 3300025921 Bacteria 3209
136 Ga0207652_11129772 3300025921 Bacteria 684
137 Ga0207646_10684165 3300025922 Bacteria 918
138 Ga0207694_10581498 3300025924 Bacteria 941
139 Ga0207694_11636645 3300025924 Bacteria 542
140 Ga0207650_10528146 3300025925 Bacteria 988
141 Ga0207687_10032772 3300025927 Bacteria 3520
142 Ga0207700_10014813 3300025928 Bacteria 5121
143 Ga0207700_10147615 3300025928 Bacteria 1940
144 Ga0207644_10216854 3300025931 Bacteria 1515
145 Ga0207690_10977324 3300025932 Bacteria 704
146 Ga0207690_11502043 3300025932 Unclassified 563
147 Ga0207706_10170593 3300025933 Bacteria 1912
148 Ga0207706_10742002 3300025933 Bacteria 837
149 Ga0207704_10552936 3300025938 Unclassified 936
150 Ga0207711_10177710 3300025941 Bacteria 1934
151 Ga0207711_11259535 3300025941 Bacteria 681
152 Ga0207689_10304250 3300025942 Bacteria 1322
153 Ga0207658_10091304 3300025986 Bacteria 2362
154 Ga0207677_11248954 3300026023 Bacteria 681
155 Ga0207678_10008499 3300026067 Bacteria 9051
156 Ga0207678_10921587 3300026067 Bacteria 773
157 Ga0207708_10310246 3300026075 Bacteria 1285
158 Ga0207702_10136525 3300026078 Bacteria 2214
159 Ga0207648_11451167 3300026089 Unclassified 645
160 Ga0207683_10242474 3300026121 Bacteria 1644
161 Ga0207698_11378446 3300026142 Unclassified 720
162 Ga0209813_10200198 3300027866 Unclassified 739
163 Ga0209813_10254014 3300027866 Bacteria 669
164 Ga0207428_10000082 3300027907 Bacteria 133684
165 Ga0207428_10004104 3300027907 Bacteria 13952
166 Ga0268266_10625911 3300028379 Bacteria 1035
167 Ga0268265_11285604 3300028380 Bacteria 731
168 Ga0265323_10009705 3300028653 Bacteria 3920
169 Ga0265322_10034967 3300028654 Bacteria 1432
170 Ga0265336_10000983 3300028666 Bacteria 14070
171 Ga0265338_10000422 3300028800 Bacteria 75820
172 Ga0265324_10040175 3300029957 Bacteria 1621
173 Ga0265763_1002078 3300030763 Bacteria 1502
174 Ga0265332_10007464 3300031238 Bacteria 4943
175 Ga0265332_10385033 3300031238 Unclassified 579
176 Ga0265325_10016732 3300031241 Bacteria 4093
177 Ga0265340_10005704 3300031247 Bacteria 6879
178 Ga0265340_10088122 3300031247 Bacteria 1454
179 Ga0265340_10250552 3300031247 Bacteria 789
180 Ga0265339_10001952 3300031249 Bacteria 15141
181 Ga0265339_10019847 3300031249 Bacteria 3935
182 Ga0265331_10029658 3300031250 Bacteria 2728
183 Ga0265316_10116134 3300031344 Bacteria 2023
184 Ga0265316_10515049 3300031344 Bacteria 854
185 Ga0265316_10778542 3300031344 Bacteria 672
186 Ga0265314_10123903 3300031711 Bacteria 1622
187 Ga0265342_10000034 3300031712 Bacteria 145074
188 Ga0316583_10003939 3300032133 Bacteria 5274
189 Ga0373944_0021974 3300035089 Bacteria 1851
190 Ga0373936_0087830 3300035113 Bacteria 1301
191 Ga0373941_0370282 3300035115 Unclassified 587
192 Ga0373945_0085463 3300035116 Bacteria 1214
193 Ga0373953_0019757 3300035117 Bacteria 2510
194 Ga0373954_0000946 3300035118 Bacteria 11331
195 Ga0373956_0246179 3300035119 Bacteria 850
196 Ga0373957_0251627 3300035120 Unclassified 743
197 Ga0373943_0084002 3300035170 Unclassified 1638
198 Ga0373955_0006203 3300035172 Bacteria 5438
199 Ga0373955_0750249 3300035172 Bacteria 600
200 Ga0373924_0141859 3300035410 Bacteria 1048
201 Ga0373931_0762459 3300035691 Unclassified 643
202 Ga0373935_0085857 3300035692 Bacteria 2053
203 Ga0373927_0081625 3300035695 Bacteria 2095
204 Ga0373933_0001593 3300035724 Bacteria 13290
205 Ga0373933_0103592 3300035724 Bacteria 1768
206 Ga0373933_0826522 3300035724 Bacteria 610
207 Ga0373947_0048244 3300035725 Bacteria 2554
208 Ga0373947_0909675 3300035725 Bacteria 601
209 Ga0373947_1033018 3300035725 Bacteria 560
210 Ga0373937_0002192 3300036401 Bacteria 16329
211 Ga0373937_0010838 3300036401 Bacteria 7979
212 Ga0373937_0889781 3300036401 Bacteria 839
213 Ga0373937_0957135 3300036401 Bacteria 805
214 Ga0373937_1183937 3300036401 Bacteria 713
215 Ga0316582_1053397 3300036647 Bacteria 555
216 Ga0395899_0012714 3300037312 Bacteria 6449
217 Ga0395899_0013258 3300037312 Bacteria 6308
218 Ga0395900_0024738 3300037418 Bacteria 6146
219 Ga0395900_0223961 3300037418 Bacteria 1894
220 Ga0395898_0041623 3300037466 Bacteria 4537
221 Ga0395898_0104572 3300037466 Bacteria 2715
222 Ga0395898_0151306 3300037466 Bacteria 2220
223 Ga0395898_0735662 3300037466 Bacteria 928
224 Ga0436364_0735832 3300037853 Bacteria 599
225 Ga0395901_0051442 3300038443 Bacteria 4283
226 Ga0395901_0111981 3300038443 Bacteria 2866
227 Ga0395901_0154121 3300038443 Bacteria 2413
228 Ga0436365_1026767 3300039437 Bacteria 1775
229 Ga0436365_1813966 3300039437 Bacteria 2714
230 Ga0436360_0788127 3300039438 Bacteria 689
231 Ga0436360_0911099 3300039438 Bacteria 2043
232 Ga0436361_0477321 3300039447 Bacteria 2038
233 Ga0436363_0461260 3300039450 Bacteria 613
234 Ga0436363_1124010 3300039450 Bacteria 662
235 Ga0436363_1205162 3300039450 Bacteria 527
236 Ga0436363_1637534 3300039450 Bacteria 7144
237 Ga0451807_1467177 3300041486 Bacteria 981
238 Ga0466966_0135984 3300044684 Bacteria 1503
239 Ga0466957_0177711 3300044842 Bacteria 1389
240 Ga0466958_0192880 3300045836 Bacteria 1295
241 Ga0495592_0043799 3300046454 Bacteria 3346
242 Ga0495592_0185801 3300046454 Bacteria 1412
243 Ga0495603_0281601 3300046455 Bacteria 956
244 Ga0495641_0191296 3300046461 Bacteria 917
245 Ga0495651_0000895 3300046462 Bacteria 23161
246 Ga0495651_0168496 3300046462 Bacteria 1562
247 Ga0495653_0000637 3300046463 Bacteria 26722
248 Ga0495653_0791864 3300046463 Bacteria 570
249 Ga0495582_0123901 3300046473 Bacteria 1458
250 Ga0495639_0533095 3300046475 Unclassified 601
251 Ga0495664_0005342 3300046477 Bacteria 7051
252 Ga0495594_0241158 3300046499 Bacteria 1030
253 Ga0495608_0000129 3300046511 Bacteria 53862
254 Ga0495608_0053608 3300046511 Bacteria 2668
255 Ga0495618_0003335 3300046514 Bacteria 10032
256 Ga0495618_0637297 3300046514 Unclassified 631
257 Ga0495628_0001570 3300046516 Bacteria 20927
258 Ga0495630_0511672 3300046517 Unclassified 920
259 Ga0495652_0023216 3300046529 Bacteria 5499
260 Ga0495652_0329086 3300046529 Bacteria 1101
261 Ga0495665_0204037 3300046531 Bacteria 1024
262 Ga0495640_0069130 3300046533 Bacteria 2375
263 Ga0495640_0123175 3300046533 Bacteria 1683
264 Ga0495640_0225396 3300046533 Bacteria 1180
265 Ga0495586_0028713 3300046535 Bacteria 2976
266 Ga0495587_0000354 3300046536 Bacteria 32868
267 Ga0495587_0195486 3300046536 Bacteria 1145
268 Ga0495645_0000800 3300046543 Bacteria 21568
269 Ga0495645_0306276 3300046543 Bacteria 1036
270 Ga0495667_0000688 3300046559 Bacteria 21611
271 Ga0495667_0145091 3300046559 Bacteria 1529
272 Ga0495667_0772027 3300046559 Unclassified 593
273 Ga0495634_0055595 3300046642 Bacteria 2646
274 Ga0495634_0381737 3300046642 Unclassified 839
275 Ga0495634_0440080 3300046642 Bacteria 770
276 Ga0495635_0004643 3300046663 Bacteria 9532
277 Ga0495635_0351383 3300046663 Bacteria 983
278 Ga0495659_0175127 3300046664 Bacteria 872
279 Ga0495588_0115396 3300046674 Unclassified 1415
280 Ga0495599_0000294 3300046678 Bacteria 30376
281 Ga0495599_0354237 3300046678 Unclassified 879
282 Ga0495623_0000055 3300046679 Bacteria 69548
283 Ga0495647_0035634 3300046681 Bacteria 1869
284 Ga0495647_0434448 3300046681 Unclassified 606
285 Ga0495658_0184690 3300046683 Bacteria 1294
286 Ga0495624_0035822 3300046690 Bacteria 3202
287 Ga0495671_0296630 3300046692 Unclassified 778
288 Ga0495600_0028696 3300046809 Bacteria 3601
289 Ga0495600_0121994 3300046809 Bacteria 1695
290 Ga0495604_0001560 3300047317 Bacteria 18862
291 Ga0495636_0580895 3300047318 Bacteria 547
292 Ga0495674_0025464 3300047319 Bacteria 5424
293 Ga0495674_0047208 3300047319 Bacteria 3819
294 Ga0495674_0436645 3300047319 Bacteria 1053
295 Ga0495674_1038763 3300047319 Bacteria 626
296 Ga0495676_0125858 3300047321 Bacteria 1857
297 Ga0495680_0001199 3300047322 Bacteria 28457
298 Ga0495680_0489467 3300047322 Bacteria 836
299 Ga0495684_0219852 3300047471 Bacteria 1393
300 Ga0495593_0230631 3300047673 Bacteria 928
301 Ga0495602_0000445 3300048088 Bacteria 38896
302 Ga0495602_0180665 3300048088 Bacteria 1628
303 Ga0495602_0658029 3300048088 Bacteria 715
304 Ga0495614_0131096 3300048089 Unclassified 1109
305 Ga0496103_0276789 3300048906 Unclassified 1080
306 Ga0496103_1047767 3300048906 Bacteria 506
307 Ga0496105_0094834 3300048908 Bacteria 2465
308 Ga0496107_0399875 3300048910 Unclassified 1021
309 Ga0496108_0738622 3300048911 Bacteria 852
310 Ga0496110_0191294 3300048913 Bacteria 1858
311 Ga0496112_0770783 3300048915 Unclassified 887
312 Ga0496113_0333772 3300048916 Bacteria 1216
313 Ga0496113_0807494 3300048916 Bacteria 745
314 Ga0496114_0272443 3300048917 Bacteria 1492
315 Ga0496114_1016417 3300048917 Bacteria 712
316 Ga0496115_0044258 3300048918 Bacteria 3550
317 Ga0496115_0389929 3300048918 Bacteria 1131
318 Ga0496124_0387217 3300048927 Bacteria 975
319 Ga0496125_0064488 3300048928 Bacteria 2910
320 Ga0496125_0298307 3300048928 Bacteria 988
321 Ga0496126_0064657 3300048929 Bacteria 3276
322 Ga0501031_0146900 3300049568 Bacteria 1541
323 Ga0501031_0962655 3300049568 Bacteria 546
324 Ga0501032_0321068 3300049569 Bacteria 999
325 Ga0501034_0075725 3300049571 Bacteria 3372
326 Ga0501036_0699989 3300049572 Bacteria 837
327 Ga0501037_0156665 3300049573 Bacteria 1625
328 Ga0501037_0402265 3300049573 Bacteria 939
329 Ga0501038_0622014 3300049574 Bacteria 815
330 Ga0501039_0373710 3300049575 Bacteria 1120
331 Ga0501041_0094690 3300049577 Bacteria 1845
332 Ga0501042_0737090 3300049578 Bacteria 717
333 Ga0501043_0236006 3300049579 Bacteria 1411
334 Ga0501047_0061047 3300049581 Bacteria 3637
335 Ga0501047_0217179 3300049581 Bacteria 1769
336 Ga0501047_1368247 3300049581 Bacteria 523
337 Ga0501048_0330450 3300049582 Bacteria 1086
338 Ga0501048_1238833 3300049582 Bacteria 536
339 Ga0501069_0371676 3300049585 Bacteria 844
340 Ga0501070_0012403 3300049586 Bacteria 7188
341 Ga0501071_0012141 3300049587 Bacteria 5829
342 Ga0501072_0004379 3300049588 Bacteria 10721
343 Ga0501072_0457932 3300049588 Bacteria 1010
344 Ga0501073_0418935 3300049589 Bacteria 925
345 Ga0501074_0584219 3300049590 Bacteria 790
346 Ga0501074_1068200 3300049590 Bacteria 567
347 Ga0501075_0027955 3300049591 Bacteria 4159
348 Ga0501079_0752761 3300049741 Bacteria 767
349 Ga0501080_0626941 3300049742 Bacteria 953
350 Ga0501083_0106233 3300049744 Bacteria 1848
351 Ga0501035_0184123 3300049822 Bacteria 1798
352 Ga0501035_0690784 3300049822 Bacteria 824
353 Ga0501044_0382717 3300049823 Bacteria 1322
354 Ga0501044_0427025 3300049823 Bacteria 1235
355 Ga0501044_1052692 3300049823 Bacteria 684
356 Ga0501044_1213841 3300049823 Bacteria 622
357 nmdc:mga03n38_55175_c1 3300050490 Bacteria 1789
358 nmdc:mga00v17_271869_c1 3300050491 Bacteria 1100
359 nmdc:mga00v17_446755_c1 3300050491 Unclassified 839
360 nmdc:mga00v17_78786_c1 3300050491 Bacteria 2054
361 nmdc:mga0yw44_1216913_c1 3300050492 Bacteria 508
362 nmdc:mga0yw44_349285_c1 3300050492 Bacteria 996
363 nmdc:mga0yw44_778793_c1 3300050492 Bacteria 650
364 nmdc:mga06z11_127277_c1 3300050494 Bacteria 1427
365 nmdc:mga04h51_107380_c1 3300050495 Bacteria 1025
366 nmdc:mga04h51_211472_c1 3300050495 Bacteria 766
367 nmdc:mga07m45_497909_c1 3300050496 Bacteria 706
368 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
369 nmdc:mga05p37_4690_c1 3300050507 Bacteria 15966
370 nmdc:mga09592_1297_c1 3300050508 Bacteria 20091
371 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
372 nmdc:mga0qj67_798145_c1 3300050509 Bacteria 747
373 nmdc:mga06r32_1133_c1 3300050510 Bacteria 23910
374 nmdc:mga08y16_354_c1 3300050511 Bacteria 41427
375 nmdc:mga0n895_5683_c1 3300050512 Bacteria 10456
376 nmdc:mga0n895_701_c1 3300050512 Bacteria 23539
377 nmdc:mga0n895_895664_c1 3300050512 Bacteria 873
378 nmdc:mga0rr50_263748_c1 3300050513 Bacteria 1434
379 nmdc:mga0rr50_35347_c1 3300050513 Bacteria 3588
380 nmdc:mga0a205_10392_c1 3300050515 Bacteria 4379
381 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
382 nmdc:mga0sz30_267942_c1 3300050516 Bacteria 761
383 Ga0495601_0000186 3300053077 Bacteria 33078
384 Ga0495601_0000677 3300053077 Bacteria 18186
385 Ga0495601_0007966 3300053077 Bacteria 6238
386 Ga0495601_0118982 3300053077 Bacteria 1714
387 Ga0495612_0015407 3300053078 Bacteria 3064
388 Ga0495612_0084595 3300053078 Bacteria 1336
389 Ga0495655_0277574 3300053083 Bacteria 570
390 Ga0495595_0001358 3300053084 Bacteria 9498
391 Ga0495595_0009090 3300053084 Bacteria 4103
392 Ga0495619_0000052 3300053085 Bacteria 98882
393 Ga0495619_0007321 3300053085 Bacteria 6991
394 Ga0495619_0068037 3300053085 Bacteria 2378
395 Ga0500566_0325375 3300053094 Bacteria 714
396 Ga0500641_0119801 3300053096 Bacteria 1134
397 Ga0500618_069537 3300053125 Bacteria 790
398 Ga0500636_0048660 3300053177 Bacteria 2495
399 Ga0500636_0111012 3300053177 Bacteria 1549
400 Ga0500657_140773 3300053728 Bacteria 916
401 Ga0501084_0333939 3300054114 Bacteria 1280
402 Ga0590071_057696 3300059421 Bacteria 946
403 Ga0587066_182381 3300059490 Bacteria 541
404 Ga0587068_096506 3300059641 Bacteria 616
405 Ga0501082_0063488 3300060353 Bacteria 3180
406 Ga0501082_0222671 3300060353 Bacteria 1642
407 Ga0466962_0013427 3300061719 Bacteria 3943
408 Ga0530510_0007398 3300061734 Bacteria 7644
409 2513659500 2513237096 Bacteria 8722461
410 2513921567 2513237145 Bacteria 8979722
411 2793072721 2791355197 Bacteria 8420563
412 2844315533 2844315083 Bacteria 8138177
413 2903733698 2903727486 Bacteria 8281579
414 2904708412
415 2906609471 2906602504 Bacteria 8295279
416 2906613585
417 2922434021
418 2935636048 2935630451 Bacteria 8169952
419 2941512648 2941507105 Bacteria 8166816
420 2941520514 2941515067 Bacteria 8166720
421 2941528528 2941523033 Bacteria 8169134
422 3005475265 3005474847 Bacteria 9259049
423 8006936013 8006933436 Bacteria 10410654
424 8006975863 8006973647 Bacteria 10679141
425 8019562641 8019555841 Bacteria 9642137
426 8019572720 8019565922 Bacteria 9639779
427 Ga0111539_10001270
428 JGI25404J52841_10059738
429 Ga0070690_100204869
430 Ga0070677_10913477
431 Ga0070666_10459982
432 Ga0070680_100139362
433 Ga0070680_100213839
434 Ga0070680_100276002
435 Ga0070660_100352211
436 Ga0070660_100526519
437 Ga0070691_10130523
438 Ga0070687_100214603
439 Ga0070669_100568993
440 Ga0070669_101155370
441 Ga0070671_100840239
442 Ga0070673_102185434
443 Ga0070688_100355929
444 Ga0070659_100218199
445 Ga0070659_101385947
446 Ga0070667_100061098
447 Ga0070713_100605120
448 Ga0070710_11544363
449 Ga0070701_10483571
450 Ga0070711_100319706
451 Ga0070700_100587350
452 Ga0070700_100949304
453 Ga0070694_100131107
454 Ga0070708_100244289
455 Ga0070663_100723889
456 Ga0070678_100474747
457 Ga0070662_100208544
458 Ga0070662_100223840
459 Ga0070681_10001300
460 Ga0070681_10097886
461 Ga0070681_10162578
462 Ga0070681_10479471
463 Ga0070707_101206731
464 Ga0070679_100087018
465 Ga0070679_101280490
466 Ga0070684_100665752
467 Ga0070684_100837390
468 Ga0070695_100089359
469 Ga0070696_100909206
470 Ga0070693_100078639
471 Ga0070704_100610381
472 Ga0068856_100094639
473 Ga0070702_100475893
474 Ga0068852_102010358
475 Ga0068859_102217503
476 Ga0068866_10348154
477 Ga0068858_100201439
478 Ga0068858_102365936
479 Ga0068860_101167737
480 Ga0081455_10017267
481 Ga0081540_1009755
482 Ga0081540_1076019
483 Ga0070717_10052875
484 Ga0075365_10158190
485 Ga0075365_10191093
486 Ga0075363_100015573
487 Ga0075364_10047887
488 Ga0070712_101159699
489 Ga0070712_101975756
490 Ga0075367_10093438
491 Ga0075369_10187509
492 Ga0075427_10000389
493 Ga0097621_100134396
494 Ga0075370_10166610
495 Ga0075428_100004407
496 Ga0075428_100007998
497 Ga0075430_100000032
498 Ga0075430_100000276
499 Ga0075430_100010806
500 Ga0075430_100717573
501 Ga0075431_100000787
502 Ga0075431_100000903
503 Ga0075433_10019599
504 Ga0075434_100000271
505 Ga0075434_100100972
506 Ga0075434_101041508
507 Ga0075429_100000561
508 Ga0075429_100008560
509 Ga0068865_100398675
510 Ga0097620_102218117
511 Ga0075435_100049397
512 Ga0075435_100068983
513 Ga0105240_10409995
514 Ga0111539_10001373
515 Ga0114129_10001730
516 Ga0114129_11580094
517 Ga0114129_11794677
518 Ga0105241_10215635
519 Ga0105241_11976667
520 Ga0105248_11151803
521 Ga0105237_10062793
522 Ga0105237_11009768
523 Ga0105238_10063705
524 Ga0105238_12161678
525 Ga0105249_11799692
526 Ga0105239_10080594
527 Ga0105239_10439925
528 Ga0157373_10168926
529 Ga0157371_10912033
530 Ga0157370_10057496
531 Ga0157369_10686194
532 Ga0157369_10995756
533 Ga0157374_10126685
534 Ga0157375_12173163
535 Ga0163163_10751662
536 Ga0157379_10501228
537 Ga0163161_10493278
538 Ga0213876_10143026
539 Ga0213871_10122728
540 Ga0247553_107698
541 Ga0209564_1000671
542 Ga0207692_10841725
543 Ga0207680_10082925
544 Ga0207699_10672028
545 Ga0207645_10677963
546 Ga0207705_11190463
547 Ga0207654_10196576
548 Ga0207707_10318871
549 Ga0207707_10393416
550 Ga0207707_10589851
551 Ga0207695_10654386
552 Ga0207695_11101460
553 Ga0207671_11244268
554 Ga0207693_10024624
555 Ga0207693_11355098
556 Ga0207660_10075949
557 Ga0207660_10106853
558 Ga0207660_10162790
559 Ga0207660_10177563
560 Ga0207657_10206783
561 Ga0207652_10062836
562 Ga0207652_11129772
563 Ga0207646_10684165
564 Ga0207694_10581498
565 Ga0207694_11636645
566 Ga0207650_10528146
567 Ga0207687_10032772
568 Ga0207700_10014813
569 Ga0207700_10147615
570 Ga0207644_10216854
571 Ga0207690_10977324
572 Ga0207690_11502043
573 Ga0207706_10170593
574 Ga0207706_10742002
575 Ga0207704_10552936
576 Ga0207711_10177710
577 Ga0207711_11259535
578 Ga0207689_10304250
579 Ga0207658_10091304
580 Ga0207677_11248954
581 Ga0207678_10008499
582 Ga0207678_10921587
583 Ga0207708_10310246
584 Ga0207702_10136525
585 Ga0207648_11451167
586 Ga0207683_10242474
587 Ga0207698_11378446
588 Ga0209813_10200198
589 Ga0209813_10254014
590 Ga0207428_10000082
591 Ga0207428_10004104
592 Ga0268266_10625911
593 Ga0268265_11285604
594 Ga0265323_10009705
595 Ga0265322_10034967
596 Ga0265336_10000983
597 Ga0265338_10000422
598 Ga0265324_10040175
599 Ga0265763_1002078
600 Ga0265332_10007464
601 Ga0265332_10385033
602 Ga0265325_10016732
603 Ga0265340_10005704
604 Ga0265340_10088122
605 Ga0265340_10250552
606 Ga0265339_10001952
607 Ga0265339_10019847
608 Ga0265331_10029658
609 Ga0265316_10116134
610 Ga0265316_10515049
611 Ga0265316_10778542
612 Ga0265314_10123903
613 Ga0265342_10000034
614 Ga0316583_10003939
615 Ga0373944_0021974
616 Ga0373936_0087830
617 Ga0373941_0370282
618 Ga0373945_0085463
619 Ga0373953_0019757
620 Ga0373954_0000946
621 Ga0373956_0246179
622 Ga0373957_0251627
623 Ga0373943_0084002
624 Ga0373955_0006203
625 Ga0373955_0750249
626 Ga0373924_0141859
627 Ga0373931_0762459
628 Ga0373935_0085857
629 Ga0373927_0081625
630 Ga0373933_0001593
631 Ga0373933_0103592
632 Ga0373933_0826522
633 Ga0373947_0048244
634 Ga0373947_0909675
635 Ga0373947_1033018
636 Ga0373937_0002192
637 Ga0373937_0010838
638 Ga0373937_0889781
639 Ga0373937_0957135
640 Ga0373937_1183937
641 Ga0316582_1053397
642 Ga0395899_0012714
643 Ga0395899_0013258
644 Ga0395900_0024738
645 Ga0395900_0223961
646 Ga0395898_0041623
647 Ga0395898_0104572
648 Ga0395898_0151306
649 Ga0395898_0735662
650 Ga0436364_0735832
651 Ga0395901_0051442
652 Ga0395901_0111981
653 Ga0395901_0154121
654 Ga0436365_1026767
655 Ga0436365_1813966
656 Ga0436360_0788127
657 Ga0436360_0911099
658 Ga0436361_0477321
659 Ga0436363_0461260
660 Ga0436363_1124010
661 Ga0436363_1205162
662 Ga0436363_1637534
663 Ga0451807_1467177
664 Ga0466966_0135984
665 Ga0466957_0177711
666 Ga0466958_0192880
667 Ga0495592_0043799
668 Ga0495592_0185801
669 Ga0495603_0281601
670 Ga0495641_0191296
671 Ga0495651_0000895
672 Ga0495651_0168496
673 Ga0495653_0000637
674 Ga0495653_0791864
675 Ga0495582_0123901
676 Ga0495639_0533095
677 Ga0495664_0005342
678 Ga0495594_0241158
679 Ga0495608_0000129
680 Ga0495608_0053608
681 Ga0495618_0003335
682 Ga0495618_0637297
683 Ga0495628_0001570
684 Ga0495630_0511672
685 Ga0495652_0023216
686 Ga0495652_0329086
687 Ga0495665_0204037
688 Ga0495640_0069130
689 Ga0495640_0123175
690 Ga0495640_0225396
691 Ga0495586_0028713
692 Ga0495587_0000354
693 Ga0495587_0195486
694 Ga0495645_0000800
695 Ga0495645_0306276
696 Ga0495667_0000688
697 Ga0495667_0145091
698 Ga0495667_0772027
699 Ga0495634_0055595
700 Ga0495634_0381737
701 Ga0495634_0440080
702 Ga0495635_0004643
703 Ga0495635_0351383
704 Ga0495659_0175127
705 Ga0495588_0115396
706 Ga0495599_0000294
707 Ga0495599_0354237
708 Ga0495623_0000055
709 Ga0495647_0035634
710 Ga0495647_0434448
711 Ga0495658_0184690
712 Ga0495624_0035822
713 Ga0495671_0296630
714 Ga0495600_0028696
715 Ga0495600_0121994
716 Ga0495604_0001560
717 Ga0495636_0580895
718 Ga0495674_0025464
719 Ga0495674_0047208
720 Ga0495674_0436645
721 Ga0495674_1038763
722 Ga0495676_0125858
723 Ga0495680_0001199
724 Ga0495680_0489467
725 Ga0495684_0219852
726 Ga0495593_0230631
727 Ga0495602_0000445
728 Ga0495602_0180665
729 Ga0495602_0658029
730 Ga0495614_0131096
731 Ga0496103_0276789
732 Ga0496103_1047767
733 Ga0496105_0094834
734 Ga0496107_0399875
735 Ga0496108_0738622
736 Ga0496110_0191294
737 Ga0496112_0770783
738 Ga0496113_0333772
739 Ga0496113_0807494
740 Ga0496114_0272443
741 Ga0496114_1016417
742 Ga0496115_0044258
743 Ga0496115_0389929
744 Ga0496124_0387217
745 Ga0496125_0064488
746 Ga0496125_0298307
747 Ga0496126_0064657
748 Ga0501031_0146900
749 Ga0501031_0962655
750 Ga0501032_0321068
751 Ga0501034_0075725
752 Ga0501036_0699989
753 Ga0501037_0156665
754 Ga0501037_0402265
755 Ga0501038_0622014
756 Ga0501039_0373710
757 Ga0501041_0094690
758 Ga0501042_0737090
759 Ga0501043_0236006
760 Ga0501047_0061047
761 Ga0501047_0217179
762 Ga0501047_1368247
763 Ga0501048_0330450
764 Ga0501048_1238833
765 Ga0501069_0371676
766 Ga0501070_0012403
767 Ga0501071_0012141
768 Ga0501072_0004379
769 Ga0501072_0457932
770 Ga0501073_0418935
771 Ga0501074_0584219
772 Ga0501074_1068200
773 Ga0501075_0027955
774 Ga0501079_0752761
775 Ga0501080_0626941
776 Ga0501083_0106233
777 Ga0501035_0184123
778 Ga0501035_0690784
779 Ga0501044_0382717
780 Ga0501044_0427025
781 Ga0501044_1052692
782 Ga0501044_1213841
783 nmdc:mga03n38_55175_c1
784 nmdc:mga00v17_271869_c1
785 nmdc:mga00v17_446755_c1
786 nmdc:mga00v17_78786_c1
787 nmdc:mga0yw44_1216913_c1
788 nmdc:mga0yw44_349285_c1
789 nmdc:mga0yw44_778793_c1
790 nmdc:mga06z11_127277_c1
791 nmdc:mga04h51_107380_c1
792 nmdc:mga04h51_211472_c1
793 nmdc:mga07m45_497909_c1
794 nmdc:mga05p37_19_c2
795 nmdc:mga05p37_4690_c1
796 nmdc:mga09592_1297_c1
797 nmdc:mga0qj67_259_c1
798 nmdc:mga0qj67_798145_c1
799 nmdc:mga06r32_1133_c1
800 nmdc:mga08y16_354_c1
801 nmdc:mga0n895_5683_c1
802 nmdc:mga0n895_701_c1
803 nmdc:mga0n895_895664_c1
804 nmdc:mga0rr50_263748_c1
805 nmdc:mga0rr50_35347_c1
806 nmdc:mga0a205_10392_c1
807 nmdc:mga0a205_249_c1
808 nmdc:mga0sz30_267942_c1
809 Ga0495601_0000186
810 Ga0495601_0000677
811 Ga0495601_0007966
812 Ga0495601_0118982
813 Ga0495612_0015407
814 Ga0495612_0084595
815 Ga0495655_0277574
816 Ga0495595_0001358
817 Ga0495595_0009090
818 Ga0495619_0000052
819 Ga0495619_0007321
820 Ga0495619_0068037
821 Ga0500566_0325375
822 Ga0500641_0119801
823 Ga0500618_069537
824 Ga0500636_0048660
825 Ga0500636_0111012
826 Ga0500657_140773
827 Ga0501084_0333939
828 Ga0590071_057696
829 Ga0587066_182381
830 Ga0587068_096506
831 Ga0501082_0063488
832 Ga0501082_0222671
833 Ga0466962_0013427
834 Ga0530510_0007398
835 2513659500
836 2513921567
837 2793072721
838 2844315533
839 2903733698
840 2904708412
841 2906609471
842 2906613585
843 2922434021
844 2935636048
845 2941512648
846 2941520514
847 2941528528
848 3005475265
849 8006936013
850 8006975863
851 8019562641
852 8019572720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10984

DUF2794

Protein of unknown function (DUF2794)

47

131

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fjr-assembly1.cif.gz_A-2 structure of a mutant of ospa 0.6923 61 97
5xqj-assembly2.cif.gz_C crystal structure of a pl 26 exo-rhamnogalacturonan lyase from penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose 0.644 55 103
3ckg-assembly1.cif.gz_A the crystal structure of ospa deletion mutant 0.6435 61 100
6kwv-assembly1.cif.gz_O a crystal structure of ospa mutant 0.6263 55 97
3vqx-assembly2.cif.gz_D crystal structure of the catalytic domain of pyrrolysyl-trna synthetase in triclinic crystal form 0.62 28 84
ID Description Score Start End Superfamily
af_A0A1D6L052_103_280_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7195 55 83 3.60.21.10
af_Q4CRA5_13_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7173 51 86 3.30.420.40
af_Q54NM4_122_303_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.712 64 102 2.40.160.120
af_Q8GWL2_12_181_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.7061 65 103 2.40.160.200
af_K7KQ43_71_310_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7055 55 83 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A6B2D5P4-F1-model_v4 deleted 0.9755 28 116
AF-A0A6I6MRZ0-F1-model_v4 DUF2794 domain-containing protein 0.9734 28 117
AF-A0A2G2LDX6-F1-model_v4 DUF2794 domain-containing protein 0.9708 28 117
AF-A0A3M1PTJ5-F1-model_v4 DUF2794 domain-containing protein 0.9694 28 83
AF-A0A1E4FKR6-F1-model_v4 DUF2794 domain-containing protein 0.9621 28 123

Map