F441077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 425 | 271 | 420 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300053096|Ga0500641_0104242|Ga0500641_0104242_477_818 |
| Length | 113 |
| Sequence | MTRLAFILALLFAAPWEQAEIVDVKDRGAVDLKPFNCQDVTRSVISRVCYDAASRRMLVQRHATYHQYCDLPKHTLDAFLNAPSMGQYFNANIKAVGGNGPYDCRTPKVRSYQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791355199 | |||
| 2 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 3 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 4 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 5 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 144 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 147 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 156 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 157 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 158 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 159 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 160 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 161 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 237 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 238 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 239 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 246 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 247 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 248 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 249 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 250 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 251 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 252 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 253 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 254 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 255 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 256 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 257 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 258 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 259 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 262 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 263 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 264 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 265 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 266 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 267 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 268 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 269 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 270 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 271 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0 |
| Isolates | 0.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.59 |
| Nodule | 0.47 |
| Rhizoplane | 4.71 |
| Rhizosphere | 69.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10034185 | 3300003320 | Bacteria | 1507 |
| 2 | rootL2_10053669 | 3300003322 | Bacteria | 2540 |
| 3 | Ga0068869_100405940 | 3300005334 | Bacteria | 1121 |
| 4 | Ga0068869_100449045 | 3300005334 | Bacteria | 1068 |
| 5 | Ga0070682_100334189 | 3300005337 | Bacteria | 1124 |
| 6 | Ga0068868_100053907 | 3300005338 | Bacteria | 3168 |
| 7 | Ga0068868_100521116 | 3300005338 | Bacteria | 1043 |
| 8 | Ga0068868_102424335 | 3300005338 | Unclassified | 501 |
| 9 | Ga0070660_100066999 | 3300005339 | Bacteria | 2797 |
| 10 | Ga0070689_100040088 | 3300005340 | Bacteria | 3589 |
| 11 | Ga0070661_100240547 | 3300005344 | Bacteria | 1394 |
| 12 | Ga0070692_10320766 | 3300005345 | Bacteria | 952 |
| 13 | Ga0070668_100011355 | 3300005347 | Bacteria | 6635 |
| 14 | Ga0070668_100114051 | 3300005347 | Bacteria | 2153 |
| 15 | Ga0070668_100145595 | 3300005347 | Bacteria | 1912 |
| 16 | Ga0070668_100494638 | 3300005347 | Bacteria | 1058 |
| 17 | Ga0070668_100698574 | 3300005347 | Bacteria | 894 |
| 18 | Ga0070668_100949900 | 3300005347 | Bacteria | 770 |
| 19 | Ga0070668_101824096 | 3300005347 | Bacteria | 559 |
| 20 | Ga0070669_101203064 | 3300005353 | Bacteria | 655 |
| 21 | Ga0070671_101927512 | 3300005355 | Bacteria | 526 |
| 22 | Ga0070673_100370555 | 3300005364 | Bacteria | 1275 |
| 23 | Ga0070688_100063221 | 3300005365 | Bacteria | 2345 |
| 24 | Ga0070659_100589087 | 3300005366 | Bacteria | 955 |
| 25 | Ga0070667_101075359 | 3300005367 | Bacteria | 752 |
| 26 | Ga0070700_100220161 | 3300005441 | Bacteria | 1344 |
| 27 | Ga0070694_100636910 | 3300005444 | Bacteria | 862 |
| 28 | Ga0070663_100007837 | 3300005455 | Bacteria | 6530 |
| 29 | Ga0070663_100330480 | 3300005455 | Bacteria | 1229 |
| 30 | Ga0070678_100033929 | 3300005456 | Bacteria | 3548 |
| 31 | Ga0070678_100137260 | 3300005456 | Bacteria | 1952 |
| 32 | Ga0070678_101567924 | 3300005456 | Bacteria | 618 |
| 33 | Ga0070662_100221316 | 3300005457 | Bacteria | 1510 |
| 34 | Ga0070662_100614975 | 3300005457 | Bacteria | 915 |
| 35 | Ga0070685_10155102 | 3300005466 | Bacteria | 1454 |
| 36 | Ga0070698_100539320 | 3300005471 | Bacteria | 1106 |
| 37 | Ga0070699_100305866 | 3300005518 | Bacteria | 1427 |
| 38 | Ga0068853_100153536 | 3300005539 | Bacteria | 2073 |
| 39 | Ga0068853_101706412 | 3300005539 | Bacteria | 610 |
| 40 | Ga0070672_101129517 | 3300005543 | Bacteria | 697 |
| 41 | Ga0070672_101289861 | 3300005543 | Bacteria | 652 |
| 42 | Ga0070686_100201027 | 3300005544 | Bacteria | 1428 |
| 43 | Ga0070695_100073320 | 3300005545 | Bacteria | 2246 |
| 44 | Ga0070696_100860902 | 3300005546 | Bacteria | 750 |
| 45 | Ga0070693_100563035 | 3300005547 | Bacteria | 817 |
| 46 | Ga0070665_100064844 | 3300005548 | Bacteria | 3664 |
| 47 | Ga0070665_100566556 | 3300005548 | Bacteria | 1148 |
| 48 | Ga0070665_100654791 | 3300005548 | Bacteria | 1063 |
| 49 | Ga0070704_101034911 | 3300005549 | Bacteria | 744 |
| 50 | Ga0068856_100102134 | 3300005614 | Bacteria | 2860 |
| 51 | Ga0070702_101194747 | 3300005615 | Bacteria | 613 |
| 52 | Ga0068852_100103780 | 3300005616 | Bacteria | 2572 |
| 53 | Ga0068852_100582373 | 3300005616 | Bacteria | 1122 |
| 54 | Ga0068859_100025848 | 3300005617 | Bacteria | 5890 |
| 55 | Ga0068859_100894880 | 3300005617 | Bacteria | 972 |
| 56 | Ga0068864_100108510 | 3300005618 | Bacteria | 2470 |
| 57 | Ga0068861_100512489 | 3300005719 | Bacteria | 1086 |
| 58 | Ga0068851_10329513 | 3300005834 | Bacteria | 884 |
| 59 | Ga0068870_10019559 | 3300005840 | Bacteria | 3286 |
| 60 | Ga0068863_100242724 | 3300005841 | Bacteria | 1739 |
| 61 | Ga0068863_100291547 | 3300005841 | Bacteria | 1582 |
| 62 | Ga0068863_101647728 | 3300005841 | Bacteria | 651 |
| 63 | Ga0068860_100036330 | 3300005843 | Bacteria | 4721 |
| 64 | Ga0068860_100162554 | 3300005843 | Bacteria | 2153 |
| 65 | Ga0068860_100481785 | 3300005843 | Bacteria | 1236 |
| 66 | Ga0068862_100349548 | 3300005844 | Bacteria | 1371 |
| 67 | Ga0068862_100361911 | 3300005844 | Bacteria | 1348 |
| 68 | Ga0068862_100385874 | 3300005844 | Bacteria | 1307 |
| 69 | Ga0081455_10103304 | 3300005937 | Bacteria | 2283 |
| 70 | Ga0081455_10484567 | 3300005937 | Bacteria | 835 |
| 71 | Ga0081540_1008133 | 3300005983 | Bacteria | 7358 |
| 72 | Ga0081539_10146220 | 3300005985 | Bacteria | 1142 |
| 73 | Ga0081539_10175943 | 3300005985 | Bacteria | 1008 |
| 74 | Ga0075365_10053132 | 3300006038 | Bacteria | 2682 |
| 75 | Ga0075365_10105552 | 3300006038 | Bacteria | 1932 |
| 76 | Ga0075365_10139466 | 3300006038 | Bacteria | 1683 |
| 77 | Ga0075368_10048237 | 3300006042 | Bacteria | 1688 |
| 78 | Ga0075368_10083775 | 3300006042 | Bacteria | 1299 |
| 79 | Ga0075363_100080617 | 3300006048 | Bacteria | 1780 |
| 80 | Ga0075363_100124999 | 3300006048 | Bacteria | 1439 |
| 81 | Ga0075363_100169354 | 3300006048 | Bacteria | 1239 |
| 82 | Ga0075364_10161465 | 3300006051 | Bacteria | 1512 |
| 83 | Ga0075432_10446605 | 3300006058 | Bacteria | 567 |
| 84 | Ga0070715_10939378 | 3300006163 | Bacteria | 535 |
| 85 | Ga0075362_10018906 | 3300006177 | Bacteria | 2859 |
| 86 | Ga0075362_10044367 | 3300006177 | Bacteria | 1971 |
| 87 | Ga0075362_10060323 | 3300006177 | Bacteria | 1714 |
| 88 | Ga0075362_10126454 | 3300006177 | Bacteria | 1213 |
| 89 | Ga0075362_10551160 | 3300006177 | Bacteria | 593 |
| 90 | Ga0075367_10090246 | 3300006178 | Bacteria | 1864 |
| 91 | Ga0075367_10106794 | 3300006178 | Bacteria | 1716 |
| 92 | Ga0075367_10784125 | 3300006178 | Bacteria | 607 |
| 93 | Ga0075369_10012585 | 3300006186 | Bacteria | 3342 |
| 94 | Ga0075366_10019651 | 3300006195 | Bacteria | 3913 |
| 95 | Ga0075366_10075167 | 3300006195 | Bacteria | 2015 |
| 96 | Ga0075366_10189791 | 3300006195 | Bacteria | 1249 |
| 97 | Ga0075366_10647429 | 3300006195 | Bacteria | 656 |
| 98 | Ga0075370_10053960 | 3300006353 | Bacteria | 2281 |
| 99 | Ga0075370_10065687 | 3300006353 | Bacteria | 2069 |
| 100 | Ga0075370_10120446 | 3300006353 | Bacteria | 1527 |
| 101 | Ga0075370_10213512 | 3300006353 | Bacteria | 1139 |
| 102 | Ga0075370_10923536 | 3300006353 | Bacteria | 534 |
| 103 | Ga0068871_100009991 | 3300006358 | Bacteria | 6897 |
| 104 | Ga0068871_100654958 | 3300006358 | Bacteria | 959 |
| 105 | Ga0075428_100104254 | 3300006844 | Bacteria | 3092 |
| 106 | Ga0068865_100396043 | 3300006881 | Bacteria | 1130 |
| 107 | Ga0068865_100771065 | 3300006881 | Bacteria | 827 |
| 108 | Ga0068865_101052932 | 3300006881 | Bacteria | 714 |
| 109 | Ga0097620_100025848 | 3300006931 | Bacteria | 5890 |
| 110 | Ga0097620_100894855 | 3300006931 | Bacteria | 972 |
| 111 | Ga0075435_100178399 | 3300007076 | Bacteria | 1795 |
| 112 | Ga0099795_10075450 | 3300007788 | Bacteria | 1280 |
| 113 | Ga0105250_10047525 | 3300009092 | Bacteria | 1721 |
| 114 | Ga0105250_10087582 | 3300009092 | Bacteria | 1265 |
| 115 | Ga0105240_10509304 | 3300009093 | Bacteria | 1337 |
| 116 | Ga0105245_10013930 | 3300009098 | Bacteria | 7004 |
| 117 | Ga0105245_11608428 | 3300009098 | Bacteria | 701 |
| 118 | Ga0105247_10058680 | 3300009101 | Bacteria | 2381 |
| 119 | Ga0105247_10595204 | 3300009101 | Bacteria | 819 |
| 120 | Ga0114129_10240232 | 3300009147 | Bacteria | 2435 |
| 121 | Ga0114129_11581972 | 3300009147 | Bacteria | 803 |
| 122 | Ga0105243_10218860 | 3300009148 | Bacteria | 1682 |
| 123 | Ga0105243_10377923 | 3300009148 | Bacteria | 1309 |
| 124 | Ga0105243_11149265 | 3300009148 | Unclassified | 787 |
| 125 | Ga0105243_11230069 | 3300009148 | Bacteria | 763 |
| 126 | Ga0105242_10429798 | 3300009176 | Bacteria | 1240 |
| 127 | Ga0105242_12375259 | 3300009176 | Bacteria | 577 |
| 128 | Ga0105248_10014109 | 3300009177 | Bacteria | 8793 |
| 129 | Ga0105237_10082630 | 3300009545 | Bacteria | 3203 |
| 130 | Ga0105249_10502640 | 3300009553 | Bacteria | 1258 |
| 131 | Ga0105249_10746574 | 3300009553 | Bacteria | 1041 |
| 132 | Ga0105249_11579731 | 3300009553 | Bacteria | 728 |
| 133 | Ga0105239_10007120 | 3300010375 | Bacteria | 12868 |
| 134 | Ga0105239_10487032 | 3300010375 | Bacteria | 1401 |
| 135 | Ga0105246_10038604 | 3300011119 | Bacteria | 3212 |
| 136 | Ga0105246_10348082 | 3300011119 | Bacteria | 1213 |
| 137 | Ga0157374_11276934 | 3300013296 | Bacteria | 756 |
| 138 | Ga0157378_10429495 | 3300013297 | Bacteria | 1307 |
| 139 | Ga0163162_10264274 | 3300013306 | Bacteria | 1852 |
| 140 | Ga0163162_10981655 | 3300013306 | Bacteria | 954 |
| 141 | Ga0163162_11136933 | 3300013306 | Bacteria | 885 |
| 142 | Ga0157375_10644433 | 3300013308 | Bacteria | 1216 |
| 143 | Ga0163163_12355147 | 3300014325 | Bacteria | 591 |
| 144 | Ga0157380_10174402 | 3300014326 | Bacteria | 1882 |
| 145 | Ga0157380_11481879 | 3300014326 | Bacteria | 731 |
| 146 | Ga0157377_10377718 | 3300014745 | Bacteria | 958 |
| 147 | Ga0157377_10451158 | 3300014745 | Bacteria | 888 |
| 148 | Ga0157379_10281784 | 3300014968 | Bacteria | 1513 |
| 149 | Ga0157376_10074460 | 3300014969 | Bacteria | 2894 |
| 150 | Ga0157376_10168076 | 3300014969 | Bacteria | 1994 |
| 151 | Ga0157376_11019344 | 3300014969 | Bacteria | 851 |
| 152 | Ga0157376_11405161 | 3300014969 | Bacteria | 730 |
| 153 | Ga0163161_10532669 | 3300017792 | Bacteria | 960 |
| 154 | Ga0209758_1002180 | 3300025297 | Bacteria | 20532 |
| 155 | Ga0207710_10029511 | 3300025900 | Bacteria | 2387 |
| 156 | Ga0207688_10008199 | 3300025901 | Bacteria | 5677 |
| 157 | Ga0207647_10085687 | 3300025904 | Bacteria | 1884 |
| 158 | Ga0207643_10062650 | 3300025908 | Bacteria | 2125 |
| 159 | Ga0207684_10919561 | 3300025910 | Bacteria | 735 |
| 160 | Ga0207654_10035557 | 3300025911 | Bacteria | 2777 |
| 161 | Ga0207671_10042950 | 3300025914 | Bacteria | 3344 |
| 162 | Ga0207657_10326021 | 3300025919 | Bacteria | 1214 |
| 163 | Ga0207649_10061377 | 3300025920 | Bacteria | 2366 |
| 164 | Ga0207649_10494806 | 3300025920 | Bacteria | 929 |
| 165 | Ga0207646_10449982 | 3300025922 | Bacteria | 1162 |
| 166 | Ga0207681_10690828 | 3300025923 | Bacteria | 848 |
| 167 | Ga0207694_10282626 | 3300025924 | Bacteria | 1363 |
| 168 | Ga0207687_10044331 | 3300025927 | Bacteria | 3069 |
| 169 | Ga0207644_10109726 | 3300025931 | Bacteria | 2085 |
| 170 | Ga0207690_11250492 | 3300025932 | Bacteria | 620 |
| 171 | Ga0207706_10032724 | 3300025933 | Bacteria | 4629 |
| 172 | Ga0207686_10399833 | 3300025934 | Bacteria | 1046 |
| 173 | Ga0207709_10325745 | 3300025935 | Bacteria | 1152 |
| 174 | Ga0207704_10236216 | 3300025938 | Bacteria | 1363 |
| 175 | Ga0207691_11048895 | 3300025940 | Bacteria | 679 |
| 176 | Ga0207711_10068171 | 3300025941 | Bacteria | 3081 |
| 177 | Ga0207689_10311076 | 3300025942 | Bacteria | 1306 |
| 178 | Ga0207689_10566808 | 3300025942 | Bacteria | 954 |
| 179 | Ga0207689_10584328 | 3300025942 | Bacteria | 939 |
| 180 | Ga0207689_11339098 | 3300025942 | Bacteria | 601 |
| 181 | Ga0207651_11130322 | 3300025960 | Bacteria | 702 |
| 182 | Ga0207668_10550399 | 3300025972 | Bacteria | 999 |
| 183 | Ga0207640_10653517 | 3300025981 | Bacteria | 896 |
| 184 | Ga0207658_11127322 | 3300025986 | Bacteria | 717 |
| 185 | Ga0207677_10783810 | 3300026023 | Bacteria | 852 |
| 186 | Ga0207703_10793574 | 3300026035 | Bacteria | 904 |
| 187 | Ga0207639_10049503 | 3300026041 | Bacteria | 3187 |
| 188 | Ga0207639_10253959 | 3300026041 | Bacteria | 1534 |
| 189 | Ga0207639_11188997 | 3300026041 | Bacteria | 716 |
| 190 | Ga0207678_10019008 | 3300026067 | Bacteria | 6036 |
| 191 | Ga0207678_10029500 | 3300026067 | Bacteria | 4788 |
| 192 | Ga0207678_10594798 | 3300026067 | Bacteria | 970 |
| 193 | Ga0207708_10071680 | 3300026075 | Bacteria | 2654 |
| 194 | Ga0207708_10511922 | 3300026075 | Bacteria | 1007 |
| 195 | Ga0207708_10709655 | 3300026075 | Bacteria | 860 |
| 196 | Ga0207702_10041361 | 3300026078 | Bacteria | 3865 |
| 197 | Ga0207641_10025123 | 3300026088 | Bacteria | 4911 |
| 198 | Ga0207641_10461540 | 3300026088 | Bacteria | 1229 |
| 199 | Ga0207675_100046630 | 3300026118 | Bacteria | 4049 |
| 200 | Ga0207675_100187601 | 3300026118 | Bacteria | 1982 |
| 201 | Ga0207675_102349535 | 3300026118 | Bacteria | 546 |
| 202 | Ga0207683_10065818 | 3300026121 | Bacteria | 3195 |
| 203 | Ga0207683_10141240 | 3300026121 | Bacteria | 2170 |
| 204 | Ga0207683_10162274 | 3300026121 | Bacteria | 2021 |
| 205 | Ga0207683_10512419 | 3300026121 | Bacteria | 1108 |
| 206 | Ga0207698_10083440 | 3300026142 | Bacteria | 2586 |
| 207 | Ga0207698_11149116 | 3300026142 | Bacteria | 790 |
| 208 | Ga0268266_10031885 | 3300028379 | Bacteria | 4477 |
| 209 | Ga0268266_10048964 | 3300028379 | Bacteria | 3622 |
| 210 | Ga0268266_10084660 | 3300028379 | Bacteria | 2769 |
| 211 | Ga0268266_10416490 | 3300028379 | Bacteria | 1272 |
| 212 | Ga0268266_10460784 | 3300028379 | Bacteria | 1209 |
| 213 | Ga0268266_11673824 | 3300028379 | Bacteria | 611 |
| 214 | Ga0268265_10604419 | 3300028380 | Bacteria | 1048 |
| 215 | Ga0268265_10618896 | 3300028380 | Bacteria | 1037 |
| 216 | Ga0268265_11564769 | 3300028380 | Bacteria | 664 |
| 217 | Ga0268264_10083749 | 3300028381 | Bacteria | 2732 |
| 218 | Ga0268264_10226084 | 3300028381 | Bacteria | 1725 |
| 219 | Ga0268264_10304597 | 3300028381 | Bacteria | 1501 |
| 220 | Ga0307517_10102407 | 3300028786 | Bacteria | 2245 |
| 221 | Ga0307517_10230641 | 3300028786 | Bacteria | 1112 |
| 222 | Ga0307517_10618287 | 3300028786 | Bacteria | 531 |
| 223 | Ga0307513_10275993 | 3300031456 | Bacteria | 1461 |
| 224 | Ga0307509_10212034 | 3300031507 | Bacteria | 1760 |
| 225 | Ga0307408_100143771 | 3300031548 | Bacteria | 1875 |
| 226 | Ga0307408_100381648 | 3300031548 | Bacteria | 1205 |
| 227 | Ga0307413_10022807 | 3300031824 | Bacteria | 3382 |
| 228 | Ga0307410_10065482 | 3300031852 | Bacteria | 2500 |
| 229 | Ga0307407_10378287 | 3300031903 | Bacteria | 1010 |
| 230 | Ga0307412_10257613 | 3300031911 | Bacteria | 1358 |
| 231 | Ga0307416_100086079 | 3300032002 | Bacteria | 2678 |
| 232 | Ga0307416_100306833 | 3300032002 | Bacteria | 1581 |
| 233 | Ga0307416_100350746 | 3300032002 | Bacteria | 1493 |
| 234 | Ga0307416_100747804 | 3300032002 | Bacteria | 1070 |
| 235 | Ga0307414_10135138 | 3300032004 | Bacteria | 1921 |
| 236 | Ga0307411_10198026 | 3300032005 | Bacteria | 1540 |
| 237 | Ga0307411_12209786 | 3300032005 | Bacteria | 516 |
| 238 | Ga0307415_100167411 | 3300032126 | Bacteria | 1710 |
| 239 | Ga0307510_10046908 | 3300033180 | Bacteria | 4638 |
| 240 | Ga0373943_0227898 | 3300035170 | Bacteria | 1040 |
| 241 | Ga0373931_0607095 | 3300035691 | Bacteria | 716 |
| 242 | Ga0373927_0447121 | 3300035695 | Bacteria | 853 |
| 243 | Ga0373947_0353892 | 3300035725 | Bacteria | 986 |
| 244 | Ga0373925_0512853 | 3300037068 | Bacteria | 985 |
| 245 | Ga0451787_287229 | 3300041441 | Bacteria | 867 |
| 246 | Ga0451791_0080968 | 3300041451 | Bacteria | 1238 |
| 247 | Ga0451791_0401571 | 3300041451 | Bacteria | 714 |
| 248 | Ga0451793_1559712 | 3300041452 | Bacteria | 625 |
| 249 | Ga0451797_1065054 | 3300041453 | Bacteria | 940 |
| 250 | Ga0451802_0783352 | 3300041460 | Bacteria | 515 |
| 251 | Ga0451807_1048395 | 3300041486 | Bacteria | 1058 |
| 252 | Ga0451833_0161027 | 3300041491 | Bacteria | 543 |
| 253 | Ga0451837_0587790 | 3300041494 | Bacteria | 678 |
| 254 | Ga0451845_0085056 | 3300041501 | Bacteria | 547 |
| 255 | Ga0451853_2066006 | 3300041512 | Bacteria | 784 |
| 256 | Ga0439458_0057036 | 3300042157 | Bacteria | 971 |
| 257 | Ga0439459_0033694 | 3300042438 | Bacteria | 1056 |
| 258 | Ga0495617_047422 | 3300046452 | Bacteria | 1430 |
| 259 | Ga0495617_142384 | 3300046452 | Bacteria | 765 |
| 260 | Ga0495617_265605 | 3300046452 | Bacteria | 527 |
| 261 | Ga0495603_0037517 | 3300046455 | Bacteria | 2908 |
| 262 | Ga0495603_0059489 | 3300046455 | Bacteria | 2259 |
| 263 | Ga0495603_0151614 | 3300046455 | Bacteria | 1346 |
| 264 | Ga0495638_0021293 | 3300046460 | Bacteria | 4274 |
| 265 | Ga0495638_0021639 | 3300046460 | Bacteria | 4233 |
| 266 | Ga0495641_0023391 | 3300046461 | Bacteria | 3070 |
| 267 | Ga0495650_0048895 | 3300046471 | Bacteria | 1759 |
| 268 | Ga0495580_0497181 | 3300046472 | Bacteria | 814 |
| 269 | Ga0495605_0070850 | 3300046474 | Bacteria | 1648 |
| 270 | Ga0495639_0145691 | 3300046475 | Bacteria | 1140 |
| 271 | Ga0495584_0213292 | 3300046491 | Bacteria | 981 |
| 272 | Ga0495584_0348197 | 3300046491 | Bacteria | 752 |
| 273 | Ga0495585_0137421 | 3300046492 | Bacteria | 1282 |
| 274 | Ga0495585_0178206 | 3300046492 | Bacteria | 1094 |
| 275 | Ga0495585_0407335 | 3300046492 | Bacteria | 654 |
| 276 | Ga0495594_0017922 | 3300046499 | Bacteria | 3747 |
| 277 | Ga0495594_0122301 | 3300046499 | Bacteria | 1472 |
| 278 | Ga0495596_0060864 | 3300046500 | Bacteria | 1471 |
| 279 | Ga0495606_0116321 | 3300046507 | Bacteria | 1606 |
| 280 | Ga0495610_0134961 | 3300046512 | Bacteria | 1068 |
| 281 | Ga0495616_0117224 | 3300046513 | Bacteria | 1232 |
| 282 | Ga0495616_0172594 | 3300046513 | Bacteria | 966 |
| 283 | Ga0495620_0030393 | 3300046515 | Bacteria | 2487 |
| 284 | Ga0495631_0502929 | 3300046518 | Bacteria | 516 |
| 285 | Ga0495632_0107022 | 3300046519 | Bacteria | 1315 |
| 286 | Ga0495632_0196012 | 3300046519 | Bacteria | 921 |
| 287 | Ga0495643_0123647 | 3300046522 | Bacteria | 1305 |
| 288 | Ga0495643_0143727 | 3300046522 | Bacteria | 1187 |
| 289 | Ga0495644_0044543 | 3300046523 | Bacteria | 1669 |
| 290 | Ga0495644_0182558 | 3300046523 | Bacteria | 807 |
| 291 | Ga0495648_0222521 | 3300046524 | Bacteria | 930 |
| 292 | Ga0495663_0059712 | 3300046525 | Bacteria | 1197 |
| 293 | Ga0495642_0040449 | 3300046528 | Bacteria | 1894 |
| 294 | Ga0495598_0041694 | 3300046537 | Bacteria | 1344 |
| 295 | Ga0495598_0186007 | 3300046537 | Bacteria | 743 |
| 296 | Ga0495609_0026467 | 3300046538 | Bacteria | 2656 |
| 297 | Ga0495609_0069706 | 3300046538 | Bacteria | 1546 |
| 298 | Ga0495609_0088639 | 3300046538 | Bacteria | 1347 |
| 299 | Ga0495597_0091746 | 3300046542 | Bacteria | 1289 |
| 300 | Ga0495622_0004295 | 3300046557 | Bacteria | 6633 |
| 301 | Ga0495633_0037322 | 3300046558 | Bacteria | 2325 |
| 302 | Ga0495633_0047806 | 3300046558 | Bacteria | 2022 |
| 303 | Ga0495656_0016409 | 3300046615 | Bacteria | 2809 |
| 304 | Ga0495656_0427792 | 3300046615 | Bacteria | 695 |
| 305 | Ga0495668_0112137 | 3300046616 | Bacteria | 1491 |
| 306 | Ga0495668_0347136 | 3300046616 | Bacteria | 814 |
| 307 | Ga0495668_0458058 | 3300046616 | Bacteria | 702 |
| 308 | Ga0495668_0698179 | 3300046616 | Bacteria | 561 |
| 309 | Ga0495611_0094230 | 3300046648 | Bacteria | 1385 |
| 310 | Ga0495625_0391147 | 3300046660 | Bacteria | 870 |
| 311 | Ga0495635_0153797 | 3300046663 | Bacteria | 1566 |
| 312 | Ga0495659_0009566 | 3300046664 | Bacteria | 3097 |
| 313 | Ga0495661_0466756 | 3300046665 | Bacteria | 606 |
| 314 | Ga0495588_0063118 | 3300046674 | Bacteria | 1920 |
| 315 | Ga0495588_0311525 | 3300046674 | Bacteria | 828 |
| 316 | Ga0495669_0344375 | 3300046684 | Bacteria | 720 |
| 317 | Ga0495613_0875054 | 3300046689 | Bacteria | 583 |
| 318 | Ga0495671_0281971 | 3300046692 | Bacteria | 800 |
| 319 | Ga0495671_0366050 | 3300046692 | Bacteria | 691 |
| 320 | Ga0495671_0444042 | 3300046692 | Bacteria | 620 |
| 321 | Ga0495649_0231548 | 3300046694 | Bacteria | 953 |
| 322 | Ga0495589_0200455 | 3300046794 | Bacteria | 942 |
| 323 | Ga0495581_0556142 | 3300047315 | Bacteria | 666 |
| 324 | Ga0495636_0089107 | 3300047318 | Bacteria | 1338 |
| 325 | Ga0495636_0319739 | 3300047318 | Bacteria | 728 |
| 326 | Ga0495676_0043346 | 3300047321 | Bacteria | 3684 |
| 327 | Ga0495683_0269133 | 3300047323 | Bacteria | 741 |
| 328 | Ga0495687_109733 | 3300047443 | Bacteria | 1017 |
| 329 | Ga0495677_0052724 | 3300047445 | Bacteria | 1499 |
| 330 | Ga0495685_024974 | 3300047447 | Bacteria | 2057 |
| 331 | Ga0495686_0086026 | 3300047472 | Bacteria | 1913 |
| 332 | Ga0495602_0586748 | 3300048088 | Bacteria | 768 |
| 333 | Ga0495626_0126088 | 3300048091 | Bacteria | 1097 |
| 334 | Ga0496101_0429842 | 3300048904 | Bacteria | 1041 |
| 335 | Ga0496102_0588397 | 3300048905 | Bacteria | 1036 |
| 336 | Ga0496103_0738644 | 3300048906 | Bacteria | 623 |
| 337 | Ga0496104_0550071 | 3300048907 | Bacteria | 1065 |
| 338 | Ga0496105_0769889 | 3300048908 | Bacteria | 734 |
| 339 | Ga0496106_0077099 | 3300048909 | Bacteria | 2556 |
| 340 | Ga0496108_0311422 | 3300048911 | Bacteria | 1372 |
| 341 | Ga0496109_0076921 | 3300048912 | Bacteria | 3070 |
| 342 | Ga0496110_1241892 | 3300048913 | Bacteria | 654 |
| 343 | Ga0496110_1844095 | 3300048913 | Bacteria | 515 |
| 344 | Ga0496112_0082032 | 3300048915 | Bacteria | 3189 |
| 345 | Ga0496113_0242611 | 3300048916 | Bacteria | 1438 |
| 346 | Ga0496115_0441612 | 3300048918 | Bacteria | 1052 |
| 347 | Ga0496118_0241173 | 3300048921 | Bacteria | 1035 |
| 348 | Ga0496118_0304890 | 3300048921 | Bacteria | 872 |
| 349 | Ga0496121_0035432 | 3300048924 | Bacteria | 4474 |
| 350 | Ga0496121_0065418 | 3300048924 | Bacteria | 2958 |
| 351 | Ga0496121_0065618 | 3300048924 | Bacteria | 2952 |
| 352 | Ga0496121_0824763 | 3300048924 | Bacteria | 542 |
| 353 | Ga0496124_0112828 | 3300048927 | Bacteria | 2185 |
| 354 | Ga0496124_0417359 | 3300048927 | Bacteria | 926 |
| 355 | Ga0496125_0210501 | 3300048928 | Bacteria | 1263 |
| 356 | Ga0496126_0033287 | 3300048929 | Bacteria | 4849 |
| 357 | Ga0496126_0074385 | 3300048929 | Bacteria | 3017 |
| 358 | Ga0496126_0083747 | 3300048929 | Bacteria | 2814 |
| 359 | Ga0496126_0286125 | 3300048929 | Bacteria | 1364 |
| 360 | Ga0496126_0924063 | 3300048929 | Bacteria | 660 |
| 361 | Ga0496126_1065941 | 3300048929 | Bacteria | 602 |
| 362 | Ga0495682_0129050 | 3300049460 | Bacteria | 904 |
| 363 | Ga0501069_0214162 | 3300049585 | Bacteria | 1118 |
| 364 | Ga0501227_178394 | 3300049665 | Bacteria | 596 |
| 365 | Ga0501045_1086548 | 3300049824 | Bacteria | 585 |
| 366 | nmdc:mga03683_30647_c1 | 3300050489 | Bacteria | 2153 |
| 367 | nmdc:mga03683_55762_c1 | 3300050489 | Bacteria | 1660 |
| 368 | nmdc:mga03683_608161_c1 | 3300050489 | Bacteria | 535 |
| 369 | nmdc:mga03n38_37124_c1 | 3300050490 | Bacteria | 2099 |
| 370 | nmdc:mga0yw44_1083708_c1 | 3300050492 | Bacteria | 541 |
| 371 | nmdc:mga0yw44_12675_c1 | 3300050492 | Bacteria | 4405 |
| 372 | nmdc:mga0yw44_184567_c1 | 3300050492 | Bacteria | 1374 |
| 373 | nmdc:mga0yw44_547516_c1 | 3300050492 | Bacteria | 786 |
| 374 | nmdc:mga0k408_71158_c1 | 3300050493 | Bacteria | 2030 |
| 375 | nmdc:mga06z11_148685_c1 | 3300050494 | Bacteria | 1330 |
| 376 | nmdc:mga06z11_32420_c1 | 3300050494 | Bacteria | 2548 |
| 377 | nmdc:mga06z11_97939_c1 | 3300050494 | Bacteria | 1604 |
| 378 | nmdc:mga04h51_24187_c1 | 3300050495 | Bacteria | 1858 |
| 379 | nmdc:mga04h51_78842_c1 | 3300050495 | Bacteria | 1165 |
| 380 | nmdc:mga07m45_188880_c1 | 3300050496 | Bacteria | 1198 |
| 381 | nmdc:mga07m45_209835_c1 | 3300050496 | Bacteria | 1133 |
| 382 | nmdc:mga07m45_330772_c1 | 3300050496 | Bacteria | 885 |
| 383 | nmdc:mga05p37_45620_c1 | 3300050507 | Bacteria | 5389 |
| 384 | nmdc:mga09592_432444_c1 | 3300050508 | Bacteria | 1136 |
| 385 | nmdc:mga0n895_247738_c1 | 3300050512 | Bacteria | 1808 |
| 386 | nmdc:mga0rr50_167805_c1 | 3300050513 | Bacteria | 1786 |
| 387 | nmdc:mga0sz30_34155_c1 | 3300050516 | Bacteria | 2116 |
| 388 | Ga0500610_0245775 | 3300053079 | Bacteria | 829 |
| 389 | Ga0500578_0151382 | 3300053086 | Bacteria | 1445 |
| 390 | Ga0500583_0008100 | 3300053092 | Bacteria | 3746 |
| 391 | Ga0500583_0152677 | 3300053092 | Bacteria | 1149 |
| 392 | Ga0500583_0169947 | 3300053092 | Bacteria | 1086 |
| 393 | Ga0500651_0768510 | 3300053093 | Bacteria | 510 |
| 394 | Ga0500566_0307867 | 3300053094 | Bacteria | 743 |
| 395 | Ga0500641_0004230 | 3300053096 | Bacteria | 5064 |
| 396 | Ga0500641_0020927 | 3300053096 | Bacteria | 2486 |
| 397 | Ga0500641_0104242 | 3300053096 | Bacteria | 1218 |
| 398 | Ga0500562_032245 | 3300053108 | Bacteria | 1382 |
| 399 | Ga0500569_107328 | 3300053109 | Bacteria | 920 |
| 400 | Ga0500582_188091 | 3300053114 | Bacteria | 700 |
| 401 | Ga0500592_044315 | 3300053116 | Bacteria | 721 |
| 402 | Ga0500594_0022120 | 3300053118 | Bacteria | 1601 |
| 403 | Ga0500595_003594 | 3300053119 | Bacteria | 7194 |
| 404 | Ga0500642_0066926 | 3300053130 | Bacteria | 1627 |
| 405 | Ga0500655_009033 | 3300053133 | Bacteria | 1794 |
| 406 | Ga0500658_0067309 | 3300053134 | Bacteria | 1504 |
| 407 | Ga0500658_0100027 | 3300053134 | Bacteria | 1264 |
| 408 | Ga0500658_0117681 | 3300053134 | Bacteria | 1175 |
| 409 | Ga0500568_0102167 | 3300053139 | Bacteria | 1075 |
| 410 | Ga0500577_0086177 | 3300053142 | Bacteria | 1261 |
| 411 | Ga0500579_270563 | 3300053143 | Bacteria | 530 |
| 412 | Ga0500588_0098724 | 3300053146 | Bacteria | 1004 |
| 413 | Ga0500589_128676 | 3300053147 | Bacteria | 1061 |
| 414 | Ga0500590_115655 | 3300053148 | Bacteria | 1265 |
| 415 | Ga0500604_0360888 | 3300053151 | Bacteria | 505 |
| 416 | Ga0500633_0027161 | 3300053160 | Bacteria | 1809 |
| 417 | Ga0500634_0173657 | 3300053161 | Bacteria | 978 |
| 418 | Ga0500637_0114942 | 3300053178 | Bacteria | 1561 |
| 419 | Ga0500645_082810 | 3300053730 | Bacteria | 915 |
| 420 | Ga0500609_007069 | 3300053731 | Bacteria | 1519 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_102424335 | Ga0068868_1024243351 | 110 |
| 2 | 3300005367 | Ga0070667_101075359 | Ga0070667_1010753592 | 110 |
| 3 | 3300005441 | Ga0070700_100220161 | Ga0070700_1002201612 | 110 |
| 4 | 3300005456 | Ga0070678_100137260 | Ga0070678_1001372603 | 110 |
| 5 | 3300005539 | Ga0068853_101706412 | Ga0068853_1017064121 | 110 |
| 6 | 3300005543 | Ga0070672_101129517 | Ga0070672_1011295171 | 110 |
| 7 | 3300005548 | Ga0070665_100566556 | Ga0070665_1005665562 | 110 |
| 8 | 3300005548 | Ga0070665_100654791 | Ga0070665_1006547911 | 110 |
| 9 | 3300006038 | Ga0075365_10139466 | Ga0075365_101394662 | 110 |
| 10 | 3300006048 | Ga0075363_100124999 | Ga0075363_1001249993 | 110 |
| 11 | 3300006177 | Ga0075362_10044367 | Ga0075362_100443673 | 110 |
| 12 | 3300006353 | Ga0075370_10053960 | Ga0075370_100539602 | 110 |
| 13 | 3300006353 | Ga0075370_10213512 | Ga0075370_102135122 | 110 |
| 14 | 3300006358 | Ga0068871_100654958 | Ga0068871_1006549583 | 110 |
| 15 | 3300006881 | Ga0068865_100771065 | Ga0068865_1007710652 | 110 |
| 16 | 3300009101 | Ga0105247_10058680 | Ga0105247_100586803 | 110 |
| 17 | 3300009148 | Ga0105243_11149265 | Ga0105243_111492651 | 110 |
| 18 | 3300009553 | Ga0105249_11579731 | Ga0105249_115797311 | 110 |
| 19 | 3300011119 | Ga0105246_10348082 | Ga0105246_103480822 | 110 |
| 20 | 3300013306 | Ga0163162_10981655 | Ga0163162_109816551 | 110 |
| 21 | 3300014325 | Ga0163163_12355147 | Ga0163163_123551471 | 110 |
| 22 | 3300014326 | Ga0157380_11481879 | Ga0157380_114818792 | 110 |
| 23 | 3300014969 | Ga0157376_11019344 | Ga0157376_110193441 | 110 |
| 24 | 3300025910 | Ga0207684_10919561 | Ga0207684_109195611 | 110 |
| 25 | 3300025920 | Ga0207649_10494806 | Ga0207649_104948062 | 110 |
| 26 | 3300026041 | Ga0207639_11188997 | Ga0207639_111889971 | 110 |
| 27 | 3300026067 | Ga0207678_10019008 | Ga0207678_100190084 | 110 |
| 28 | 3300026075 | Ga0207708_10511922 | Ga0207708_105119222 | 110 |
| 29 | 3300026118 | Ga0207675_102349535 | Ga0207675_1023495351 | 110 |
| 30 | 3300026121 | Ga0207683_10162274 | Ga0207683_101622743 | 110 |
| 31 | 3300026121 | Ga0207683_10512419 | Ga0207683_105124192 | 110 |
| 32 | 3300028379 | Ga0268266_10084660 | Ga0268266_100846601 | 110 |
| 33 | 3300028379 | Ga0268266_10460784 | Ga0268266_104607842 | 110 |
| 34 | 3300031852 | Ga0307410_10065482 | Ga0307410_100654823 | 110 |
| 35 | 3300031911 | Ga0307412_10257613 | Ga0307412_102576132 | 110 |
| 36 | 3300032002 | Ga0307416_100086079 | Ga0307416_1000860793 | 110 |
| 37 | 3300032002 | Ga0307416_100747804 | Ga0307416_1007478042 | 110 |
| 38 | 3300032005 | Ga0307411_10198026 | Ga0307411_101980263 | 110 |
| 39 | 3300032005 | Ga0307411_12209786 | Ga0307411_122097861 | 110 |
| 40 | 3300032126 | Ga0307415_100167411 | Ga0307415_1001674113 | 110 |
| 41 | 3300041441 | Ga0451787_287229 | Ga0451787_287229_251_583 | 110 |
| 42 | 3300041451 | Ga0451791_0080968 | Ga0451791_0080968_760_1092 | 110 |
| 43 | 3300041452 | Ga0451793_1559712 | Ga0451793_1559712_186_518 | 110 |
| 44 | 3300041453 | Ga0451797_1065054 | Ga0451797_1065054_500_832 | 110 |
| 45 | 3300041460 | Ga0451802_0783352 | Ga0451802_0783352_159_491 | 110 |
| 46 | 3300048904 | Ga0496101_0429842 | Ga0496101_0429842_585_983 | 110 |
| 47 | 3300048909 | Ga0496106_0077099 | Ga0496106_0077099_1814_2212 | 110 |
| 48 | 3300048918 | Ga0496115_0441612 | Ga0496115_0441612_30_362 | 110 |
| 49 | 3300048929 | Ga0496126_1065941 | Ga0496126_1065941_105_503 | 110 |
| 50 | 3300050489 | nmdc:mga03683_608161_c1 | nmdc:mga03683_608161_c1_23_355 | 110 |
| 51 | 3300050492 | nmdc:mga0yw44_547516_c1 | nmdc:mga0yw44_547516_c1_422_754 | 110 |
| 52 | 3300050494 | nmdc:mga06z11_97939_c1 | nmdc:mga06z11_97939_c1_1004_1402 | 110 |
| 53 | 3300050496 | nmdc:mga07m45_209835_c1 | nmdc:mga07m45_209835_c1_644_976 | 110 |
| 54 | 3300053096 | Ga0500641_0004230 | Ga0500641_0004230_3321_3665 | 110 |
| 55 | 3300053096 | Ga0500641_0020927 | Ga0500641_0020927_1204_1536 | 110 |
| 56 | 3300053151 | Ga0500604_0360888 | Ga0500604_0360888_149_493 | 110 |
| 57 | 3300005347 | Ga0070668_100494638 | Ga0070668_1004946381 | 111 |
| 58 | 3300005985 | Ga0081539_10146220 | Ga0081539_101462202 | 111 |
| 59 | 3300006038 | Ga0075365_10053132 | Ga0075365_100531321 | 111 |
| 60 | 3300006048 | Ga0075363_100169354 | Ga0075363_1001693542 | 111 |
| 61 | 3300006177 | Ga0075362_10126454 | Ga0075362_101264542 | 111 |
| 62 | 3300006186 | Ga0075369_10012585 | Ga0075369_100125853 | 111 |
| 63 | 3300006195 | Ga0075366_10189791 | Ga0075366_101897911 | 111 |
| 64 | 3300006844 | Ga0075428_100104254 | Ga0075428_1001042544 | 111 |
| 65 | 3300009147 | Ga0114129_10240232 | Ga0114129_102402323 | 111 |
| 66 | 3300009553 | Ga0105249_10746574 | Ga0105249_107465742 | 111 |
| 67 | 3300025972 | Ga0207668_10550399 | Ga0207668_105503992 | 111 |
| 68 | 3300031548 | Ga0307408_100143771 | Ga0307408_1001437712 | 111 |
| 69 | 3300042157 | Ga0439458_0057036 | Ga0439458_0057036_207_542 | 111 |
| 70 | 3300042438 | Ga0439459_0033694 | Ga0439459_0033694_317_652 | 111 |
| 71 | 3300049824 | Ga0501045_1086548 | Ga0501045_1086548_163_498 | 111 |
| 72 | 3300050490 | nmdc:mga03n38_37124_c1 | nmdc:mga03n38_37124_c1_1137_1472 | 111 |
| 73 | 3300050492 | nmdc:mga0yw44_12675_c1 | nmdc:mga0yw44_12675_c1_111_446 | 111 |
| 74 | 3300050507 | nmdc:mga05p37_45620_c1 | nmdc:mga05p37_45620_c1_1003_1338 | 111 |
| 75 | 3300050516 | nmdc:mga0sz30_34155_c1 | nmdc:mga0sz30_34155_c1_1094_1429 | 111 |
| 76 | 3300005337 | Ga0070682_100334189 | Ga0070682_1003341891 | 112 |
| 77 | 3300005616 | Ga0068852_100582373 | Ga0068852_1005823731 | 112 |
| 78 | 3300010375 | Ga0105239_10487032 | Ga0105239_104870322 | 112 |
| 79 | 3300025920 | Ga0207649_10061377 | Ga0207649_100613773 | 112 |
| 80 | 3300026142 | Ga0207698_11149116 | Ga0207698_111491161 | 112 |
| 81 | 3300041451 | Ga0451791_0401571 | Ga0451791_0401571_185_523 | 112 |
| 82 | 3300041486 | Ga0451807_1048395 | Ga0451807_1048395_23_361 | 112 |
| 83 | 3300041491 | Ga0451833_0161027 | Ga0451833_0161027_149_487 | 112 |
| 84 | 3300041494 | Ga0451837_0587790 | Ga0451837_0587790_312_650 | 112 |
| 85 | 3300041501 | Ga0451845_0085056 | Ga0451845_0085056_38_376 | 112 |
| 86 | 3300041512 | Ga0451853_2066006 | Ga0451853_2066006_292_630 | 112 |
| 87 | iso_pu_bacteria | 2791355199 | 2793079545 | 112 |
| 88 | iso_pu_bacteria | 2876808645 | 2876817776 | 112 |
| 89 | iso_pu_bacteria | 2879110137 | 2879118060 | 112 |
| 90 | iso_pu_bacteria | 2889033259 | 2889033653 | 112 |
| 91 | iso_pu_bacteria | 2922386360 | 2922390201 | 112 |
| 92 | 3300046500 | Ga0495596_0060864 | Ga0495596_0060864_291_632 | 113 |
| 93 | 3300046692 | Ga0495671_0281971 | Ga0495671_0281971_271_612 | 113 |
| 94 | 3300046694 | Ga0495649_0231548 | Ga0495649_0231548_523_864 | 113 |
| 95 | 3300053096 | Ga0500641_0104242 | Ga0500641_0104242_477_818 | 113 |
| 96 | 3300005334 | Ga0068869_100405940 | Ga0068869_1004059402 | 114 |
| 97 | 3300005334 | Ga0068869_100449045 | Ga0068869_1004490452 | 114 |
| 98 | 3300005338 | Ga0068868_100053907 | Ga0068868_1000539073 | 114 |
| 99 | 3300005338 | Ga0068868_100521116 | Ga0068868_1005211162 | 114 |
| 100 | 3300005339 | Ga0070660_100066999 | Ga0070660_1000669992 | 114 |
| 101 | 3300005340 | Ga0070689_100040088 | Ga0070689_1000400883 | 114 |
| 102 | 3300005344 | Ga0070661_100240547 | Ga0070661_1002405473 | 114 |
| 103 | 3300005345 | Ga0070692_10320766 | Ga0070692_103207662 | 114 |
| 104 | 3300005347 | Ga0070668_100011355 | Ga0070668_1000113552 | 114 |
| 105 | 3300005347 | Ga0070668_100114051 | Ga0070668_1001140512 | 114 |
| 106 | 3300005347 | Ga0070668_100145595 | Ga0070668_1001455953 | 114 |
| 107 | 3300005347 | Ga0070668_100698574 | Ga0070668_1006985741 | 114 |
| 108 | 3300005347 | Ga0070668_100949900 | Ga0070668_1009499002 | 114 |
| 109 | 3300005347 | Ga0070668_101824096 | Ga0070668_1018240962 | 114 |
| 110 | 3300005353 | Ga0070669_101203064 | Ga0070669_1012030642 | 114 |
| 111 | 3300005355 | Ga0070671_101927512 | Ga0070671_1019275121 | 114 |
| 112 | 3300005364 | Ga0070673_100370555 | Ga0070673_1003705551 | 114 |
| 113 | 3300005365 | Ga0070688_100063221 | Ga0070688_1000632213 | 114 |
| 114 | 3300005366 | Ga0070659_100589087 | Ga0070659_1005890871 | 114 |
| 115 | 3300005444 | Ga0070694_100636910 | Ga0070694_1006369102 | 114 |
| 116 | 3300005455 | Ga0070663_100007837 | Ga0070663_1000078371 | 114 |
| 117 | 3300005455 | Ga0070663_100330480 | Ga0070663_1003304801 | 114 |
| 118 | 3300005456 | Ga0070678_100033929 | Ga0070678_1000339293 | 114 |
| 119 | 3300005456 | Ga0070678_101567924 | Ga0070678_1015679242 | 114 |
| 120 | 3300005457 | Ga0070662_100221316 | Ga0070662_1002213162 | 114 |
| 121 | 3300005457 | Ga0070662_100614975 | Ga0070662_1006149752 | 114 |
| 122 | 3300005466 | Ga0070685_10155102 | Ga0070685_101551021 | 114 |
| 123 | 3300005471 | Ga0070698_100539320 | Ga0070698_1005393202 | 114 |
| 124 | 3300005518 | Ga0070699_100305866 | Ga0070699_1003058662 | 114 |
| 125 | 3300005539 | Ga0068853_100153536 | Ga0068853_1001535362 | 114 |
| 126 | 3300005543 | Ga0070672_101289861 | Ga0070672_1012898612 | 114 |
| 127 | 3300005544 | Ga0070686_100201027 | Ga0070686_1002010272 | 114 |
| 128 | 3300005545 | Ga0070695_100073320 | Ga0070695_1000733202 | 114 |
| 129 | 3300005546 | Ga0070696_100860902 | Ga0070696_1008609022 | 114 |
| 130 | 3300005547 | Ga0070693_100563035 | Ga0070693_1005630352 | 114 |
| 131 | 3300005548 | Ga0070665_100064844 | Ga0070665_1000648444 | 114 |
| 132 | 3300005549 | Ga0070704_101034911 | Ga0070704_1010349112 | 114 |
| 133 | 3300005614 | Ga0068856_100102134 | Ga0068856_1001021343 | 114 |
| 134 | 3300005615 | Ga0070702_101194747 | Ga0070702_1011947472 | 114 |
| 135 | 3300005616 | Ga0068852_100103780 | Ga0068852_1001037803 | 114 |
| 136 | 3300005617 | Ga0068859_100025848 | Ga0068859_1000258484 | 114 |
| 137 | 3300005617 | Ga0068859_100894880 | Ga0068859_1008948802 | 114 |
| 138 | 3300005618 | Ga0068864_100108510 | Ga0068864_1001085101 | 114 |
| 139 | 3300005719 | Ga0068861_100512489 | Ga0068861_1005124892 | 114 |
| 140 | 3300005834 | Ga0068851_10329513 | Ga0068851_103295131 | 114 |
| 141 | 3300005840 | Ga0068870_10019559 | Ga0068870_100195593 | 114 |
| 142 | 3300005841 | Ga0068863_100242724 | Ga0068863_1002427244 | 114 |
| 143 | 3300005841 | Ga0068863_100291547 | Ga0068863_1002915471 | 114 |
| 144 | 3300005841 | Ga0068863_101647728 | Ga0068863_1016477282 | 114 |
| 145 | 3300005843 | Ga0068860_100036330 | Ga0068860_1000363306 | 114 |
| 146 | 3300005843 | Ga0068860_100162554 | Ga0068860_1001625542 | 114 |
| 147 | 3300005843 | Ga0068860_100481785 | Ga0068860_1004817853 | 114 |
| 148 | 3300005844 | Ga0068862_100349548 | Ga0068862_1003495481 | 114 |
| 149 | 3300005844 | Ga0068862_100361911 | Ga0068862_1003619112 | 114 |
| 150 | 3300005844 | Ga0068862_100385874 | Ga0068862_1003858743 | 114 |
| 151 | 3300005983 | Ga0081540_1008133 | Ga0081540_10081333 | 114 |
| 152 | 3300006038 | Ga0075365_10105552 | Ga0075365_101055523 | 114 |
| 153 | 3300006042 | Ga0075368_10048237 | Ga0075368_100482373 | 114 |
| 154 | 3300006042 | Ga0075368_10083775 | Ga0075368_100837753 | 114 |
| 155 | 3300006048 | Ga0075363_100080617 | Ga0075363_1000806172 | 114 |
| 156 | 3300006051 | Ga0075364_10161465 | Ga0075364_101614651 | 114 |
| 157 | 3300006058 | Ga0075432_10446605 | Ga0075432_104466051 | 114 |
| 158 | 3300006163 | Ga0070715_10939378 | Ga0070715_109393781 | 114 |
| 159 | 3300006177 | Ga0075362_10060323 | Ga0075362_100603233 | 114 |
| 160 | 3300006177 | Ga0075362_10551160 | Ga0075362_105511602 | 114 |
| 161 | 3300006178 | Ga0075367_10090246 | Ga0075367_100902463 | 114 |
| 162 | 3300006178 | Ga0075367_10106794 | Ga0075367_101067942 | 114 |
| 163 | 3300006178 | Ga0075367_10784125 | Ga0075367_107841252 | 114 |
| 164 | 3300006195 | Ga0075366_10019651 | Ga0075366_100196511 | 114 |
| 165 | 3300006195 | Ga0075366_10075167 | Ga0075366_100751671 | 114 |
| 166 | 3300006195 | Ga0075366_10647429 | Ga0075366_106474292 | 114 |
| 167 | 3300006353 | Ga0075370_10065687 | Ga0075370_100656871 | 114 |
| 168 | 3300006353 | Ga0075370_10120446 | Ga0075370_101204463 | 114 |
| 169 | 3300006353 | Ga0075370_10923536 | Ga0075370_109235362 | 114 |
| 170 | 3300006358 | Ga0068871_100009991 | Ga0068871_1000099912 | 114 |
| 171 | 3300006881 | Ga0068865_100396043 | Ga0068865_1003960432 | 114 |
| 172 | 3300006881 | Ga0068865_101052932 | Ga0068865_1010529322 | 114 |
| 173 | 3300006931 | Ga0097620_100025848 | Ga0097620_1000258484 | 114 |
| 174 | 3300006931 | Ga0097620_100894855 | Ga0097620_1008948552 | 114 |
| 175 | 3300007076 | Ga0075435_100178399 | Ga0075435_1001783991 | 114 |
| 176 | 3300007788 | Ga0099795_10075450 | Ga0099795_100754504 | 114 |
| 177 | 3300009092 | Ga0105250_10047525 | Ga0105250_100475253 | 114 |
| 178 | 3300009092 | Ga0105250_10087582 | Ga0105250_100875822 | 114 |
| 179 | 3300009093 | Ga0105240_10509304 | Ga0105240_105093042 | 114 |
| 180 | 3300009098 | Ga0105245_10013930 | Ga0105245_100139307 | 114 |
| 181 | 3300009098 | Ga0105245_11608428 | Ga0105245_116084282 | 114 |
| 182 | 3300009101 | Ga0105247_10595204 | Ga0105247_105952042 | 114 |
| 183 | 3300009147 | Ga0114129_11581972 | Ga0114129_115819721 | 114 |
| 184 | 3300009148 | Ga0105243_10218860 | Ga0105243_102188603 | 114 |
| 185 | 3300009148 | Ga0105243_10377923 | Ga0105243_103779233 | 114 |
| 186 | 3300009148 | Ga0105243_11230069 | Ga0105243_112300692 | 114 |
| 187 | 3300009176 | Ga0105242_10429798 | Ga0105242_104297981 | 114 |
| 188 | 3300009176 | Ga0105242_12375259 | Ga0105242_123752591 | 114 |
| 189 | 3300009177 | Ga0105248_10014109 | Ga0105248_100141092 | 114 |
| 190 | 3300009545 | Ga0105237_10082630 | Ga0105237_100826303 | 114 |
| 191 | 3300009553 | Ga0105249_10502640 | Ga0105249_105026402 | 114 |
| 192 | 3300010375 | Ga0105239_10007120 | Ga0105239_100071203 | 114 |
| 193 | 3300011119 | Ga0105246_10038604 | Ga0105246_100386043 | 114 |
| 194 | 3300013296 | Ga0157374_11276934 | Ga0157374_112769341 | 114 |
| 195 | 3300013297 | Ga0157378_10429495 | Ga0157378_104294952 | 114 |
| 196 | 3300013306 | Ga0163162_10264274 | Ga0163162_102642742 | 114 |
| 197 | 3300013306 | Ga0163162_11136933 | Ga0163162_111369331 | 114 |
| 198 | 3300013308 | Ga0157375_10644433 | Ga0157375_106444333 | 114 |
| 199 | 3300014326 | Ga0157380_10174402 | Ga0157380_101744022 | 114 |
| 200 | 3300014745 | Ga0157377_10377718 | Ga0157377_103777182 | 114 |
| 201 | 3300014745 | Ga0157377_10451158 | Ga0157377_104511582 | 114 |
| 202 | 3300014968 | Ga0157379_10281784 | Ga0157379_102817842 | 114 |
| 203 | 3300014969 | Ga0157376_10074460 | Ga0157376_100744603 | 114 |
| 204 | 3300014969 | Ga0157376_10168076 | Ga0157376_101680763 | 114 |
| 205 | 3300014969 | Ga0157376_11405161 | Ga0157376_114051611 | 114 |
| 206 | 3300017792 | Ga0163161_10532669 | Ga0163161_105326693 | 114 |
| 207 | 3300025900 | Ga0207710_10029511 | Ga0207710_100295112 | 114 |
| 208 | 3300025901 | Ga0207688_10008199 | Ga0207688_100081995 | 114 |
| 209 | 3300025904 | Ga0207647_10085687 | Ga0207647_100856873 | 114 |
| 210 | 3300025908 | Ga0207643_10062650 | Ga0207643_100626502 | 114 |
| 211 | 3300025911 | Ga0207654_10035557 | Ga0207654_100355573 | 114 |
| 212 | 3300025914 | Ga0207671_10042950 | Ga0207671_100429501 | 114 |
| 213 | 3300025919 | Ga0207657_10326021 | Ga0207657_103260212 | 114 |
| 214 | 3300025922 | Ga0207646_10449982 | Ga0207646_104499822 | 114 |
| 215 | 3300025923 | Ga0207681_10690828 | Ga0207681_106908282 | 114 |
| 216 | 3300025924 | Ga0207694_10282626 | Ga0207694_102826262 | 114 |
| 217 | 3300025927 | Ga0207687_10044331 | Ga0207687_100443313 | 114 |
| 218 | 3300025931 | Ga0207644_10109726 | Ga0207644_101097262 | 114 |
| 219 | 3300025932 | Ga0207690_11250492 | Ga0207690_112504921 | 114 |
| 220 | 3300025933 | Ga0207706_10032724 | Ga0207706_100327244 | 114 |
| 221 | 3300025934 | Ga0207686_10399833 | Ga0207686_103998332 | 114 |
| 222 | 3300025935 | Ga0207709_10325745 | Ga0207709_103257451 | 114 |
| 223 | 3300025938 | Ga0207704_10236216 | Ga0207704_102362162 | 114 |
| 224 | 3300025940 | Ga0207691_11048895 | Ga0207691_110488951 | 114 |
| 225 | 3300025941 | Ga0207711_10068171 | Ga0207711_100681713 | 114 |
| 226 | 3300025942 | Ga0207689_10311076 | Ga0207689_103110763 | 114 |
| 227 | 3300025942 | Ga0207689_10566808 | Ga0207689_105668082 | 114 |
| 228 | 3300025942 | Ga0207689_10584328 | Ga0207689_105843281 | 114 |
| 229 | 3300025942 | Ga0207689_11339098 | Ga0207689_113390981 | 114 |
| 230 | 3300025960 | Ga0207651_11130322 | Ga0207651_111303221 | 114 |
| 231 | 3300025981 | Ga0207640_10653517 | Ga0207640_106535171 | 114 |
| 232 | 3300025986 | Ga0207658_11127322 | Ga0207658_111273222 | 114 |
| 233 | 3300026023 | Ga0207677_10783810 | Ga0207677_107838102 | 114 |
| 234 | 3300026035 | Ga0207703_10793574 | Ga0207703_107935741 | 114 |
| 235 | 3300026041 | Ga0207639_10049503 | Ga0207639_100495031 | 114 |
| 236 | 3300026041 | Ga0207639_10253959 | Ga0207639_102539592 | 114 |
| 237 | 3300026067 | Ga0207678_10029500 | Ga0207678_100295003 | 114 |
| 238 | 3300026067 | Ga0207678_10594798 | Ga0207678_105947982 | 114 |
| 239 | 3300026075 | Ga0207708_10071680 | Ga0207708_100716803 | 114 |
| 240 | 3300026075 | Ga0207708_10709655 | Ga0207708_107096552 | 114 |
| 241 | 3300026078 | Ga0207702_10041361 | Ga0207702_100413612 | 114 |
| 242 | 3300026088 | Ga0207641_10025123 | Ga0207641_100251234 | 114 |
| 243 | 3300026088 | Ga0207641_10461540 | Ga0207641_104615402 | 114 |
| 244 | 3300026118 | Ga0207675_100046630 | Ga0207675_1000466303 | 114 |
| 245 | 3300026118 | Ga0207675_100187601 | Ga0207675_1001876012 | 114 |
| 246 | 3300026121 | Ga0207683_10065818 | Ga0207683_100658182 | 114 |
| 247 | 3300026121 | Ga0207683_10141240 | Ga0207683_101412403 | 114 |
| 248 | 3300026142 | Ga0207698_10083440 | Ga0207698_100834403 | 114 |
| 249 | 3300028379 | Ga0268266_10031885 | Ga0268266_100318853 | 114 |
| 250 | 3300028379 | Ga0268266_10048964 | Ga0268266_100489643 | 114 |
| 251 | 3300028379 | Ga0268266_10416490 | Ga0268266_104164902 | 114 |
| 252 | 3300028379 | Ga0268266_11673824 | Ga0268266_116738242 | 114 |
| 253 | 3300028380 | Ga0268265_10604419 | Ga0268265_106044192 | 114 |
| 254 | 3300028380 | Ga0268265_10618896 | Ga0268265_106188962 | 114 |
| 255 | 3300028380 | Ga0268265_11564769 | Ga0268265_115647692 | 114 |
| 256 | 3300028381 | Ga0268264_10083749 | Ga0268264_100837493 | 114 |
| 257 | 3300028381 | Ga0268264_10226084 | Ga0268264_102260842 | 114 |
| 258 | 3300028381 | Ga0268264_10304597 | Ga0268264_103045971 | 114 |
| 259 | 3300028786 | Ga0307517_10102407 | Ga0307517_101024073 | 114 |
| 260 | 3300028786 | Ga0307517_10230641 | Ga0307517_102306412 | 114 |
| 261 | 3300031456 | Ga0307513_10275993 | Ga0307513_102759933 | 114 |
| 262 | 3300031507 | Ga0307509_10212034 | Ga0307509_102120341 | 114 |
| 263 | 3300031548 | Ga0307408_100381648 | Ga0307408_1003816482 | 114 |
| 264 | 3300031824 | Ga0307413_10022807 | Ga0307413_100228073 | 114 |
| 265 | 3300031903 | Ga0307407_10378287 | Ga0307407_103782872 | 114 |
| 266 | 3300032002 | Ga0307416_100306833 | Ga0307416_1003068331 | 114 |
| 267 | 3300032002 | Ga0307416_100350746 | Ga0307416_1003507462 | 114 |
| 268 | 3300032004 | Ga0307414_10135138 | Ga0307414_101351383 | 114 |
| 269 | 3300033180 | Ga0307510_10046908 | Ga0307510_100469083 | 114 |
| 270 | 3300035170 | Ga0373943_0227898 | Ga0373943_0227898_341_685 | 114 |
| 271 | 3300035691 | Ga0373931_0607095 | Ga0373931_0607095_204_548 | 114 |
| 272 | 3300035695 | Ga0373927_0447121 | Ga0373927_0447121_71_415 | 114 |
| 273 | 3300035725 | Ga0373947_0353892 | Ga0373947_0353892_356_700 | 114 |
| 274 | 3300037068 | Ga0373925_0512853 | Ga0373925_0512853_187_531 | 114 |
| 275 | 3300046452 | Ga0495617_047422 | Ga0495617_047422_84_428 | 114 |
| 276 | 3300046452 | Ga0495617_142384 | Ga0495617_142384_148_492 | 114 |
| 277 | 3300046452 | Ga0495617_265605 | Ga0495617_265605_136_480 | 114 |
| 278 | 3300046455 | Ga0495603_0037517 | Ga0495603_0037517_2160_2504 | 114 |
| 279 | 3300046455 | Ga0495603_0059489 | Ga0495603_0059489_1832_2176 | 114 |
| 280 | 3300046455 | Ga0495603_0151614 | Ga0495603_0151614_502_846 | 114 |
| 281 | 3300046460 | Ga0495638_0021293 | Ga0495638_0021293_1162_1506 | 114 |
| 282 | 3300046460 | Ga0495638_0021639 | Ga0495638_0021639_455_799 | 114 |
| 283 | 3300046461 | Ga0495641_0023391 | Ga0495641_0023391_29_373 | 114 |
| 284 | 3300046471 | Ga0495650_0048895 | Ga0495650_0048895_94_438 | 114 |
| 285 | 3300046472 | Ga0495580_0497181 | Ga0495580_0497181_87_431 | 114 |
| 286 | 3300046474 | Ga0495605_0070850 | Ga0495605_0070850_1285_1629 | 114 |
| 287 | 3300046475 | Ga0495639_0145691 | Ga0495639_0145691_655_999 | 114 |
| 288 | 3300046491 | Ga0495584_0213292 | Ga0495584_0213292_589_933 | 114 |
| 289 | 3300046491 | Ga0495584_0348197 | Ga0495584_0348197_56_400 | 114 |
| 290 | 3300046492 | Ga0495585_0137421 | Ga0495585_0137421_359_703 | 114 |
| 291 | 3300046492 | Ga0495585_0178206 | Ga0495585_0178206_590_934 | 114 |
| 292 | 3300046492 | Ga0495585_0407335 | Ga0495585_0407335_66_410 | 114 |
| 293 | 3300046499 | Ga0495594_0017922 | Ga0495594_0017922_1363_1707 | 114 |
| 294 | 3300046499 | Ga0495594_0122301 | Ga0495594_0122301_197_541 | 114 |
| 295 | 3300046507 | Ga0495606_0116321 | Ga0495606_0116321_647_991 | 114 |
| 296 | 3300046512 | Ga0495610_0134961 | Ga0495610_0134961_454_798 | 114 |
| 297 | 3300046513 | Ga0495616_0117224 | Ga0495616_0117224_86_430 | 114 |
| 298 | 3300046513 | Ga0495616_0172594 | Ga0495616_0172594_325_669 | 114 |
| 299 | 3300046515 | Ga0495620_0030393 | Ga0495620_0030393_1065_1409 | 114 |
| 300 | 3300046518 | Ga0495631_0502929 | Ga0495631_0502929_101_445 | 114 |
| 301 | 3300046519 | Ga0495632_0107022 | Ga0495632_0107022_321_665 | 114 |
| 302 | 3300046519 | Ga0495632_0196012 | Ga0495632_0196012_545_889 | 114 |
| 303 | 3300046522 | Ga0495643_0123647 | Ga0495643_0123647_53_397 | 114 |
| 304 | 3300046522 | Ga0495643_0143727 | Ga0495643_0143727_423_767 | 114 |
| 305 | 3300046523 | Ga0495644_0044543 | Ga0495644_0044543_171_533 | 114 |
| 306 | 3300046524 | Ga0495648_0222521 | Ga0495648_0222521_333_677 | 114 |
| 307 | 3300046525 | Ga0495663_0059712 | Ga0495663_0059712_140_484 | 114 |
| 308 | 3300046528 | Ga0495642_0040449 | Ga0495642_0040449_1329_1673 | 114 |
| 309 | 3300046537 | Ga0495598_0041694 | Ga0495598_0041694_986_1330 | 114 |
| 310 | 3300046537 | Ga0495598_0186007 | Ga0495598_0186007_141_485 | 114 |
| 311 | 3300046538 | Ga0495609_0026467 | Ga0495609_0026467_1500_1844 | 114 |
| 312 | 3300046538 | Ga0495609_0069706 | Ga0495609_0069706_609_953 | 114 |
| 313 | 3300046538 | Ga0495609_0088639 | Ga0495609_0088639_629_973 | 114 |
| 314 | 3300046542 | Ga0495597_0091746 | Ga0495597_0091746_101_445 | 114 |
| 315 | 3300046557 | Ga0495622_0004295 | Ga0495622_0004295_6081_6425 | 114 |
| 316 | 3300046558 | Ga0495633_0047806 | Ga0495633_0047806_1582_1926 | 114 |
| 317 | 3300046615 | Ga0495656_0016409 | Ga0495656_0016409_1296_1640 | 114 |
| 318 | 3300046615 | Ga0495656_0427792 | Ga0495656_0427792_159_503 | 114 |
| 319 | 3300046616 | Ga0495668_0112137 | Ga0495668_0112137_841_1185 | 114 |
| 320 | 3300046616 | Ga0495668_0347136 | Ga0495668_0347136_402_746 | 114 |
| 321 | 3300046616 | Ga0495668_0458058 | Ga0495668_0458058_135_479 | 114 |
| 322 | 3300046616 | Ga0495668_0698179 | Ga0495668_0698179_161_505 | 114 |
| 323 | 3300046648 | Ga0495611_0094230 | Ga0495611_0094230_213_557 | 114 |
| 324 | 3300046660 | Ga0495625_0391147 | Ga0495625_0391147_335_679 | 114 |
| 325 | 3300046663 | Ga0495635_0153797 | Ga0495635_0153797_60_404 | 114 |
| 326 | 3300046664 | Ga0495659_0009566 | Ga0495659_0009566_1545_1889 | 114 |
| 327 | 3300046665 | Ga0495661_0466756 | Ga0495661_0466756_182_526 | 114 |
| 328 | 3300046674 | Ga0495588_0063118 | Ga0495588_0063118_539_883 | 114 |
| 329 | 3300046674 | Ga0495588_0311525 | Ga0495588_0311525_380_724 | 114 |
| 330 | 3300046684 | Ga0495669_0344375 | Ga0495669_0344375_108_452 | 114 |
| 331 | 3300046689 | Ga0495613_0875054 | Ga0495613_0875054_36_380 | 114 |
| 332 | 3300046692 | Ga0495671_0366050 | Ga0495671_0366050_128_541 | 114 |
| 333 | 3300046692 | Ga0495671_0444042 | Ga0495671_0444042_143_487 | 114 |
| 334 | 3300046794 | Ga0495589_0200455 | Ga0495589_0200455_97_441 | 114 |
| 335 | 3300047315 | Ga0495581_0556142 | Ga0495581_0556142_203_547 | 114 |
| 336 | 3300047318 | Ga0495636_0089107 | Ga0495636_0089107_712_1056 | 114 |
| 337 | 3300047318 | Ga0495636_0319739 | Ga0495636_0319739_356_700 | 114 |
| 338 | 3300047321 | Ga0495676_0043346 | Ga0495676_0043346_1998_2342 | 114 |
| 339 | 3300047323 | Ga0495683_0269133 | Ga0495683_0269133_258_602 | 114 |
| 340 | 3300047443 | Ga0495687_109733 | Ga0495687_109733_52_396 | 114 |
| 341 | 3300047445 | Ga0495677_0052724 | Ga0495677_0052724_1025_1369 | 114 |
| 342 | 3300047447 | Ga0495685_024974 | Ga0495685_024974_557_919 | 114 |
| 343 | 3300047472 | Ga0495686_0086026 | Ga0495686_0086026_132_476 | 114 |
| 344 | 3300048088 | Ga0495602_0586748 | Ga0495602_0586748_45_389 | 114 |
| 345 | 3300048091 | Ga0495626_0126088 | Ga0495626_0126088_127_483 | 114 |
| 346 | 3300048905 | Ga0496102_0588397 | Ga0496102_0588397_562_906 | 114 |
| 347 | 3300048906 | Ga0496103_0738644 | Ga0496103_0738644_219_563 | 114 |
| 348 | 3300048907 | Ga0496104_0550071 | Ga0496104_0550071_614_976 | 114 |
| 349 | 3300048908 | Ga0496105_0769889 | Ga0496105_0769889_348_710 | 114 |
| 350 | 3300048911 | Ga0496108_0311422 | Ga0496108_0311422_923_1267 | 114 |
| 351 | 3300048912 | Ga0496109_0076921 | Ga0496109_0076921_2201_2545 | 114 |
| 352 | 3300048913 | Ga0496110_1241892 | Ga0496110_1241892_292_636 | 114 |
| 353 | 3300048913 | Ga0496110_1844095 | Ga0496110_1844095_48_392 | 114 |
| 354 | 3300048915 | Ga0496112_0082032 | Ga0496112_0082032_2030_2374 | 114 |
| 355 | 3300048916 | Ga0496113_0242611 | Ga0496113_0242611_555_899 | 114 |
| 356 | 3300048921 | Ga0496118_0241173 | Ga0496118_0241173_658_1002 | 114 |
| 357 | 3300048921 | Ga0496118_0304890 | Ga0496118_0304890_11_355 | 114 |
| 358 | 3300048924 | Ga0496121_0035432 | Ga0496121_0035432_3279_3623 | 114 |
| 359 | 3300048924 | Ga0496121_0065418 | Ga0496121_0065418_1812_2156 | 114 |
| 360 | 3300048924 | Ga0496121_0065618 | Ga0496121_0065618_1718_2062 | 114 |
| 361 | 3300048924 | Ga0496121_0824763 | Ga0496121_0824763_93_437 | 114 |
| 362 | 3300048927 | Ga0496124_0112828 | Ga0496124_0112828_859_1206 | 114 |
| 363 | 3300048927 | Ga0496124_0417359 | Ga0496124_0417359_252_596 | 114 |
| 364 | 3300048928 | Ga0496125_0210501 | Ga0496125_0210501_191_535 | 114 |
| 365 | 3300048929 | Ga0496126_0033287 | Ga0496126_0033287_3347_3691 | 114 |
| 366 | 3300048929 | Ga0496126_0074385 | Ga0496126_0074385_1899_2246 | 114 |
| 367 | 3300048929 | Ga0496126_0083747 | Ga0496126_0083747_889_1233 | 114 |
| 368 | 3300048929 | Ga0496126_0286125 | Ga0496126_0286125_591_935 | 114 |
| 369 | 3300048929 | Ga0496126_0924063 | Ga0496126_0924063_242_586 | 114 |
| 370 | 3300049460 | Ga0495682_0129050 | Ga0495682_0129050_159_503 | 114 |
| 371 | 3300049665 | Ga0501227_178394 | Ga0501227_178394_194_538 | 114 |
| 372 | 3300050489 | nmdc:mga03683_55762_c1 | nmdc:mga03683_55762_c1_913_1257 | 114 |
| 373 | 3300050492 | nmdc:mga0yw44_1083708_c1 | nmdc:mga0yw44_1083708_c1_33_377 | 114 |
| 374 | 3300050492 | nmdc:mga0yw44_184567_c1 | nmdc:mga0yw44_184567_c1_159_503 | 114 |
| 375 | 3300050493 | nmdc:mga0k408_71158_c1 | nmdc:mga0k408_71158_c1_218_562 | 114 |
| 376 | 3300050494 | nmdc:mga06z11_148685_c1 | nmdc:mga06z11_148685_c1_445_789 | 114 |
| 377 | 3300050494 | nmdc:mga06z11_32420_c1 | nmdc:mga06z11_32420_c1_304_666 | 114 |
| 378 | 3300050495 | nmdc:mga04h51_24187_c1 | nmdc:mga04h51_24187_c1_252_596 | 114 |
| 379 | 3300050495 | nmdc:mga04h51_78842_c1 | nmdc:mga04h51_78842_c1_203_595 | 114 |
| 380 | 3300050496 | nmdc:mga07m45_188880_c1 | nmdc:mga07m45_188880_c1_459_803 | 114 |
| 381 | 3300050496 | nmdc:mga07m45_330772_c1 | nmdc:mga07m45_330772_c1_270_629 | 114 |
| 382 | 3300050508 | nmdc:mga09592_432444_c1 | nmdc:mga09592_432444_c1_136_480 | 114 |
| 383 | 3300050512 | nmdc:mga0n895_247738_c1 | nmdc:mga0n895_247738_c1_829_1173 | 114 |
| 384 | 3300050513 | nmdc:mga0rr50_167805_c1 | nmdc:mga0rr50_167805_c1_452_796 | 114 |
| 385 | 3300053079 | Ga0500610_0245775 | Ga0500610_0245775_324_668 | 114 |
| 386 | 3300053086 | Ga0500578_0151382 | Ga0500578_0151382_385_729 | 114 |
| 387 | 3300053092 | Ga0500583_0008100 | Ga0500583_0008100_441_803 | 114 |
| 388 | 3300053092 | Ga0500583_0152677 | Ga0500583_0152677_131_475 | 114 |
| 389 | 3300053092 | Ga0500583_0169947 | Ga0500583_0169947_307_651 | 114 |
| 390 | 3300053093 | Ga0500651_0768510 | Ga0500651_0768510_132_476 | 114 |
| 391 | 3300053094 | Ga0500566_0307867 | Ga0500566_0307867_244_588 | 114 |
| 392 | 3300053108 | Ga0500562_032245 | Ga0500562_032245_842_1186 | 114 |
| 393 | 3300053109 | Ga0500569_107328 | Ga0500569_107328_493_837 | 114 |
| 394 | 3300053114 | Ga0500582_188091 | Ga0500582_188091_244_588 | 114 |
| 395 | 3300053116 | Ga0500592_044315 | Ga0500592_044315_251_613 | 114 |
| 396 | 3300053118 | Ga0500594_0022120 | Ga0500594_0022120_869_1213 | 114 |
| 397 | 3300053119 | Ga0500595_003594 | Ga0500595_003594_3913_4257 | 114 |
| 398 | 3300053130 | Ga0500642_0066926 | Ga0500642_0066926_506_850 | 114 |
| 399 | 3300053133 | Ga0500655_009033 | Ga0500655_009033_417_761 | 114 |
| 400 | 3300053134 | Ga0500658_0067309 | Ga0500658_0067309_231_575 | 114 |
| 401 | 3300053134 | Ga0500658_0100027 | Ga0500658_0100027_681_1025 | 114 |
| 402 | 3300053134 | Ga0500658_0117681 | Ga0500658_0117681_201_545 | 114 |
| 403 | 3300053139 | Ga0500568_0102167 | Ga0500568_0102167_84_428 | 114 |
| 404 | 3300053142 | Ga0500577_0086177 | Ga0500577_0086177_291_635 | 114 |
| 405 | 3300053143 | Ga0500579_270563 | Ga0500579_270563_58_402 | 114 |
| 406 | 3300053146 | Ga0500588_0098724 | Ga0500588_0098724_416_760 | 114 |
| 407 | 3300053147 | Ga0500589_128676 | Ga0500589_128676_563_907 | 114 |
| 408 | 3300053148 | Ga0500590_115655 | Ga0500590_115655_480_824 | 114 |
| 409 | 3300053160 | Ga0500633_0027161 | Ga0500633_0027161_1096_1440 | 114 |
| 410 | 3300053161 | Ga0500634_0173657 | Ga0500634_0173657_233_577 | 114 |
| 411 | 3300053178 | Ga0500637_0114942 | Ga0500637_0114942_917_1261 | 114 |
| 412 | 3300053730 | Ga0500645_082810 | Ga0500645_082810_404_748 | 114 |
| 413 | 3300053731 | Ga0500609_007069 | Ga0500609_007069_361_705 | 114 |
| 414 | 3300003320 | rootH2_10034185 | rootH2_100341853 | 116 |
| 415 | 3300003322 | rootL2_10053669 | rootL2_100536693 | 116 |
| 416 | 3300005937 | Ga0081455_10103304 | Ga0081455_101033044 | 116 |
| 417 | 3300005937 | Ga0081455_10484567 | Ga0081455_104845672 | 116 |
| 418 | 3300005985 | Ga0081539_10175943 | Ga0081539_101759433 | 116 |
| 419 | 3300006177 | Ga0075362_10018906 | Ga0075362_100189064 | 116 |
| 420 | 3300025297 | Ga0209758_1002180 | Ga0209758_100218010 | 116 |
| 421 | 3300028786 | Ga0307517_10618287 | Ga0307517_106182871 | 116 |
| 422 | 3300046523 | Ga0495644_0182558 | Ga0495644_0182558_140_490 | 116 |
| 423 | 3300046558 | Ga0495633_0037322 | Ga0495633_0037322_144_494 | 116 |
| 424 | 3300049585 | Ga0501069_0214162 | Ga0501069_0214162_213_563 | 116 |
| 425 | 3300050489 | nmdc:mga03683_30647_c1 | nmdc:mga03683_30647_c1_1670_2020 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x8c-assembly1.cif.gz_C | crystal structure of a ktsc family protein from euryarchaeon methanolobus vulcani | 0.9065 | 36 | 96 |
| 4rgi-assembly1.cif.gz_A | crystal structure of ktsc domain protein ypo2434 from yersinia pestis | 0.8967 | 35 | 108 |
| 4rgi-assembly1.cif.gz_A | crystal structure of ktsc domain protein ypo2434 from yersinia pestis | 0.8391 | 35 | 108 |
| 4wl2-assembly3.cif.gz_G | structure of penicillin v acylase from pectobacterium atrosepticum | 0.7957 | 48 | 70 |
| 7x8c-assembly1.cif.gz_C | crystal structure of a ktsc family protein from euryarchaeon methanolobus vulcani | 0.7861 | 36 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KFA3_153_352_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.8201 | 48 | 72 | 2.60.120.200 |
| af_A0A0R0IJU0_61_261_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8002 | 45 | 69 | 2.130.10.10 |
| af_Q2FUW1_257_494_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7796 | 48 | 72 | 2.60.120.200 |
| af_Q4E087_7_130_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7723 | 46 | 73 | 2.130.10.10 |
| af_I1KSA4_38_162_2.30.240.10 | Mainly Beta;Roll;at5g01610, DUF538 DOMAIN;At5g01610-like | 0.7702 | 46 | 68 | 2.30.240.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4AIM1-F1-model_v4 | deleted | 0.9995 | 19 | 75 |
|
| AF-A0A1H5HGF5-F1-model_v4 | KTSC domain-containing protein | 0.9891 | 19 | 63 |
|
| AF-A0A845M066-F1-model_v4 | KTSC domain-containing protein | 0.9589 | 35 | 96 |
|
| AF-A0A1Y6B0V5-F1-model_v4 | deleted | 0.9581 | 36 | 96 |
|
| AF-A0A0F9PBN5-F1-model_v4 | KTSC domain-containing protein | 0.9516 | 36 | 96 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar