F441077

General Info

Members Datasets Scaffolds Average Seq Length
425 271 420 115

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0104242|Ga0500641_0104242_477_818
Length 113
Sequence MTRLAFILALLFAAPWEQAEIVDVKDRGAVDLKPFNCQDVTRSVISRVCYDAASRRMLVQRHATYHQYCDLPKHTLDAFLNAPSMGQYFNANIKAVGGNGPYDCRTPKVRSYQ

Samples

Sample ID Description Type Environment
1 2791355199
2 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
3 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
4 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
5 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
254 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
255 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
258 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
263 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
264 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
265 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
268 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
269 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.59
Nodule 0.47
Rhizoplane 4.71
Rhizosphere 69.18
Stem 0
Stem Tuber 0
Unclassified 7.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10034185 3300003320 Bacteria 1507
2 rootL2_10053669 3300003322 Bacteria 2540
3 Ga0068869_100405940 3300005334 Bacteria 1121
4 Ga0068869_100449045 3300005334 Bacteria 1068
5 Ga0070682_100334189 3300005337 Bacteria 1124
6 Ga0068868_100053907 3300005338 Bacteria 3168
7 Ga0068868_100521116 3300005338 Bacteria 1043
8 Ga0068868_102424335 3300005338 Unclassified 501
9 Ga0070660_100066999 3300005339 Bacteria 2797
10 Ga0070689_100040088 3300005340 Bacteria 3589
11 Ga0070661_100240547 3300005344 Bacteria 1394
12 Ga0070692_10320766 3300005345 Bacteria 952
13 Ga0070668_100011355 3300005347 Bacteria 6635
14 Ga0070668_100114051 3300005347 Bacteria 2153
15 Ga0070668_100145595 3300005347 Bacteria 1912
16 Ga0070668_100494638 3300005347 Bacteria 1058
17 Ga0070668_100698574 3300005347 Bacteria 894
18 Ga0070668_100949900 3300005347 Bacteria 770
19 Ga0070668_101824096 3300005347 Bacteria 559
20 Ga0070669_101203064 3300005353 Bacteria 655
21 Ga0070671_101927512 3300005355 Bacteria 526
22 Ga0070673_100370555 3300005364 Bacteria 1275
23 Ga0070688_100063221 3300005365 Bacteria 2345
24 Ga0070659_100589087 3300005366 Bacteria 955
25 Ga0070667_101075359 3300005367 Bacteria 752
26 Ga0070700_100220161 3300005441 Bacteria 1344
27 Ga0070694_100636910 3300005444 Bacteria 862
28 Ga0070663_100007837 3300005455 Bacteria 6530
29 Ga0070663_100330480 3300005455 Bacteria 1229
30 Ga0070678_100033929 3300005456 Bacteria 3548
31 Ga0070678_100137260 3300005456 Bacteria 1952
32 Ga0070678_101567924 3300005456 Bacteria 618
33 Ga0070662_100221316 3300005457 Bacteria 1510
34 Ga0070662_100614975 3300005457 Bacteria 915
35 Ga0070685_10155102 3300005466 Bacteria 1454
36 Ga0070698_100539320 3300005471 Bacteria 1106
37 Ga0070699_100305866 3300005518 Bacteria 1427
38 Ga0068853_100153536 3300005539 Bacteria 2073
39 Ga0068853_101706412 3300005539 Bacteria 610
40 Ga0070672_101129517 3300005543 Bacteria 697
41 Ga0070672_101289861 3300005543 Bacteria 652
42 Ga0070686_100201027 3300005544 Bacteria 1428
43 Ga0070695_100073320 3300005545 Bacteria 2246
44 Ga0070696_100860902 3300005546 Bacteria 750
45 Ga0070693_100563035 3300005547 Bacteria 817
46 Ga0070665_100064844 3300005548 Bacteria 3664
47 Ga0070665_100566556 3300005548 Bacteria 1148
48 Ga0070665_100654791 3300005548 Bacteria 1063
49 Ga0070704_101034911 3300005549 Bacteria 744
50 Ga0068856_100102134 3300005614 Bacteria 2860
51 Ga0070702_101194747 3300005615 Bacteria 613
52 Ga0068852_100103780 3300005616 Bacteria 2572
53 Ga0068852_100582373 3300005616 Bacteria 1122
54 Ga0068859_100025848 3300005617 Bacteria 5890
55 Ga0068859_100894880 3300005617 Bacteria 972
56 Ga0068864_100108510 3300005618 Bacteria 2470
57 Ga0068861_100512489 3300005719 Bacteria 1086
58 Ga0068851_10329513 3300005834 Bacteria 884
59 Ga0068870_10019559 3300005840 Bacteria 3286
60 Ga0068863_100242724 3300005841 Bacteria 1739
61 Ga0068863_100291547 3300005841 Bacteria 1582
62 Ga0068863_101647728 3300005841 Bacteria 651
63 Ga0068860_100036330 3300005843 Bacteria 4721
64 Ga0068860_100162554 3300005843 Bacteria 2153
65 Ga0068860_100481785 3300005843 Bacteria 1236
66 Ga0068862_100349548 3300005844 Bacteria 1371
67 Ga0068862_100361911 3300005844 Bacteria 1348
68 Ga0068862_100385874 3300005844 Bacteria 1307
69 Ga0081455_10103304 3300005937 Bacteria 2283
70 Ga0081455_10484567 3300005937 Bacteria 835
71 Ga0081540_1008133 3300005983 Bacteria 7358
72 Ga0081539_10146220 3300005985 Bacteria 1142
73 Ga0081539_10175943 3300005985 Bacteria 1008
74 Ga0075365_10053132 3300006038 Bacteria 2682
75 Ga0075365_10105552 3300006038 Bacteria 1932
76 Ga0075365_10139466 3300006038 Bacteria 1683
77 Ga0075368_10048237 3300006042 Bacteria 1688
78 Ga0075368_10083775 3300006042 Bacteria 1299
79 Ga0075363_100080617 3300006048 Bacteria 1780
80 Ga0075363_100124999 3300006048 Bacteria 1439
81 Ga0075363_100169354 3300006048 Bacteria 1239
82 Ga0075364_10161465 3300006051 Bacteria 1512
83 Ga0075432_10446605 3300006058 Bacteria 567
84 Ga0070715_10939378 3300006163 Bacteria 535
85 Ga0075362_10018906 3300006177 Bacteria 2859
86 Ga0075362_10044367 3300006177 Bacteria 1971
87 Ga0075362_10060323 3300006177 Bacteria 1714
88 Ga0075362_10126454 3300006177 Bacteria 1213
89 Ga0075362_10551160 3300006177 Bacteria 593
90 Ga0075367_10090246 3300006178 Bacteria 1864
91 Ga0075367_10106794 3300006178 Bacteria 1716
92 Ga0075367_10784125 3300006178 Bacteria 607
93 Ga0075369_10012585 3300006186 Bacteria 3342
94 Ga0075366_10019651 3300006195 Bacteria 3913
95 Ga0075366_10075167 3300006195 Bacteria 2015
96 Ga0075366_10189791 3300006195 Bacteria 1249
97 Ga0075366_10647429 3300006195 Bacteria 656
98 Ga0075370_10053960 3300006353 Bacteria 2281
99 Ga0075370_10065687 3300006353 Bacteria 2069
100 Ga0075370_10120446 3300006353 Bacteria 1527
101 Ga0075370_10213512 3300006353 Bacteria 1139
102 Ga0075370_10923536 3300006353 Bacteria 534
103 Ga0068871_100009991 3300006358 Bacteria 6897
104 Ga0068871_100654958 3300006358 Bacteria 959
105 Ga0075428_100104254 3300006844 Bacteria 3092
106 Ga0068865_100396043 3300006881 Bacteria 1130
107 Ga0068865_100771065 3300006881 Bacteria 827
108 Ga0068865_101052932 3300006881 Bacteria 714
109 Ga0097620_100025848 3300006931 Bacteria 5890
110 Ga0097620_100894855 3300006931 Bacteria 972
111 Ga0075435_100178399 3300007076 Bacteria 1795
112 Ga0099795_10075450 3300007788 Bacteria 1280
113 Ga0105250_10047525 3300009092 Bacteria 1721
114 Ga0105250_10087582 3300009092 Bacteria 1265
115 Ga0105240_10509304 3300009093 Bacteria 1337
116 Ga0105245_10013930 3300009098 Bacteria 7004
117 Ga0105245_11608428 3300009098 Bacteria 701
118 Ga0105247_10058680 3300009101 Bacteria 2381
119 Ga0105247_10595204 3300009101 Bacteria 819
120 Ga0114129_10240232 3300009147 Bacteria 2435
121 Ga0114129_11581972 3300009147 Bacteria 803
122 Ga0105243_10218860 3300009148 Bacteria 1682
123 Ga0105243_10377923 3300009148 Bacteria 1309
124 Ga0105243_11149265 3300009148 Unclassified 787
125 Ga0105243_11230069 3300009148 Bacteria 763
126 Ga0105242_10429798 3300009176 Bacteria 1240
127 Ga0105242_12375259 3300009176 Bacteria 577
128 Ga0105248_10014109 3300009177 Bacteria 8793
129 Ga0105237_10082630 3300009545 Bacteria 3203
130 Ga0105249_10502640 3300009553 Bacteria 1258
131 Ga0105249_10746574 3300009553 Bacteria 1041
132 Ga0105249_11579731 3300009553 Bacteria 728
133 Ga0105239_10007120 3300010375 Bacteria 12868
134 Ga0105239_10487032 3300010375 Bacteria 1401
135 Ga0105246_10038604 3300011119 Bacteria 3212
136 Ga0105246_10348082 3300011119 Bacteria 1213
137 Ga0157374_11276934 3300013296 Bacteria 756
138 Ga0157378_10429495 3300013297 Bacteria 1307
139 Ga0163162_10264274 3300013306 Bacteria 1852
140 Ga0163162_10981655 3300013306 Bacteria 954
141 Ga0163162_11136933 3300013306 Bacteria 885
142 Ga0157375_10644433 3300013308 Bacteria 1216
143 Ga0163163_12355147 3300014325 Bacteria 591
144 Ga0157380_10174402 3300014326 Bacteria 1882
145 Ga0157380_11481879 3300014326 Bacteria 731
146 Ga0157377_10377718 3300014745 Bacteria 958
147 Ga0157377_10451158 3300014745 Bacteria 888
148 Ga0157379_10281784 3300014968 Bacteria 1513
149 Ga0157376_10074460 3300014969 Bacteria 2894
150 Ga0157376_10168076 3300014969 Bacteria 1994
151 Ga0157376_11019344 3300014969 Bacteria 851
152 Ga0157376_11405161 3300014969 Bacteria 730
153 Ga0163161_10532669 3300017792 Bacteria 960
154 Ga0209758_1002180 3300025297 Bacteria 20532
155 Ga0207710_10029511 3300025900 Bacteria 2387
156 Ga0207688_10008199 3300025901 Bacteria 5677
157 Ga0207647_10085687 3300025904 Bacteria 1884
158 Ga0207643_10062650 3300025908 Bacteria 2125
159 Ga0207684_10919561 3300025910 Bacteria 735
160 Ga0207654_10035557 3300025911 Bacteria 2777
161 Ga0207671_10042950 3300025914 Bacteria 3344
162 Ga0207657_10326021 3300025919 Bacteria 1214
163 Ga0207649_10061377 3300025920 Bacteria 2366
164 Ga0207649_10494806 3300025920 Bacteria 929
165 Ga0207646_10449982 3300025922 Bacteria 1162
166 Ga0207681_10690828 3300025923 Bacteria 848
167 Ga0207694_10282626 3300025924 Bacteria 1363
168 Ga0207687_10044331 3300025927 Bacteria 3069
169 Ga0207644_10109726 3300025931 Bacteria 2085
170 Ga0207690_11250492 3300025932 Bacteria 620
171 Ga0207706_10032724 3300025933 Bacteria 4629
172 Ga0207686_10399833 3300025934 Bacteria 1046
173 Ga0207709_10325745 3300025935 Bacteria 1152
174 Ga0207704_10236216 3300025938 Bacteria 1363
175 Ga0207691_11048895 3300025940 Bacteria 679
176 Ga0207711_10068171 3300025941 Bacteria 3081
177 Ga0207689_10311076 3300025942 Bacteria 1306
178 Ga0207689_10566808 3300025942 Bacteria 954
179 Ga0207689_10584328 3300025942 Bacteria 939
180 Ga0207689_11339098 3300025942 Bacteria 601
181 Ga0207651_11130322 3300025960 Bacteria 702
182 Ga0207668_10550399 3300025972 Bacteria 999
183 Ga0207640_10653517 3300025981 Bacteria 896
184 Ga0207658_11127322 3300025986 Bacteria 717
185 Ga0207677_10783810 3300026023 Bacteria 852
186 Ga0207703_10793574 3300026035 Bacteria 904
187 Ga0207639_10049503 3300026041 Bacteria 3187
188 Ga0207639_10253959 3300026041 Bacteria 1534
189 Ga0207639_11188997 3300026041 Bacteria 716
190 Ga0207678_10019008 3300026067 Bacteria 6036
191 Ga0207678_10029500 3300026067 Bacteria 4788
192 Ga0207678_10594798 3300026067 Bacteria 970
193 Ga0207708_10071680 3300026075 Bacteria 2654
194 Ga0207708_10511922 3300026075 Bacteria 1007
195 Ga0207708_10709655 3300026075 Bacteria 860
196 Ga0207702_10041361 3300026078 Bacteria 3865
197 Ga0207641_10025123 3300026088 Bacteria 4911
198 Ga0207641_10461540 3300026088 Bacteria 1229
199 Ga0207675_100046630 3300026118 Bacteria 4049
200 Ga0207675_100187601 3300026118 Bacteria 1982
201 Ga0207675_102349535 3300026118 Bacteria 546
202 Ga0207683_10065818 3300026121 Bacteria 3195
203 Ga0207683_10141240 3300026121 Bacteria 2170
204 Ga0207683_10162274 3300026121 Bacteria 2021
205 Ga0207683_10512419 3300026121 Bacteria 1108
206 Ga0207698_10083440 3300026142 Bacteria 2586
207 Ga0207698_11149116 3300026142 Bacteria 790
208 Ga0268266_10031885 3300028379 Bacteria 4477
209 Ga0268266_10048964 3300028379 Bacteria 3622
210 Ga0268266_10084660 3300028379 Bacteria 2769
211 Ga0268266_10416490 3300028379 Bacteria 1272
212 Ga0268266_10460784 3300028379 Bacteria 1209
213 Ga0268266_11673824 3300028379 Bacteria 611
214 Ga0268265_10604419 3300028380 Bacteria 1048
215 Ga0268265_10618896 3300028380 Bacteria 1037
216 Ga0268265_11564769 3300028380 Bacteria 664
217 Ga0268264_10083749 3300028381 Bacteria 2732
218 Ga0268264_10226084 3300028381 Bacteria 1725
219 Ga0268264_10304597 3300028381 Bacteria 1501
220 Ga0307517_10102407 3300028786 Bacteria 2245
221 Ga0307517_10230641 3300028786 Bacteria 1112
222 Ga0307517_10618287 3300028786 Bacteria 531
223 Ga0307513_10275993 3300031456 Bacteria 1461
224 Ga0307509_10212034 3300031507 Bacteria 1760
225 Ga0307408_100143771 3300031548 Bacteria 1875
226 Ga0307408_100381648 3300031548 Bacteria 1205
227 Ga0307413_10022807 3300031824 Bacteria 3382
228 Ga0307410_10065482 3300031852 Bacteria 2500
229 Ga0307407_10378287 3300031903 Bacteria 1010
230 Ga0307412_10257613 3300031911 Bacteria 1358
231 Ga0307416_100086079 3300032002 Bacteria 2678
232 Ga0307416_100306833 3300032002 Bacteria 1581
233 Ga0307416_100350746 3300032002 Bacteria 1493
234 Ga0307416_100747804 3300032002 Bacteria 1070
235 Ga0307414_10135138 3300032004 Bacteria 1921
236 Ga0307411_10198026 3300032005 Bacteria 1540
237 Ga0307411_12209786 3300032005 Bacteria 516
238 Ga0307415_100167411 3300032126 Bacteria 1710
239 Ga0307510_10046908 3300033180 Bacteria 4638
240 Ga0373943_0227898 3300035170 Bacteria 1040
241 Ga0373931_0607095 3300035691 Bacteria 716
242 Ga0373927_0447121 3300035695 Bacteria 853
243 Ga0373947_0353892 3300035725 Bacteria 986
244 Ga0373925_0512853 3300037068 Bacteria 985
245 Ga0451787_287229 3300041441 Bacteria 867
246 Ga0451791_0080968 3300041451 Bacteria 1238
247 Ga0451791_0401571 3300041451 Bacteria 714
248 Ga0451793_1559712 3300041452 Bacteria 625
249 Ga0451797_1065054 3300041453 Bacteria 940
250 Ga0451802_0783352 3300041460 Bacteria 515
251 Ga0451807_1048395 3300041486 Bacteria 1058
252 Ga0451833_0161027 3300041491 Bacteria 543
253 Ga0451837_0587790 3300041494 Bacteria 678
254 Ga0451845_0085056 3300041501 Bacteria 547
255 Ga0451853_2066006 3300041512 Bacteria 784
256 Ga0439458_0057036 3300042157 Bacteria 971
257 Ga0439459_0033694 3300042438 Bacteria 1056
258 Ga0495617_047422 3300046452 Bacteria 1430
259 Ga0495617_142384 3300046452 Bacteria 765
260 Ga0495617_265605 3300046452 Bacteria 527
261 Ga0495603_0037517 3300046455 Bacteria 2908
262 Ga0495603_0059489 3300046455 Bacteria 2259
263 Ga0495603_0151614 3300046455 Bacteria 1346
264 Ga0495638_0021293 3300046460 Bacteria 4274
265 Ga0495638_0021639 3300046460 Bacteria 4233
266 Ga0495641_0023391 3300046461 Bacteria 3070
267 Ga0495650_0048895 3300046471 Bacteria 1759
268 Ga0495580_0497181 3300046472 Bacteria 814
269 Ga0495605_0070850 3300046474 Bacteria 1648
270 Ga0495639_0145691 3300046475 Bacteria 1140
271 Ga0495584_0213292 3300046491 Bacteria 981
272 Ga0495584_0348197 3300046491 Bacteria 752
273 Ga0495585_0137421 3300046492 Bacteria 1282
274 Ga0495585_0178206 3300046492 Bacteria 1094
275 Ga0495585_0407335 3300046492 Bacteria 654
276 Ga0495594_0017922 3300046499 Bacteria 3747
277 Ga0495594_0122301 3300046499 Bacteria 1472
278 Ga0495596_0060864 3300046500 Bacteria 1471
279 Ga0495606_0116321 3300046507 Bacteria 1606
280 Ga0495610_0134961 3300046512 Bacteria 1068
281 Ga0495616_0117224 3300046513 Bacteria 1232
282 Ga0495616_0172594 3300046513 Bacteria 966
283 Ga0495620_0030393 3300046515 Bacteria 2487
284 Ga0495631_0502929 3300046518 Bacteria 516
285 Ga0495632_0107022 3300046519 Bacteria 1315
286 Ga0495632_0196012 3300046519 Bacteria 921
287 Ga0495643_0123647 3300046522 Bacteria 1305
288 Ga0495643_0143727 3300046522 Bacteria 1187
289 Ga0495644_0044543 3300046523 Bacteria 1669
290 Ga0495644_0182558 3300046523 Bacteria 807
291 Ga0495648_0222521 3300046524 Bacteria 930
292 Ga0495663_0059712 3300046525 Bacteria 1197
293 Ga0495642_0040449 3300046528 Bacteria 1894
294 Ga0495598_0041694 3300046537 Bacteria 1344
295 Ga0495598_0186007 3300046537 Bacteria 743
296 Ga0495609_0026467 3300046538 Bacteria 2656
297 Ga0495609_0069706 3300046538 Bacteria 1546
298 Ga0495609_0088639 3300046538 Bacteria 1347
299 Ga0495597_0091746 3300046542 Bacteria 1289
300 Ga0495622_0004295 3300046557 Bacteria 6633
301 Ga0495633_0037322 3300046558 Bacteria 2325
302 Ga0495633_0047806 3300046558 Bacteria 2022
303 Ga0495656_0016409 3300046615 Bacteria 2809
304 Ga0495656_0427792 3300046615 Bacteria 695
305 Ga0495668_0112137 3300046616 Bacteria 1491
306 Ga0495668_0347136 3300046616 Bacteria 814
307 Ga0495668_0458058 3300046616 Bacteria 702
308 Ga0495668_0698179 3300046616 Bacteria 561
309 Ga0495611_0094230 3300046648 Bacteria 1385
310 Ga0495625_0391147 3300046660 Bacteria 870
311 Ga0495635_0153797 3300046663 Bacteria 1566
312 Ga0495659_0009566 3300046664 Bacteria 3097
313 Ga0495661_0466756 3300046665 Bacteria 606
314 Ga0495588_0063118 3300046674 Bacteria 1920
315 Ga0495588_0311525 3300046674 Bacteria 828
316 Ga0495669_0344375 3300046684 Bacteria 720
317 Ga0495613_0875054 3300046689 Bacteria 583
318 Ga0495671_0281971 3300046692 Bacteria 800
319 Ga0495671_0366050 3300046692 Bacteria 691
320 Ga0495671_0444042 3300046692 Bacteria 620
321 Ga0495649_0231548 3300046694 Bacteria 953
322 Ga0495589_0200455 3300046794 Bacteria 942
323 Ga0495581_0556142 3300047315 Bacteria 666
324 Ga0495636_0089107 3300047318 Bacteria 1338
325 Ga0495636_0319739 3300047318 Bacteria 728
326 Ga0495676_0043346 3300047321 Bacteria 3684
327 Ga0495683_0269133 3300047323 Bacteria 741
328 Ga0495687_109733 3300047443 Bacteria 1017
329 Ga0495677_0052724 3300047445 Bacteria 1499
330 Ga0495685_024974 3300047447 Bacteria 2057
331 Ga0495686_0086026 3300047472 Bacteria 1913
332 Ga0495602_0586748 3300048088 Bacteria 768
333 Ga0495626_0126088 3300048091 Bacteria 1097
334 Ga0496101_0429842 3300048904 Bacteria 1041
335 Ga0496102_0588397 3300048905 Bacteria 1036
336 Ga0496103_0738644 3300048906 Bacteria 623
337 Ga0496104_0550071 3300048907 Bacteria 1065
338 Ga0496105_0769889 3300048908 Bacteria 734
339 Ga0496106_0077099 3300048909 Bacteria 2556
340 Ga0496108_0311422 3300048911 Bacteria 1372
341 Ga0496109_0076921 3300048912 Bacteria 3070
342 Ga0496110_1241892 3300048913 Bacteria 654
343 Ga0496110_1844095 3300048913 Bacteria 515
344 Ga0496112_0082032 3300048915 Bacteria 3189
345 Ga0496113_0242611 3300048916 Bacteria 1438
346 Ga0496115_0441612 3300048918 Bacteria 1052
347 Ga0496118_0241173 3300048921 Bacteria 1035
348 Ga0496118_0304890 3300048921 Bacteria 872
349 Ga0496121_0035432 3300048924 Bacteria 4474
350 Ga0496121_0065418 3300048924 Bacteria 2958
351 Ga0496121_0065618 3300048924 Bacteria 2952
352 Ga0496121_0824763 3300048924 Bacteria 542
353 Ga0496124_0112828 3300048927 Bacteria 2185
354 Ga0496124_0417359 3300048927 Bacteria 926
355 Ga0496125_0210501 3300048928 Bacteria 1263
356 Ga0496126_0033287 3300048929 Bacteria 4849
357 Ga0496126_0074385 3300048929 Bacteria 3017
358 Ga0496126_0083747 3300048929 Bacteria 2814
359 Ga0496126_0286125 3300048929 Bacteria 1364
360 Ga0496126_0924063 3300048929 Bacteria 660
361 Ga0496126_1065941 3300048929 Bacteria 602
362 Ga0495682_0129050 3300049460 Bacteria 904
363 Ga0501069_0214162 3300049585 Bacteria 1118
364 Ga0501227_178394 3300049665 Bacteria 596
365 Ga0501045_1086548 3300049824 Bacteria 585
366 nmdc:mga03683_30647_c1 3300050489 Bacteria 2153
367 nmdc:mga03683_55762_c1 3300050489 Bacteria 1660
368 nmdc:mga03683_608161_c1 3300050489 Bacteria 535
369 nmdc:mga03n38_37124_c1 3300050490 Bacteria 2099
370 nmdc:mga0yw44_1083708_c1 3300050492 Bacteria 541
371 nmdc:mga0yw44_12675_c1 3300050492 Bacteria 4405
372 nmdc:mga0yw44_184567_c1 3300050492 Bacteria 1374
373 nmdc:mga0yw44_547516_c1 3300050492 Bacteria 786
374 nmdc:mga0k408_71158_c1 3300050493 Bacteria 2030
375 nmdc:mga06z11_148685_c1 3300050494 Bacteria 1330
376 nmdc:mga06z11_32420_c1 3300050494 Bacteria 2548
377 nmdc:mga06z11_97939_c1 3300050494 Bacteria 1604
378 nmdc:mga04h51_24187_c1 3300050495 Bacteria 1858
379 nmdc:mga04h51_78842_c1 3300050495 Bacteria 1165
380 nmdc:mga07m45_188880_c1 3300050496 Bacteria 1198
381 nmdc:mga07m45_209835_c1 3300050496 Bacteria 1133
382 nmdc:mga07m45_330772_c1 3300050496 Bacteria 885
383 nmdc:mga05p37_45620_c1 3300050507 Bacteria 5389
384 nmdc:mga09592_432444_c1 3300050508 Bacteria 1136
385 nmdc:mga0n895_247738_c1 3300050512 Bacteria 1808
386 nmdc:mga0rr50_167805_c1 3300050513 Bacteria 1786
387 nmdc:mga0sz30_34155_c1 3300050516 Bacteria 2116
388 Ga0500610_0245775 3300053079 Bacteria 829
389 Ga0500578_0151382 3300053086 Bacteria 1445
390 Ga0500583_0008100 3300053092 Bacteria 3746
391 Ga0500583_0152677 3300053092 Bacteria 1149
392 Ga0500583_0169947 3300053092 Bacteria 1086
393 Ga0500651_0768510 3300053093 Bacteria 510
394 Ga0500566_0307867 3300053094 Bacteria 743
395 Ga0500641_0004230 3300053096 Bacteria 5064
396 Ga0500641_0020927 3300053096 Bacteria 2486
397 Ga0500641_0104242 3300053096 Bacteria 1218
398 Ga0500562_032245 3300053108 Bacteria 1382
399 Ga0500569_107328 3300053109 Bacteria 920
400 Ga0500582_188091 3300053114 Bacteria 700
401 Ga0500592_044315 3300053116 Bacteria 721
402 Ga0500594_0022120 3300053118 Bacteria 1601
403 Ga0500595_003594 3300053119 Bacteria 7194
404 Ga0500642_0066926 3300053130 Bacteria 1627
405 Ga0500655_009033 3300053133 Bacteria 1794
406 Ga0500658_0067309 3300053134 Bacteria 1504
407 Ga0500658_0100027 3300053134 Bacteria 1264
408 Ga0500658_0117681 3300053134 Bacteria 1175
409 Ga0500568_0102167 3300053139 Bacteria 1075
410 Ga0500577_0086177 3300053142 Bacteria 1261
411 Ga0500579_270563 3300053143 Bacteria 530
412 Ga0500588_0098724 3300053146 Bacteria 1004
413 Ga0500589_128676 3300053147 Bacteria 1061
414 Ga0500590_115655 3300053148 Bacteria 1265
415 Ga0500604_0360888 3300053151 Bacteria 505
416 Ga0500633_0027161 3300053160 Bacteria 1809
417 Ga0500634_0173657 3300053161 Bacteria 978
418 Ga0500637_0114942 3300053178 Bacteria 1561
419 Ga0500645_082810 3300053730 Bacteria 915
420 Ga0500609_007069 3300053731 Bacteria 1519

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_102424335 Ga0068868_1024243351 110
2 3300005367 Ga0070667_101075359 Ga0070667_1010753592 110
3 3300005441 Ga0070700_100220161 Ga0070700_1002201612 110
4 3300005456 Ga0070678_100137260 Ga0070678_1001372603 110
5 3300005539 Ga0068853_101706412 Ga0068853_1017064121 110
6 3300005543 Ga0070672_101129517 Ga0070672_1011295171 110
7 3300005548 Ga0070665_100566556 Ga0070665_1005665562 110
8 3300005548 Ga0070665_100654791 Ga0070665_1006547911 110
9 3300006038 Ga0075365_10139466 Ga0075365_101394662 110
10 3300006048 Ga0075363_100124999 Ga0075363_1001249993 110
11 3300006177 Ga0075362_10044367 Ga0075362_100443673 110
12 3300006353 Ga0075370_10053960 Ga0075370_100539602 110
13 3300006353 Ga0075370_10213512 Ga0075370_102135122 110
14 3300006358 Ga0068871_100654958 Ga0068871_1006549583 110
15 3300006881 Ga0068865_100771065 Ga0068865_1007710652 110
16 3300009101 Ga0105247_10058680 Ga0105247_100586803 110
17 3300009148 Ga0105243_11149265 Ga0105243_111492651 110
18 3300009553 Ga0105249_11579731 Ga0105249_115797311 110
19 3300011119 Ga0105246_10348082 Ga0105246_103480822 110
20 3300013306 Ga0163162_10981655 Ga0163162_109816551 110
21 3300014325 Ga0163163_12355147 Ga0163163_123551471 110
22 3300014326 Ga0157380_11481879 Ga0157380_114818792 110
23 3300014969 Ga0157376_11019344 Ga0157376_110193441 110
24 3300025910 Ga0207684_10919561 Ga0207684_109195611 110
25 3300025920 Ga0207649_10494806 Ga0207649_104948062 110
26 3300026041 Ga0207639_11188997 Ga0207639_111889971 110
27 3300026067 Ga0207678_10019008 Ga0207678_100190084 110
28 3300026075 Ga0207708_10511922 Ga0207708_105119222 110
29 3300026118 Ga0207675_102349535 Ga0207675_1023495351 110
30 3300026121 Ga0207683_10162274 Ga0207683_101622743 110
31 3300026121 Ga0207683_10512419 Ga0207683_105124192 110
32 3300028379 Ga0268266_10084660 Ga0268266_100846601 110
33 3300028379 Ga0268266_10460784 Ga0268266_104607842 110
34 3300031852 Ga0307410_10065482 Ga0307410_100654823 110
35 3300031911 Ga0307412_10257613 Ga0307412_102576132 110
36 3300032002 Ga0307416_100086079 Ga0307416_1000860793 110
37 3300032002 Ga0307416_100747804 Ga0307416_1007478042 110
38 3300032005 Ga0307411_10198026 Ga0307411_101980263 110
39 3300032005 Ga0307411_12209786 Ga0307411_122097861 110
40 3300032126 Ga0307415_100167411 Ga0307415_1001674113 110
41 3300041441 Ga0451787_287229 Ga0451787_287229_251_583 110
42 3300041451 Ga0451791_0080968 Ga0451791_0080968_760_1092 110
43 3300041452 Ga0451793_1559712 Ga0451793_1559712_186_518 110
44 3300041453 Ga0451797_1065054 Ga0451797_1065054_500_832 110
45 3300041460 Ga0451802_0783352 Ga0451802_0783352_159_491 110
46 3300048904 Ga0496101_0429842 Ga0496101_0429842_585_983 110
47 3300048909 Ga0496106_0077099 Ga0496106_0077099_1814_2212 110
48 3300048918 Ga0496115_0441612 Ga0496115_0441612_30_362 110
49 3300048929 Ga0496126_1065941 Ga0496126_1065941_105_503 110
50 3300050489 nmdc:mga03683_608161_c1 nmdc:mga03683_608161_c1_23_355 110
51 3300050492 nmdc:mga0yw44_547516_c1 nmdc:mga0yw44_547516_c1_422_754 110
52 3300050494 nmdc:mga06z11_97939_c1 nmdc:mga06z11_97939_c1_1004_1402 110
53 3300050496 nmdc:mga07m45_209835_c1 nmdc:mga07m45_209835_c1_644_976 110
54 3300053096 Ga0500641_0004230 Ga0500641_0004230_3321_3665 110
55 3300053096 Ga0500641_0020927 Ga0500641_0020927_1204_1536 110
56 3300053151 Ga0500604_0360888 Ga0500604_0360888_149_493 110
57 3300005347 Ga0070668_100494638 Ga0070668_1004946381 111
58 3300005985 Ga0081539_10146220 Ga0081539_101462202 111
59 3300006038 Ga0075365_10053132 Ga0075365_100531321 111
60 3300006048 Ga0075363_100169354 Ga0075363_1001693542 111
61 3300006177 Ga0075362_10126454 Ga0075362_101264542 111
62 3300006186 Ga0075369_10012585 Ga0075369_100125853 111
63 3300006195 Ga0075366_10189791 Ga0075366_101897911 111
64 3300006844 Ga0075428_100104254 Ga0075428_1001042544 111
65 3300009147 Ga0114129_10240232 Ga0114129_102402323 111
66 3300009553 Ga0105249_10746574 Ga0105249_107465742 111
67 3300025972 Ga0207668_10550399 Ga0207668_105503992 111
68 3300031548 Ga0307408_100143771 Ga0307408_1001437712 111
69 3300042157 Ga0439458_0057036 Ga0439458_0057036_207_542 111
70 3300042438 Ga0439459_0033694 Ga0439459_0033694_317_652 111
71 3300049824 Ga0501045_1086548 Ga0501045_1086548_163_498 111
72 3300050490 nmdc:mga03n38_37124_c1 nmdc:mga03n38_37124_c1_1137_1472 111
73 3300050492 nmdc:mga0yw44_12675_c1 nmdc:mga0yw44_12675_c1_111_446 111
74 3300050507 nmdc:mga05p37_45620_c1 nmdc:mga05p37_45620_c1_1003_1338 111
75 3300050516 nmdc:mga0sz30_34155_c1 nmdc:mga0sz30_34155_c1_1094_1429 111
76 3300005337 Ga0070682_100334189 Ga0070682_1003341891 112
77 3300005616 Ga0068852_100582373 Ga0068852_1005823731 112
78 3300010375 Ga0105239_10487032 Ga0105239_104870322 112
79 3300025920 Ga0207649_10061377 Ga0207649_100613773 112
80 3300026142 Ga0207698_11149116 Ga0207698_111491161 112
81 3300041451 Ga0451791_0401571 Ga0451791_0401571_185_523 112
82 3300041486 Ga0451807_1048395 Ga0451807_1048395_23_361 112
83 3300041491 Ga0451833_0161027 Ga0451833_0161027_149_487 112
84 3300041494 Ga0451837_0587790 Ga0451837_0587790_312_650 112
85 3300041501 Ga0451845_0085056 Ga0451845_0085056_38_376 112
86 3300041512 Ga0451853_2066006 Ga0451853_2066006_292_630 112
87 iso_pu_bacteria 2791355199 2793079545 112
88 iso_pu_bacteria 2876808645 2876817776 112
89 iso_pu_bacteria 2879110137 2879118060 112
90 iso_pu_bacteria 2889033259 2889033653 112
91 iso_pu_bacteria 2922386360 2922390201 112
92 3300046500 Ga0495596_0060864 Ga0495596_0060864_291_632 113
93 3300046692 Ga0495671_0281971 Ga0495671_0281971_271_612 113
94 3300046694 Ga0495649_0231548 Ga0495649_0231548_523_864 113
95 3300053096 Ga0500641_0104242 Ga0500641_0104242_477_818 113
96 3300005334 Ga0068869_100405940 Ga0068869_1004059402 114
97 3300005334 Ga0068869_100449045 Ga0068869_1004490452 114
98 3300005338 Ga0068868_100053907 Ga0068868_1000539073 114
99 3300005338 Ga0068868_100521116 Ga0068868_1005211162 114
100 3300005339 Ga0070660_100066999 Ga0070660_1000669992 114
101 3300005340 Ga0070689_100040088 Ga0070689_1000400883 114
102 3300005344 Ga0070661_100240547 Ga0070661_1002405473 114
103 3300005345 Ga0070692_10320766 Ga0070692_103207662 114
104 3300005347 Ga0070668_100011355 Ga0070668_1000113552 114
105 3300005347 Ga0070668_100114051 Ga0070668_1001140512 114
106 3300005347 Ga0070668_100145595 Ga0070668_1001455953 114
107 3300005347 Ga0070668_100698574 Ga0070668_1006985741 114
108 3300005347 Ga0070668_100949900 Ga0070668_1009499002 114
109 3300005347 Ga0070668_101824096 Ga0070668_1018240962 114
110 3300005353 Ga0070669_101203064 Ga0070669_1012030642 114
111 3300005355 Ga0070671_101927512 Ga0070671_1019275121 114
112 3300005364 Ga0070673_100370555 Ga0070673_1003705551 114
113 3300005365 Ga0070688_100063221 Ga0070688_1000632213 114
114 3300005366 Ga0070659_100589087 Ga0070659_1005890871 114
115 3300005444 Ga0070694_100636910 Ga0070694_1006369102 114
116 3300005455 Ga0070663_100007837 Ga0070663_1000078371 114
117 3300005455 Ga0070663_100330480 Ga0070663_1003304801 114
118 3300005456 Ga0070678_100033929 Ga0070678_1000339293 114
119 3300005456 Ga0070678_101567924 Ga0070678_1015679242 114
120 3300005457 Ga0070662_100221316 Ga0070662_1002213162 114
121 3300005457 Ga0070662_100614975 Ga0070662_1006149752 114
122 3300005466 Ga0070685_10155102 Ga0070685_101551021 114
123 3300005471 Ga0070698_100539320 Ga0070698_1005393202 114
124 3300005518 Ga0070699_100305866 Ga0070699_1003058662 114
125 3300005539 Ga0068853_100153536 Ga0068853_1001535362 114
126 3300005543 Ga0070672_101289861 Ga0070672_1012898612 114
127 3300005544 Ga0070686_100201027 Ga0070686_1002010272 114
128 3300005545 Ga0070695_100073320 Ga0070695_1000733202 114
129 3300005546 Ga0070696_100860902 Ga0070696_1008609022 114
130 3300005547 Ga0070693_100563035 Ga0070693_1005630352 114
131 3300005548 Ga0070665_100064844 Ga0070665_1000648444 114
132 3300005549 Ga0070704_101034911 Ga0070704_1010349112 114
133 3300005614 Ga0068856_100102134 Ga0068856_1001021343 114
134 3300005615 Ga0070702_101194747 Ga0070702_1011947472 114
135 3300005616 Ga0068852_100103780 Ga0068852_1001037803 114
136 3300005617 Ga0068859_100025848 Ga0068859_1000258484 114
137 3300005617 Ga0068859_100894880 Ga0068859_1008948802 114
138 3300005618 Ga0068864_100108510 Ga0068864_1001085101 114
139 3300005719 Ga0068861_100512489 Ga0068861_1005124892 114
140 3300005834 Ga0068851_10329513 Ga0068851_103295131 114
141 3300005840 Ga0068870_10019559 Ga0068870_100195593 114
142 3300005841 Ga0068863_100242724 Ga0068863_1002427244 114
143 3300005841 Ga0068863_100291547 Ga0068863_1002915471 114
144 3300005841 Ga0068863_101647728 Ga0068863_1016477282 114
145 3300005843 Ga0068860_100036330 Ga0068860_1000363306 114
146 3300005843 Ga0068860_100162554 Ga0068860_1001625542 114
147 3300005843 Ga0068860_100481785 Ga0068860_1004817853 114
148 3300005844 Ga0068862_100349548 Ga0068862_1003495481 114
149 3300005844 Ga0068862_100361911 Ga0068862_1003619112 114
150 3300005844 Ga0068862_100385874 Ga0068862_1003858743 114
151 3300005983 Ga0081540_1008133 Ga0081540_10081333 114
152 3300006038 Ga0075365_10105552 Ga0075365_101055523 114
153 3300006042 Ga0075368_10048237 Ga0075368_100482373 114
154 3300006042 Ga0075368_10083775 Ga0075368_100837753 114
155 3300006048 Ga0075363_100080617 Ga0075363_1000806172 114
156 3300006051 Ga0075364_10161465 Ga0075364_101614651 114
157 3300006058 Ga0075432_10446605 Ga0075432_104466051 114
158 3300006163 Ga0070715_10939378 Ga0070715_109393781 114
159 3300006177 Ga0075362_10060323 Ga0075362_100603233 114
160 3300006177 Ga0075362_10551160 Ga0075362_105511602 114
161 3300006178 Ga0075367_10090246 Ga0075367_100902463 114
162 3300006178 Ga0075367_10106794 Ga0075367_101067942 114
163 3300006178 Ga0075367_10784125 Ga0075367_107841252 114
164 3300006195 Ga0075366_10019651 Ga0075366_100196511 114
165 3300006195 Ga0075366_10075167 Ga0075366_100751671 114
166 3300006195 Ga0075366_10647429 Ga0075366_106474292 114
167 3300006353 Ga0075370_10065687 Ga0075370_100656871 114
168 3300006353 Ga0075370_10120446 Ga0075370_101204463 114
169 3300006353 Ga0075370_10923536 Ga0075370_109235362 114
170 3300006358 Ga0068871_100009991 Ga0068871_1000099912 114
171 3300006881 Ga0068865_100396043 Ga0068865_1003960432 114
172 3300006881 Ga0068865_101052932 Ga0068865_1010529322 114
173 3300006931 Ga0097620_100025848 Ga0097620_1000258484 114
174 3300006931 Ga0097620_100894855 Ga0097620_1008948552 114
175 3300007076 Ga0075435_100178399 Ga0075435_1001783991 114
176 3300007788 Ga0099795_10075450 Ga0099795_100754504 114
177 3300009092 Ga0105250_10047525 Ga0105250_100475253 114
178 3300009092 Ga0105250_10087582 Ga0105250_100875822 114
179 3300009093 Ga0105240_10509304 Ga0105240_105093042 114
180 3300009098 Ga0105245_10013930 Ga0105245_100139307 114
181 3300009098 Ga0105245_11608428 Ga0105245_116084282 114
182 3300009101 Ga0105247_10595204 Ga0105247_105952042 114
183 3300009147 Ga0114129_11581972 Ga0114129_115819721 114
184 3300009148 Ga0105243_10218860 Ga0105243_102188603 114
185 3300009148 Ga0105243_10377923 Ga0105243_103779233 114
186 3300009148 Ga0105243_11230069 Ga0105243_112300692 114
187 3300009176 Ga0105242_10429798 Ga0105242_104297981 114
188 3300009176 Ga0105242_12375259 Ga0105242_123752591 114
189 3300009177 Ga0105248_10014109 Ga0105248_100141092 114
190 3300009545 Ga0105237_10082630 Ga0105237_100826303 114
191 3300009553 Ga0105249_10502640 Ga0105249_105026402 114
192 3300010375 Ga0105239_10007120 Ga0105239_100071203 114
193 3300011119 Ga0105246_10038604 Ga0105246_100386043 114
194 3300013296 Ga0157374_11276934 Ga0157374_112769341 114
195 3300013297 Ga0157378_10429495 Ga0157378_104294952 114
196 3300013306 Ga0163162_10264274 Ga0163162_102642742 114
197 3300013306 Ga0163162_11136933 Ga0163162_111369331 114
198 3300013308 Ga0157375_10644433 Ga0157375_106444333 114
199 3300014326 Ga0157380_10174402 Ga0157380_101744022 114
200 3300014745 Ga0157377_10377718 Ga0157377_103777182 114
201 3300014745 Ga0157377_10451158 Ga0157377_104511582 114
202 3300014968 Ga0157379_10281784 Ga0157379_102817842 114
203 3300014969 Ga0157376_10074460 Ga0157376_100744603 114
204 3300014969 Ga0157376_10168076 Ga0157376_101680763 114
205 3300014969 Ga0157376_11405161 Ga0157376_114051611 114
206 3300017792 Ga0163161_10532669 Ga0163161_105326693 114
207 3300025900 Ga0207710_10029511 Ga0207710_100295112 114
208 3300025901 Ga0207688_10008199 Ga0207688_100081995 114
209 3300025904 Ga0207647_10085687 Ga0207647_100856873 114
210 3300025908 Ga0207643_10062650 Ga0207643_100626502 114
211 3300025911 Ga0207654_10035557 Ga0207654_100355573 114
212 3300025914 Ga0207671_10042950 Ga0207671_100429501 114
213 3300025919 Ga0207657_10326021 Ga0207657_103260212 114
214 3300025922 Ga0207646_10449982 Ga0207646_104499822 114
215 3300025923 Ga0207681_10690828 Ga0207681_106908282 114
216 3300025924 Ga0207694_10282626 Ga0207694_102826262 114
217 3300025927 Ga0207687_10044331 Ga0207687_100443313 114
218 3300025931 Ga0207644_10109726 Ga0207644_101097262 114
219 3300025932 Ga0207690_11250492 Ga0207690_112504921 114
220 3300025933 Ga0207706_10032724 Ga0207706_100327244 114
221 3300025934 Ga0207686_10399833 Ga0207686_103998332 114
222 3300025935 Ga0207709_10325745 Ga0207709_103257451 114
223 3300025938 Ga0207704_10236216 Ga0207704_102362162 114
224 3300025940 Ga0207691_11048895 Ga0207691_110488951 114
225 3300025941 Ga0207711_10068171 Ga0207711_100681713 114
226 3300025942 Ga0207689_10311076 Ga0207689_103110763 114
227 3300025942 Ga0207689_10566808 Ga0207689_105668082 114
228 3300025942 Ga0207689_10584328 Ga0207689_105843281 114
229 3300025942 Ga0207689_11339098 Ga0207689_113390981 114
230 3300025960 Ga0207651_11130322 Ga0207651_111303221 114
231 3300025981 Ga0207640_10653517 Ga0207640_106535171 114
232 3300025986 Ga0207658_11127322 Ga0207658_111273222 114
233 3300026023 Ga0207677_10783810 Ga0207677_107838102 114
234 3300026035 Ga0207703_10793574 Ga0207703_107935741 114
235 3300026041 Ga0207639_10049503 Ga0207639_100495031 114
236 3300026041 Ga0207639_10253959 Ga0207639_102539592 114
237 3300026067 Ga0207678_10029500 Ga0207678_100295003 114
238 3300026067 Ga0207678_10594798 Ga0207678_105947982 114
239 3300026075 Ga0207708_10071680 Ga0207708_100716803 114
240 3300026075 Ga0207708_10709655 Ga0207708_107096552 114
241 3300026078 Ga0207702_10041361 Ga0207702_100413612 114
242 3300026088 Ga0207641_10025123 Ga0207641_100251234 114
243 3300026088 Ga0207641_10461540 Ga0207641_104615402 114
244 3300026118 Ga0207675_100046630 Ga0207675_1000466303 114
245 3300026118 Ga0207675_100187601 Ga0207675_1001876012 114
246 3300026121 Ga0207683_10065818 Ga0207683_100658182 114
247 3300026121 Ga0207683_10141240 Ga0207683_101412403 114
248 3300026142 Ga0207698_10083440 Ga0207698_100834403 114
249 3300028379 Ga0268266_10031885 Ga0268266_100318853 114
250 3300028379 Ga0268266_10048964 Ga0268266_100489643 114
251 3300028379 Ga0268266_10416490 Ga0268266_104164902 114
252 3300028379 Ga0268266_11673824 Ga0268266_116738242 114
253 3300028380 Ga0268265_10604419 Ga0268265_106044192 114
254 3300028380 Ga0268265_10618896 Ga0268265_106188962 114
255 3300028380 Ga0268265_11564769 Ga0268265_115647692 114
256 3300028381 Ga0268264_10083749 Ga0268264_100837493 114
257 3300028381 Ga0268264_10226084 Ga0268264_102260842 114
258 3300028381 Ga0268264_10304597 Ga0268264_103045971 114
259 3300028786 Ga0307517_10102407 Ga0307517_101024073 114
260 3300028786 Ga0307517_10230641 Ga0307517_102306412 114
261 3300031456 Ga0307513_10275993 Ga0307513_102759933 114
262 3300031507 Ga0307509_10212034 Ga0307509_102120341 114
263 3300031548 Ga0307408_100381648 Ga0307408_1003816482 114
264 3300031824 Ga0307413_10022807 Ga0307413_100228073 114
265 3300031903 Ga0307407_10378287 Ga0307407_103782872 114
266 3300032002 Ga0307416_100306833 Ga0307416_1003068331 114
267 3300032002 Ga0307416_100350746 Ga0307416_1003507462 114
268 3300032004 Ga0307414_10135138 Ga0307414_101351383 114
269 3300033180 Ga0307510_10046908 Ga0307510_100469083 114
270 3300035170 Ga0373943_0227898 Ga0373943_0227898_341_685 114
271 3300035691 Ga0373931_0607095 Ga0373931_0607095_204_548 114
272 3300035695 Ga0373927_0447121 Ga0373927_0447121_71_415 114
273 3300035725 Ga0373947_0353892 Ga0373947_0353892_356_700 114
274 3300037068 Ga0373925_0512853 Ga0373925_0512853_187_531 114
275 3300046452 Ga0495617_047422 Ga0495617_047422_84_428 114
276 3300046452 Ga0495617_142384 Ga0495617_142384_148_492 114
277 3300046452 Ga0495617_265605 Ga0495617_265605_136_480 114
278 3300046455 Ga0495603_0037517 Ga0495603_0037517_2160_2504 114
279 3300046455 Ga0495603_0059489 Ga0495603_0059489_1832_2176 114
280 3300046455 Ga0495603_0151614 Ga0495603_0151614_502_846 114
281 3300046460 Ga0495638_0021293 Ga0495638_0021293_1162_1506 114
282 3300046460 Ga0495638_0021639 Ga0495638_0021639_455_799 114
283 3300046461 Ga0495641_0023391 Ga0495641_0023391_29_373 114
284 3300046471 Ga0495650_0048895 Ga0495650_0048895_94_438 114
285 3300046472 Ga0495580_0497181 Ga0495580_0497181_87_431 114
286 3300046474 Ga0495605_0070850 Ga0495605_0070850_1285_1629 114
287 3300046475 Ga0495639_0145691 Ga0495639_0145691_655_999 114
288 3300046491 Ga0495584_0213292 Ga0495584_0213292_589_933 114
289 3300046491 Ga0495584_0348197 Ga0495584_0348197_56_400 114
290 3300046492 Ga0495585_0137421 Ga0495585_0137421_359_703 114
291 3300046492 Ga0495585_0178206 Ga0495585_0178206_590_934 114
292 3300046492 Ga0495585_0407335 Ga0495585_0407335_66_410 114
293 3300046499 Ga0495594_0017922 Ga0495594_0017922_1363_1707 114
294 3300046499 Ga0495594_0122301 Ga0495594_0122301_197_541 114
295 3300046507 Ga0495606_0116321 Ga0495606_0116321_647_991 114
296 3300046512 Ga0495610_0134961 Ga0495610_0134961_454_798 114
297 3300046513 Ga0495616_0117224 Ga0495616_0117224_86_430 114
298 3300046513 Ga0495616_0172594 Ga0495616_0172594_325_669 114
299 3300046515 Ga0495620_0030393 Ga0495620_0030393_1065_1409 114
300 3300046518 Ga0495631_0502929 Ga0495631_0502929_101_445 114
301 3300046519 Ga0495632_0107022 Ga0495632_0107022_321_665 114
302 3300046519 Ga0495632_0196012 Ga0495632_0196012_545_889 114
303 3300046522 Ga0495643_0123647 Ga0495643_0123647_53_397 114
304 3300046522 Ga0495643_0143727 Ga0495643_0143727_423_767 114
305 3300046523 Ga0495644_0044543 Ga0495644_0044543_171_533 114
306 3300046524 Ga0495648_0222521 Ga0495648_0222521_333_677 114
307 3300046525 Ga0495663_0059712 Ga0495663_0059712_140_484 114
308 3300046528 Ga0495642_0040449 Ga0495642_0040449_1329_1673 114
309 3300046537 Ga0495598_0041694 Ga0495598_0041694_986_1330 114
310 3300046537 Ga0495598_0186007 Ga0495598_0186007_141_485 114
311 3300046538 Ga0495609_0026467 Ga0495609_0026467_1500_1844 114
312 3300046538 Ga0495609_0069706 Ga0495609_0069706_609_953 114
313 3300046538 Ga0495609_0088639 Ga0495609_0088639_629_973 114
314 3300046542 Ga0495597_0091746 Ga0495597_0091746_101_445 114
315 3300046557 Ga0495622_0004295 Ga0495622_0004295_6081_6425 114
316 3300046558 Ga0495633_0047806 Ga0495633_0047806_1582_1926 114
317 3300046615 Ga0495656_0016409 Ga0495656_0016409_1296_1640 114
318 3300046615 Ga0495656_0427792 Ga0495656_0427792_159_503 114
319 3300046616 Ga0495668_0112137 Ga0495668_0112137_841_1185 114
320 3300046616 Ga0495668_0347136 Ga0495668_0347136_402_746 114
321 3300046616 Ga0495668_0458058 Ga0495668_0458058_135_479 114
322 3300046616 Ga0495668_0698179 Ga0495668_0698179_161_505 114
323 3300046648 Ga0495611_0094230 Ga0495611_0094230_213_557 114
324 3300046660 Ga0495625_0391147 Ga0495625_0391147_335_679 114
325 3300046663 Ga0495635_0153797 Ga0495635_0153797_60_404 114
326 3300046664 Ga0495659_0009566 Ga0495659_0009566_1545_1889 114
327 3300046665 Ga0495661_0466756 Ga0495661_0466756_182_526 114
328 3300046674 Ga0495588_0063118 Ga0495588_0063118_539_883 114
329 3300046674 Ga0495588_0311525 Ga0495588_0311525_380_724 114
330 3300046684 Ga0495669_0344375 Ga0495669_0344375_108_452 114
331 3300046689 Ga0495613_0875054 Ga0495613_0875054_36_380 114
332 3300046692 Ga0495671_0366050 Ga0495671_0366050_128_541 114
333 3300046692 Ga0495671_0444042 Ga0495671_0444042_143_487 114
334 3300046794 Ga0495589_0200455 Ga0495589_0200455_97_441 114
335 3300047315 Ga0495581_0556142 Ga0495581_0556142_203_547 114
336 3300047318 Ga0495636_0089107 Ga0495636_0089107_712_1056 114
337 3300047318 Ga0495636_0319739 Ga0495636_0319739_356_700 114
338 3300047321 Ga0495676_0043346 Ga0495676_0043346_1998_2342 114
339 3300047323 Ga0495683_0269133 Ga0495683_0269133_258_602 114
340 3300047443 Ga0495687_109733 Ga0495687_109733_52_396 114
341 3300047445 Ga0495677_0052724 Ga0495677_0052724_1025_1369 114
342 3300047447 Ga0495685_024974 Ga0495685_024974_557_919 114
343 3300047472 Ga0495686_0086026 Ga0495686_0086026_132_476 114
344 3300048088 Ga0495602_0586748 Ga0495602_0586748_45_389 114
345 3300048091 Ga0495626_0126088 Ga0495626_0126088_127_483 114
346 3300048905 Ga0496102_0588397 Ga0496102_0588397_562_906 114
347 3300048906 Ga0496103_0738644 Ga0496103_0738644_219_563 114
348 3300048907 Ga0496104_0550071 Ga0496104_0550071_614_976 114
349 3300048908 Ga0496105_0769889 Ga0496105_0769889_348_710 114
350 3300048911 Ga0496108_0311422 Ga0496108_0311422_923_1267 114
351 3300048912 Ga0496109_0076921 Ga0496109_0076921_2201_2545 114
352 3300048913 Ga0496110_1241892 Ga0496110_1241892_292_636 114
353 3300048913 Ga0496110_1844095 Ga0496110_1844095_48_392 114
354 3300048915 Ga0496112_0082032 Ga0496112_0082032_2030_2374 114
355 3300048916 Ga0496113_0242611 Ga0496113_0242611_555_899 114
356 3300048921 Ga0496118_0241173 Ga0496118_0241173_658_1002 114
357 3300048921 Ga0496118_0304890 Ga0496118_0304890_11_355 114
358 3300048924 Ga0496121_0035432 Ga0496121_0035432_3279_3623 114
359 3300048924 Ga0496121_0065418 Ga0496121_0065418_1812_2156 114
360 3300048924 Ga0496121_0065618 Ga0496121_0065618_1718_2062 114
361 3300048924 Ga0496121_0824763 Ga0496121_0824763_93_437 114
362 3300048927 Ga0496124_0112828 Ga0496124_0112828_859_1206 114
363 3300048927 Ga0496124_0417359 Ga0496124_0417359_252_596 114
364 3300048928 Ga0496125_0210501 Ga0496125_0210501_191_535 114
365 3300048929 Ga0496126_0033287 Ga0496126_0033287_3347_3691 114
366 3300048929 Ga0496126_0074385 Ga0496126_0074385_1899_2246 114
367 3300048929 Ga0496126_0083747 Ga0496126_0083747_889_1233 114
368 3300048929 Ga0496126_0286125 Ga0496126_0286125_591_935 114
369 3300048929 Ga0496126_0924063 Ga0496126_0924063_242_586 114
370 3300049460 Ga0495682_0129050 Ga0495682_0129050_159_503 114
371 3300049665 Ga0501227_178394 Ga0501227_178394_194_538 114
372 3300050489 nmdc:mga03683_55762_c1 nmdc:mga03683_55762_c1_913_1257 114
373 3300050492 nmdc:mga0yw44_1083708_c1 nmdc:mga0yw44_1083708_c1_33_377 114
374 3300050492 nmdc:mga0yw44_184567_c1 nmdc:mga0yw44_184567_c1_159_503 114
375 3300050493 nmdc:mga0k408_71158_c1 nmdc:mga0k408_71158_c1_218_562 114
376 3300050494 nmdc:mga06z11_148685_c1 nmdc:mga06z11_148685_c1_445_789 114
377 3300050494 nmdc:mga06z11_32420_c1 nmdc:mga06z11_32420_c1_304_666 114
378 3300050495 nmdc:mga04h51_24187_c1 nmdc:mga04h51_24187_c1_252_596 114
379 3300050495 nmdc:mga04h51_78842_c1 nmdc:mga04h51_78842_c1_203_595 114
380 3300050496 nmdc:mga07m45_188880_c1 nmdc:mga07m45_188880_c1_459_803 114
381 3300050496 nmdc:mga07m45_330772_c1 nmdc:mga07m45_330772_c1_270_629 114
382 3300050508 nmdc:mga09592_432444_c1 nmdc:mga09592_432444_c1_136_480 114
383 3300050512 nmdc:mga0n895_247738_c1 nmdc:mga0n895_247738_c1_829_1173 114
384 3300050513 nmdc:mga0rr50_167805_c1 nmdc:mga0rr50_167805_c1_452_796 114
385 3300053079 Ga0500610_0245775 Ga0500610_0245775_324_668 114
386 3300053086 Ga0500578_0151382 Ga0500578_0151382_385_729 114
387 3300053092 Ga0500583_0008100 Ga0500583_0008100_441_803 114
388 3300053092 Ga0500583_0152677 Ga0500583_0152677_131_475 114
389 3300053092 Ga0500583_0169947 Ga0500583_0169947_307_651 114
390 3300053093 Ga0500651_0768510 Ga0500651_0768510_132_476 114
391 3300053094 Ga0500566_0307867 Ga0500566_0307867_244_588 114
392 3300053108 Ga0500562_032245 Ga0500562_032245_842_1186 114
393 3300053109 Ga0500569_107328 Ga0500569_107328_493_837 114
394 3300053114 Ga0500582_188091 Ga0500582_188091_244_588 114
395 3300053116 Ga0500592_044315 Ga0500592_044315_251_613 114
396 3300053118 Ga0500594_0022120 Ga0500594_0022120_869_1213 114
397 3300053119 Ga0500595_003594 Ga0500595_003594_3913_4257 114
398 3300053130 Ga0500642_0066926 Ga0500642_0066926_506_850 114
399 3300053133 Ga0500655_009033 Ga0500655_009033_417_761 114
400 3300053134 Ga0500658_0067309 Ga0500658_0067309_231_575 114
401 3300053134 Ga0500658_0100027 Ga0500658_0100027_681_1025 114
402 3300053134 Ga0500658_0117681 Ga0500658_0117681_201_545 114
403 3300053139 Ga0500568_0102167 Ga0500568_0102167_84_428 114
404 3300053142 Ga0500577_0086177 Ga0500577_0086177_291_635 114
405 3300053143 Ga0500579_270563 Ga0500579_270563_58_402 114
406 3300053146 Ga0500588_0098724 Ga0500588_0098724_416_760 114
407 3300053147 Ga0500589_128676 Ga0500589_128676_563_907 114
408 3300053148 Ga0500590_115655 Ga0500590_115655_480_824 114
409 3300053160 Ga0500633_0027161 Ga0500633_0027161_1096_1440 114
410 3300053161 Ga0500634_0173657 Ga0500634_0173657_233_577 114
411 3300053178 Ga0500637_0114942 Ga0500637_0114942_917_1261 114
412 3300053730 Ga0500645_082810 Ga0500645_082810_404_748 114
413 3300053731 Ga0500609_007069 Ga0500609_007069_361_705 114
414 3300003320 rootH2_10034185 rootH2_100341853 116
415 3300003322 rootL2_10053669 rootL2_100536693 116
416 3300005937 Ga0081455_10103304 Ga0081455_101033044 116
417 3300005937 Ga0081455_10484567 Ga0081455_104845672 116
418 3300005985 Ga0081539_10175943 Ga0081539_101759433 116
419 3300006177 Ga0075362_10018906 Ga0075362_100189064 116
420 3300025297 Ga0209758_1002180 Ga0209758_100218010 116
421 3300028786 Ga0307517_10618287 Ga0307517_106182871 116
422 3300046523 Ga0495644_0182558 Ga0495644_0182558_140_490 116
423 3300046558 Ga0495633_0037322 Ga0495633_0037322_144_494 116
424 3300049585 Ga0501069_0214162 Ga0501069_0214162_213_563 116
425 3300050489 nmdc:mga03683_30647_c1 nmdc:mga03683_30647_c1_1670_2020 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13619

KTSC

KTSC domain

41

96

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x8c-assembly1.cif.gz_C crystal structure of a ktsc family protein from euryarchaeon methanolobus vulcani 0.9065 36 96
4rgi-assembly1.cif.gz_A crystal structure of ktsc domain protein ypo2434 from yersinia pestis 0.8967 35 108
4rgi-assembly1.cif.gz_A crystal structure of ktsc domain protein ypo2434 from yersinia pestis 0.8391 35 108
4wl2-assembly3.cif.gz_G structure of penicillin v acylase from pectobacterium atrosepticum 0.7957 48 70
7x8c-assembly1.cif.gz_C crystal structure of a ktsc family protein from euryarchaeon methanolobus vulcani 0.7861 36 96
ID Description Score Start End Superfamily
af_C6KFA3_153_352_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8201 48 72 2.60.120.200
af_A0A0R0IJU0_61_261_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8002 45 69 2.130.10.10
af_Q2FUW1_257_494_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7796 48 72 2.60.120.200
af_Q4E087_7_130_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7723 46 73 2.130.10.10
af_I1KSA4_38_162_2.30.240.10 Mainly Beta;Roll;at5g01610, DUF538 DOMAIN;At5g01610-like 0.7702 46 68 2.30.240.10
ID Description Score Start End GO Terms
AF-A0A4Q4AIM1-F1-model_v4 deleted 0.9995 19 75
AF-A0A1H5HGF5-F1-model_v4 KTSC domain-containing protein 0.9891 19 63
AF-A0A845M066-F1-model_v4 KTSC domain-containing protein 0.9589 35 96
AF-A0A1Y6B0V5-F1-model_v4 deleted 0.9581 36 96
AF-A0A0F9PBN5-F1-model_v4 KTSC domain-containing protein 0.9516 36 96

Feature Viewer

pLDDT pTM Quality
81.06 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map