F440997

General Info

Members Datasets Scaffolds Average Seq Length
425 380 850 263

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10000363|Ga0265320_100003637
Length 301
Sequence MIQYLDLLRHVLEHGKFKADRTGTGTYSVFGAQTRFDLRKDFPVLTTKKLHLRSIIYELLWFLRGDRNVRYLQENKVTIWDEWADEKGDLGPVYGKQWRNWVKTKSRPRKSPDSSTSQATLFDLGESDGQTIVTPAGPRVRSKHGIDQIATVIEAIQKNPDSRRLIVSAWNVADIDSMALPPCHALFQFYVSDGELSCQLYQRSADIFLGVPFNIASYALLTLMVAQVCGLKPGDFVHTFGDLHLYANHLEQAKLQLSREPRPLPQMKLNPAVKHIDHFKFEDFELVNYDPHPGIKAPIAV

Samples

Sample ID Description Type Environment
1 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
173 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
175 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
176 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
177 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
178 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
179 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
180 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
181 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
182 2516143018 Ensifer sp. BR816 Isolate Nodule
183 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
184 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
185 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
186 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
187 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
188 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
189 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
190 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
191 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
192 2643221618 Ensifer sp. Root231 Isolate Unclassified
193 2643221626 Ensifer sp. Root31 Isolate Unclassified
194 2643221655 Ensifer sp. Root1252 Isolate Unclassified
195 2643221659 Ensifer sp. Root127 Isolate Unclassified
196 2643221688 Rhizobium sp. Root482 Isolate Unclassified
197 2643221698 Ensifer sp. Root142 Isolate Unclassified
198 2643221712 Ensifer sp. Root258 Isolate Unclassified
199 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
200 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
201 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
202 2738541295 Bacillus sp. OK085 Isolate Unclassified
203 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
204 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
205 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
206 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
207 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
208 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
209 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
210 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
211 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
212 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
213 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
214 2844163670 Ensifer sp. 1H6 Isolate Unclassified
215 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
216 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
217 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
218 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
219 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
220 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
221 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
222 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
223 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
224 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
225 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
226 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
227 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
228 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
229 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
230 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
231 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
232 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
233 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
234 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
235 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
236 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
237 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
238 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
239 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
240 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
241 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
242 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
243 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
244 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
245 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
246 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
247 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
248 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
249 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
250 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
251 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
252 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
253 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
254 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
255 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
256 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
257 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
258 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
259 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
260 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
261 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
262 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
263 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
264 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
265 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
266 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
267 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
268 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
269 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
270 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
271 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
272 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
273 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
274 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
275 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
276 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
277 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
278 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
279 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
280 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
281 2952252522 Salinicola sp. DM10 Isolate Unclassified
282 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
283 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
284 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
285 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
286 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
287 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
288 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
289 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
290 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
291 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
292 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
293 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
294 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
295 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
296 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
297 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
298 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
299 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
300 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
301 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
302 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
303 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
304 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
305 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
306 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
307 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
308 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
309 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
310 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
311 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
312 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
313 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
314 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
315 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
316 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
317 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
318 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
319 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
320 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
321 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
322 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
323 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
324 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
325 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
326 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
327 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
328 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
329 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
330 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
331 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
332 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
333 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
334 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
335 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
336 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
337 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
338 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
339 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
340 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
341 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
342 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
343 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
344 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
345 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
346 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
347 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
348 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
349 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
350 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
351 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
352 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
353 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
354 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
355 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
356 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
357 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
358 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
359 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
360 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
361 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
362 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
363 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
364 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
365 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
366 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
367 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
368 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
369 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
370 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
371 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
372 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
373 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
374 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
375 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
376 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
377 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
378 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
379 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
380 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 42.12
Metatranscriptomes 8.94
Isolates 48.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 38.59
Rhizoplane 3.29
Rhizosphere 43.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265320_10000363 3300031240 Bacteria 36831
2 JGI25152J39213_1000228 3300002773 Bacteria 37959
3 JGI25150J39212_1000002 3300002774 Bacteria 537631
4 JGI25151J46595_10000003 3300003187 Bacteria 715330
5 JGI25153J46596_10000003 3300003215 Bacteria 553253
6 Ga0065715_10140898 3300005293 Bacteria 1855
7 Ga0070689_100013044 3300005340 Bacteria 6004
8 Ga0070692_10165106 3300005345 Bacteria 1272
9 Ga0070675_100000005 3300005354 Bacteria 295918
10 Ga0070671_100075084 3300005355 Bacteria 2823
11 Ga0070673_100177165 3300005364 Bacteria 1823
12 Ga0070688_100008612 3300005365 Bacteria 5550
13 Ga0070711_100047941 3300005439 Bacteria 2919
14 Ga0070678_100360730 3300005456 Bacteria 1252
15 Ga0070698_100168021 3300005471 Bacteria 2135
16 Ga0070699_100185288 3300005518 Bacteria 1848
17 Ga0070684_100721210 3300005535 Bacteria 930
18 Ga0068856_100084625 3300005614 Bacteria 3150
19 Ga0068859_100275994 3300005617 Bacteria 1773
20 Ga0068859_100729265 3300005617 Bacteria 1081
21 Ga0068861_100022692 3300005719 Bacteria 4525
22 Ga0081455_10051268 3300005937 Bacteria 3541
23 Ga0070712_100552869 3300006175 Bacteria 970
24 Ga0097621_100018469 3300006237 Bacteria 5328
25 Ga0075428_100005629 3300006844 Bacteria 13922
26 Ga0075431_100002123 3300006847 Bacteria 18948
27 Ga0075436_100006354 3300006914 Bacteria 8097
28 Ga0097620_100276003 3300006931 Bacteria 1773
29 Ga0097620_100729304 3300006931 Bacteria 1081
30 Ga0079104_1025947 3300006946 Bacteria 1521
31 Ga0075435_100003288 3300007076 Bacteria 10955
32 Ga0105251_10033343 3300009011 Viruses 2558
33 Ga0105244_10024878 3300009036 Bacteria 3262
34 Ga0105240_10588978 3300009093 Bacteria 1226
35 Ga0111539_10105072 3300009094 Bacteria 3313
36 Ga0105247_10009380 3300009101 Bacteria 5943
37 Ga0105243_10019854 3300009148 Bacteria 5097
38 Ga0105238_10328684 3300009551 Bacteria 1515
39 Ga0157371_10072281 3300013102 Bacteria 2442
40 Ga0157370_10024895 3300013104 Bacteria 5925
41 Ga0157378_10013852 3300013297 Bacteria 7053
42 Ga0157375_10001982 3300013308 Bacteria 17680
43 Ga0163163_10133945 3300014325 Bacteria 2518
44 Ga0163163_10352247 3300014325 Bacteria 1528
45 Ga0157380_10119088 3300014326 Bacteria 2233
46 Ga0157379_10011704 3300014968 Bacteria 7659
47 Ga0157376_10024035 3300014969 Bacteria 4779
48 Ga0213873_10000002 3300021358 Bacteria 1164195
49 Ga0213872_10040716 3300021361 Bacteria 2121
50 Ga0213876_10000001 3300021384 Bacteria 1186326
51 Ga0207425_1000004 3300025245 Bacteria 1092421
52 Ga0209129_1000005 3300025258 Bacteria 777812
53 Ga0209025_1000009 3300025294 Bacteria 1092561
54 Ga0209758_1000010 3300025297 Bacteria 1092782
55 Ga0207713_1041937 3300025735 Viruses 1904
56 Ga0207693_10144090 3300025915 Bacteria 1873
57 Ga0207659_10000019 3300025926 Bacteria 152016
58 Ga0207644_10222778 3300025931 Bacteria 1496
59 Ga0207686_10002223 3300025934 Bacteria 10667
60 Ga0207709_10030999 3300025935 Bacteria 3117
61 Ga0207711_10280111 3300025941 Bacteria 1535
62 Ga0207678_10049388 3300026067 Bacteria 3636
63 Ga0207708_10205825 3300026075 Bacteria 1571
64 Ga0207675_100067952 3300026118 Bacteria 3331
65 Ga0207683_10109490 3300026121 Bacteria 2472
66 Ga0209281_1001243 3300027111 Bacteria 16710
67 Ga0268264_10605662 3300028381 Bacteria 1080
68 Ga0265337_1000628 3300028556 Bacteria 18684
69 Ga0265326_10004759 3300028558 Bacteria 4316
70 Ga0265319_1022610 3300028563 Bacteria 2288
71 Ga0265323_10046397 3300028653 Bacteria 1557
72 Ga0265338_10004514 3300028800 Bacteria 18770
73 Ga0265338_10027816 3300028800 Bacteria 5660
74 Ga0265338_10207998 3300028800 Bacteria 1471
75 Ga0265338_10439716 3300028800 Bacteria 924
76 Ga0265320_10066536 3300031240 Bacteria 1708
77 Ga0265327_10009233 3300031251 Bacteria 7152
78 Ga0265314_10160535 3300031711 Bacteria 1368
79 Ga0316576_10065681 3300031727 Bacteria 2667
80 Ga0307405_10145855 3300031731 Bacteria 1657
81 Ga0307412_10021652 3300031911 Bacteria 3930
82 Ga0307414_10139367 3300032004 Bacteria 1896
83 Ga0307415_100301427 3300032126 Bacteria 1328
84 Ga0316574_0008098 3300035398 Bacteria 5816
85 Ga0373935_0060520 3300035692 Bacteria 2423
86 Ga0373927_0023320 3300035695 Bacteria 4053
87 Ga0373947_0003671 3300035725 Bacteria 9052
88 Ga0373937_0248647 3300036401 Bacteria 1676
89 Ga0373925_0019498 3300037068 Bacteria 4934
90 Ga0395901_0193857 3300038443 Bacteria 2131
91 Ga0436365_0774883 3300039437 Bacteria 390569
92 Ga0436361_0599588 3300039447 Bacteria 19015
93 Ga0436362_0660519 3300039453 Bacteria 832172
94 Ga0439432_050828 3300042006 Bacteria 1293
95 Ga0451577_0000685 3300042876 Bacteria 53326
96 Ga0451577_0117349 3300042876 Bacteria 2384
97 Ga0466969_0001597 3300044656 Bacteria 12131
98 Ga0453683_0018675 3300044673 Bacteria 4450
99 Ga0453683_0161122 3300044673 Bacteria 1419
100 Ga0466966_0049519 3300044684 Bacteria 2676
101 Ga0466961_0000648 3300044693 Bacteria 21882
102 Ga0453684_0011030 3300044712 Bacteria 15266
103 Ga0453684_0556823 3300044712 Bacteria 1262
104 Ga0451576_0016385 3300045051 Bacteria 8182
105 Ga0495603_0002276 3300046455 Bacteria 11275
106 Ga0495590_0032029 3300046457 Bacteria 1839
107 Ga0495629_0069815 3300046459 Bacteria 2451
108 Ga0495580_0034869 3300046472 Bacteria 3620
109 Ga0495580_0140507 3300046472 Bacteria 1674
110 Ga0495594_0004341 3300046499 Bacteria 7295
111 Ga0495645_0045946 3300046543 Bacteria 3185
112 Ga0495667_0285530 3300046559 Bacteria 1047
113 Ga0495634_0008415 3300046642 Bacteria 7685
114 Ga0495634_0245524 3300046642 Bacteria 1097
115 Ga0495658_0001699 3300046683 Bacteria 11444
116 Ga0495613_0002986 3300046689 Bacteria 12661
117 Ga0495581_0003994 3300047315 Bacteria 8498
118 Ga0495604_0235729 3300047317 Bacteria 1254
119 Ga0495675_0217954 3300047444 Bacteria 1156
120 Ga0495684_0037954 3300047471 Bacteria 3695
121 Ga0495593_0018862 3300047673 Bacteria 3871
122 Ga0495614_0037065 3300048089 Bacteria 2092
123 Ga0496100_0012360 3300048903 Bacteria 4892
124 Ga0496100_0109119 3300048903 Bacteria 1920
125 Ga0496101_0001162 3300048904 Bacteria 15760
126 Ga0496102_0122694 3300048905 Bacteria 2427
127 Ga0496102_0528798 3300048905 Bacteria 1102
128 Ga0496103_0078552 3300048906 Bacteria 2073
129 Ga0496103_0156515 3300048906 Bacteria 1461
130 Ga0496104_0177666 3300048907 Bacteria 2039
131 Ga0496106_0005379 3300048909 Bacteria 9472
132 Ga0496108_0433233 3300048911 Bacteria 1148
133 Ga0496110_0160881 3300048913 Bacteria 2035
134 Ga0496114_0000528 3300048917 Bacteria 28153
135 Ga0496115_0000805 3300048918 Bacteria 22991
136 Ga0496116_0218198 3300048919 Bacteria 980
137 Ga0496117_0002529 3300048920 Bacteria 22887
138 Ga0496117_0043023 3300048920 Bacteria 3289
139 Ga0496118_0058043 3300048921 Bacteria 2896
140 Ga0496118_0199444 3300048921 Bacteria 1187
141 Ga0496119_0040205 3300048922 Bacteria 2994
142 Ga0496120_0029324 3300048923 Bacteria 3360
143 Ga0496121_0000003 3300048924 Bacteria 1191431
144 Ga0496122_0100700 3300048925 Bacteria 1932
145 Ga0496122_0128920 3300048925 Bacteria 1612
146 Ga0496123_0091509 3300048926 Bacteria 1803
147 Ga0496123_0315259 3300048926 Bacteria 740
148 Ga0496124_0000308 3300048927 Bacteria 90566
149 Ga0496124_0010846 3300048927 Bacteria 9175
150 Ga0496125_0000039 3300048928 Bacteria 318665
151 Ga0496126_0000589 3300048929 Bacteria 68753
152 Ga0496126_0009857 3300048929 Bacteria 10109
153 Ga0496126_0203109 3300048929 Bacteria 1672
154 Ga0501306_006735 3300049127 Bacteria 1358
155 Ga0501306_008024 3300049127 Bacteria 1279
156 Ga0501306_017867 3300049127 Bacteria 965
157 Ga0501343_002397 3300049132 Bacteria 1333
158 Ga0501343_005800 3300049132 Bacteria 954
159 Ga0501345_01915 3300049134 Bacteria 829
160 Ga0501305_004521 3300049161 Bacteria 1639
161 Ga0501305_009127 3300049161 Bacteria 1297
162 Ga0501312_001277 3300049528 Bacteria 2425
163 Ga0501312_010214 3300049528 Bacteria 1252
164 Ga0501312_016895 3300049528 Bacteria 1049
165 Ga0501313_002224 3300049529 Bacteria 1817
166 Ga0501313_004651 3300049529 Bacteria 1419
167 Ga0501313_013203 3300049529 Bacteria 968
168 Ga0501314_009699 3300049530 Bacteria 888
169 Ga0501315_005807 3300049531 Bacteria 1351
170 Ga0501316_000751 3300049532 Bacteria 2451
171 Ga0501316_011115 3300049532 Bacteria 1034
172 Ga0501316_016551 3300049532 Bacteria 897
173 Ga0501317_005571 3300049533 Bacteria 1354
174 Ga0501317_014165 3300049533 Bacteria 1007
175 Ga0501317_020465 3300049533 Bacteria 892
176 Ga0501318_001926 3300049534 Bacteria 1726
177 Ga0501320_003922 3300049536 Bacteria 1286
178 Ga0501321_004347 3300049537 Bacteria 1350
179 Ga0501323_012779 3300049539 Bacteria 1029
180 Ga0501325_010375 3300049541 Bacteria 843
181 Ga0501327_03889 3300049543 Bacteria 839
182 Ga0501332_00692 3300049548 Bacteria 1572
183 Ga0501332_01192 3300049548 Bacteria 1324
184 Ga0501334_03143 3300049550 Bacteria 1014
185 Ga0501334_04287 3300049550 Bacteria 912
186 Ga0501335_003334 3300049551 Bacteria 1356
187 Ga0501335_012858 3300049551 Bacteria 832
188 Ga0501335_013015 3300049551 Bacteria 828
189 Ga0501336_001835 3300049552 Bacteria 1316
190 Ga0501337_001452 3300049553 Bacteria 1358
191 Ga0501338_05799 3300049554 Bacteria 771
192 Ga0501032_0036839 3300049569 Bacteria 3338
193 Ga0501034_0393347 3300049571 Bacteria 1310
194 Ga0501034_0741643 3300049571 Bacteria 878
195 Ga0501036_0018302 3300049572 Bacteria 5866
196 Ga0501038_0351367 3300049574 Bacteria 1148
197 Ga0501040_0272367 3300049576 Bacteria 1209
198 Ga0501047_0369823 3300049581 Bacteria 1269
199 Ga0501047_0560399 3300049581 Bacteria 966
200 Ga0501223_001271 3300049663 Bacteria 5868
201 Ga0501079_0110891 3300049741 Bacteria 2132
202 Ga0501035_0002413 3300049822 Bacteria 18309
203 Ga0501044_0029661 3300049823 Bacteria 5767
204 Ga0501044_0458312 3300049823 Bacteria 1181
205 Ga0501044_0541970 3300049823 Bacteria 1061
206 nmdc:mga06r32_521_c1 3300050510 Bacteria 33157
207 nmdc:mga08y16_138968_c1 3300050511 Bacteria 2525
208 nmdc:mga08y16_321507_c1 3300050511 Bacteria 1593
209 nmdc:mga0rr50_12145_c1 3300050513 Bacteria 5552
210 nmdc:mga0rr50_37_c1 3300050513 Bacteria 87211
211 nmdc:mga08x19_276_c1 3300050514 Bacteria 38795
212 Ga0495601_0008166 3300053077 Bacteria 6173
213 Ga0495655_0000585 3300053083 Bacteria 5978
214 Ga0500562_004943 3300053108 Bacteria 3361
215 Ga0500607_058402 3300053121 Bacteria 2030
216 Ga0500634_0000230 3300053161 Bacteria 18142
217 Ga0590077_009155 3300059426 Bacteria 2029
218 2510304412 2510065057 Bacteria 6649661
219 2511389793 2511231027 Bacteria 5013807
220 2511502186 2511231052 Bacteria 6974333
221 2513588094 2513237086 Bacteria 7265287
222 2513617961 2513237091 Bacteria 6900273
223 2513885527 2513237140 Bacteria 7076289
224 2513903303 2513237143 Bacteria 6664116
225 2515608965 2515154107 Bacteria 6795637
226 2516204095 2516143018 Bacteria 6951533
227 2516893565 2516653046 Bacteria 6989037
228 2551674600 2551306084 Bacteria 8942552
229 2551675818 2551306084 Bacteria 8942552
230 2551684198 2551306085 Bacteria 7347181
231 2551694574 2551306086 Bacteria 6843938
232 2551703351 2551306087 Bacteria 7351905
233 2551708432 2551306089 Bacteria 7162724
234 2551723923 2551306090 Bacteria 7953713
235 2551724814 2551306091 Bacteria 7086830
236 2551746459 2551306093 Bacteria 7064773
237 2644107345 2643221618 Bacteria 7717186
238 2644150912 2643221626 Bacteria 8069654
239 2644308740 2643221655 Bacteria 7722067
240 2644335557 2643221659 Bacteria 7890716
241 2644491982 2643221688 Bacteria 5260751
242 2644539963 2643221698 Bacteria 7756764
243 2644614681 2643221712 Bacteria 7729434
244 2692315593 2690316117 Bacteria 6800650
245 2712471001 2711768156 Bacteria 4471618
246 2723876965 2721755763 Bacteria 4464185
247 2738814163 2738541295 Bacteria 5730091
248 2753461976 2751185821 Bacteria 6189929
249 2770195381 2767802442 Bacteria 5747986
250 2776270677 2775506902 Bacteria 6208009
251 2776280500 2775506904 Bacteria 5954060
252 2792626190 2791355092 Bacteria 6248105
253 2793404254 2791355275 Bacteria 4429597
254 2808916031 2808606375 Bacteria 9466072
255 2837654431 2837651117 Bacteria 3772164
256 2840767473 2840764183 Bacteria 6358399
257 2842871891 2842871566 Bacteria 4827117
258 2843694577 2843690924 Bacteria 5169057
259 2844166624 2844163670 Bacteria 7266046
260 2846034946 2846033681 Bacteria 4377894
261 2846040623 2846037992 Bacteria 4526407
262 2847419349 2847417321 Bacteria 6913799
263 2855826287 2855825444 Bacteria 6785811
264 2855841632 2855839649 Bacteria 7135830
265 2855876114 2855872281 Bacteria 6964271
266 2857631178 2857627736 Bacteria 5625397
267 2858801748 2858800743 Bacteria 6603254
268 2894656047 2894652903 Bacteria 4587256
269 2894820323 2894817345 Bacteria 4892941
270 2896388119 2896384573 Bacteria 7700774
271 2904580677 2904578770 Bacteria 5302906
272 2913299371 2913295892 Bacteria 6333755
273 2915989434 2915986958 Bacteria 6739310
274 2915998102 2915993759 Bacteria 7016183
275 2916006877 2916000859 Bacteria 6865702
276 2916013831 2916007675 Bacteria 6898660
277 2916017563 2916014648 Bacteria 6946486
278 2916025066 2916021584 Bacteria 6854472
279 2916029202 2916028427 Bacteria 6748433
280 2916041640 2916035215 Bacteria 6755766
281 2916044026 2916041962 Bacteria 6820487
282 2916054207 2916048683 Bacteria 6543552
283 2916061725 2916055098 Bacteria 6758838
284 2916070350 2916068649 Bacteria 6943657
285 2916077780 2916076590 Bacteria 6596108
286 2919121609 2919119836 Bacteria 5208557
287 2921205143 2921201388 Bacteria 6926299
288 2921214533 2921208531 Bacteria 6745326
289 2921239580 2921237296 Bacteria 6876710
290 2921245419 2921244191 Bacteria 6568419
291 2921261244 2921257292 Bacteria 6808382
292 2921264445 2921263974 Bacteria 6864552
293 2921285882 2921282425 Bacteria 6826397
294 2921289431 2921289301 Bacteria 7316391
295 2921302073 2921296804 Bacteria 7176999
296 2924148416 2924144063 Bacteria 6883928
297 2924158044 2924150972 Bacteria 7169444
298 2924159222 2924158325 Bacteria 7188855
299 2924166741 2924165586 Bacteria 7260590
300 2924174337 2924172951 Bacteria 6749356
301 2924183735 2924179722 Bacteria 6843264
302 2924188304 2924186466 Bacteria 6876637
303 2924197969 2924193448 Bacteria 6955718
304 2924204731 2924200457 Bacteria 6757188
305 2924211477 2924207177 Bacteria 6917007
306 2924225763 2924221636 Bacteria 7113495
307 2924233040 2924228884 Bacteria 6633132
308 2928523822 2928521798 Bacteria 4960112
309 2929140812 2929138655 Bacteria 5810547
310 2936999665 2936996657 Bacteria 6298727
311 2937007374 2937002841 Bacteria 6934057
312 2937012896 2937009748 Bacteria 6746052
313 2937022572 2937016420 Bacteria 6782579
314 2937026907 2937023124 Bacteria 6815156
315 2937045609 2937042894 Bacteria 6741576
316 2937053655 2937049772 Bacteria 6757901
317 2937063378 2937056579 Bacteria 7107896
318 2937070705 2937063883 Bacteria 7199456
319 2937071697 2937071275 Bacteria 6984483
320 2937098175 2937091812 Bacteria 6979387
321 2937102548 2937098957 Bacteria 7249374
322 2937109216 2937106411 Bacteria 6947143
323 2937124066 2937119839 Bacteria 6597547
324 2937130610 2937126314 Bacteria 6771275
325 2941502194 2941499720 Bacteria 7599444
326 2952254447 2952252522 Bacteria 4171745
327 2954016107 2954011201 Bacteria 4762601
328 2957383405 2957382221 Bacteria 6737050
329 2957392933 2957388812 Bacteria 6778072
330 2957395951 2957395598 Bacteria 6822399
331 2957406684 2957402308 Bacteria 6741770
332 2957410745 2957408893 Bacteria 6558585
333 2957423694 2957422303 Bacteria 7172205
334 2957434326 2957430029 Bacteria 7022557
335 2957454749 2957450854 Bacteria 6765715
336 2957461957 2957457609 Bacteria 6967680
337 2957468667 2957464669 Bacteria 6568877
338 2957476443 2957471148 Bacteria 6797643
339 2957484702 2957478035 Bacteria 6756658
340 2957488677 2957484790 Bacteria 6703082
341 2957496946 2957491536 Bacteria 6695180
342 2957503255 2957498199 Bacteria 7126688
343 2957510560 2957505466 Bacteria 7253085
344 2960587481 2960584000 Bacteria 6864594
345 2960602469 2960597568 Bacteria 6550735
346 2960606426 2960603979 Bacteria 6898737
347 2960612372 2960610863 Bacteria 6691244
348 2960630808 2960624210 Bacteria 6875384
349 2960638617 2960637947 Bacteria 7296468
350 2960649986 2960645483 Bacteria 7211087
351 2960654503 2960652885 Bacteria 7083688
352 2960671755 2960667422 Bacteria 6763020
353 2960678324 2960674078 Bacteria 6609048
354 2960692169 2960687367 Bacteria 6535474
355 2964614481 2964607997 Bacteria 7101408
356 2964621086 2964615318 Bacteria 6809089
357 2964625703 2964621998 Bacteria 6834995
358 2964632964 2964628898 Bacteria 7083044
359 2964640170 2964636051 Bacteria 7091832
360 2964646860 2964643177 Bacteria 6820887
361 2964655364 2964649959 Bacteria 6675118
362 2964663197 2964656573 Bacteria 7100150
363 2964668274 2964663802 Bacteria 7019362
364 2964676061 2964670856 Bacteria 6851364
365 2964681570 2964678106 Bacteria 6792020
366 2964691366 2964685014 Bacteria 6839111
367 2964698300 2964691889 Bacteria 6802758
368 2964705074 2964698721 Bacteria 6765331
369 2964709852 2964705432 Bacteria 7114648
370 2964716502 2964712639 Bacteria 6695970
371 2964721560 2964719344 Bacteria 7286602
372 2967666444 2967664464 Bacteria 6948836
373 2967675886 2967671571 Bacteria 7021409
374 2967684480 2967678726 Bacteria 7264382
375 2967699796 2967693043 Bacteria 6804451
376 2967704913 2967699805 Bacteria 6854538
377 2967711522 2967706974 Bacteria 7186053
378 2967714819 2967714385 Bacteria 7000047
379 2967725787 2967721400 Bacteria 7073753
380 2967738835 2967735183 Bacteria 6827012
381 2967745241 2967742019 Bacteria 6794534
382 2967753543 2967748971 Bacteria 6733771
383 2967758979 2967755722 Bacteria 6814706
384 2967768504 2967762386 Bacteria 6923502
385 2967773872 2967769361 Bacteria 6587838
386 2967777940 2967775926 Bacteria 6738189
387 2970023469 2970019648 Bacteria 7072033
388 2970040235 2970033650 Bacteria 7118744
389 2970042107 2970040964 Bacteria 6731123
390 2970053990 2970047711 Bacteria 7088379
391 2970059309 2970054988 Bacteria 6611507
392 2970065634 2970061556 Bacteria 7099761
393 2970075467 2970068827 Bacteria 7123112
394 2970080217 2970076120 Bacteria 6697332
395 2970087757 2970082768 Bacteria 6183754
396 2970093244 2970088815 Bacteria 6933825
397 2970100095 2970095765 Bacteria 6936963
398 2970108054 2970102677 Bacteria 6812532
399 2970113909 2970109326 Bacteria 6863976
400 2970117300 2970116247 Bacteria 6501857
401 2970133226 2970129317 Bacteria 6806560
402 2970140483 2970136068 Bacteria 7207982
403 2970155992 2970149975 Bacteria 6779706
404 2970161068 2970156795 Bacteria 7168044
405 2970168453 2970164137 Bacteria 6861252
406 2970171881 2970170962 Bacteria 6876229
407 2970182871 2970177841 Bacteria 6768001
408 2970188722 2970184632 Bacteria 7054431
409 2970196341 2970191845 Bacteria 7032787
410 2977518454 2977516862 Bacteria 6940108
411 2977541996 2977537788 Bacteria 6929320
412 2977558377 2977551784 Bacteria 7125765
413 2977562704 2977558990 Bacteria 6863948
414 2977570247 2977565890 Bacteria 6901543
415 2977577048 2977572785 Bacteria 6763888
416 2977583601 2977579622 Bacteria 6772100
417 2989349580 2989349275 Bacteria 6349068
418 2989774228 2989771324 Bacteria 5605128
419 2998345966 2998344455 Bacteria 4222996
420 3002144705 3002141150 Bacteria 5254435
421 3003933962 3003930520 Bacteria 5667563
422 648740516 648276728 Bacteria 6968865
423 8003994108 8003992118 Bacteria 7266902
424 8054462923 8054460903 Bacteria 4872905
425 8057163093 8057160832 Bacteria 3268302
426 Ga0265320_10000363
427 JGI25152J39213_1000228
428 JGI25150J39212_1000002
429 JGI25151J46595_10000003
430 JGI25153J46596_10000003
431 Ga0065715_10140898
432 Ga0070689_100013044
433 Ga0070692_10165106
434 Ga0070675_100000005
435 Ga0070671_100075084
436 Ga0070673_100177165
437 Ga0070688_100008612
438 Ga0070711_100047941
439 Ga0070678_100360730
440 Ga0070698_100168021
441 Ga0070699_100185288
442 Ga0070684_100721210
443 Ga0068856_100084625
444 Ga0068859_100275994
445 Ga0068859_100729265
446 Ga0068861_100022692
447 Ga0081455_10051268
448 Ga0070712_100552869
449 Ga0097621_100018469
450 Ga0075428_100005629
451 Ga0075431_100002123
452 Ga0075436_100006354
453 Ga0097620_100276003
454 Ga0097620_100729304
455 Ga0079104_1025947
456 Ga0075435_100003288
457 Ga0105251_10033343
458 Ga0105244_10024878
459 Ga0105240_10588978
460 Ga0111539_10105072
461 Ga0105247_10009380
462 Ga0105243_10019854
463 Ga0105238_10328684
464 Ga0157371_10072281
465 Ga0157370_10024895
466 Ga0157378_10013852
467 Ga0157375_10001982
468 Ga0163163_10133945
469 Ga0163163_10352247
470 Ga0157380_10119088
471 Ga0157379_10011704
472 Ga0157376_10024035
473 Ga0213873_10000002
474 Ga0213872_10040716
475 Ga0213876_10000001
476 Ga0207425_1000004
477 Ga0209129_1000005
478 Ga0209025_1000009
479 Ga0209758_1000010
480 Ga0207713_1041937
481 Ga0207693_10144090
482 Ga0207659_10000019
483 Ga0207644_10222778
484 Ga0207686_10002223
485 Ga0207709_10030999
486 Ga0207711_10280111
487 Ga0207678_10049388
488 Ga0207708_10205825
489 Ga0207675_100067952
490 Ga0207683_10109490
491 Ga0209281_1001243
492 Ga0268264_10605662
493 Ga0265337_1000628
494 Ga0265326_10004759
495 Ga0265319_1022610
496 Ga0265323_10046397
497 Ga0265338_10004514
498 Ga0265338_10027816
499 Ga0265338_10207998
500 Ga0265338_10439716
501 Ga0265320_10066536
502 Ga0265327_10009233
503 Ga0265314_10160535
504 Ga0316576_10065681
505 Ga0307405_10145855
506 Ga0307412_10021652
507 Ga0307414_10139367
508 Ga0307415_100301427
509 Ga0316574_0008098
510 Ga0373935_0060520
511 Ga0373927_0023320
512 Ga0373947_0003671
513 Ga0373937_0248647
514 Ga0373925_0019498
515 Ga0395901_0193857
516 Ga0436365_0774883
517 Ga0436361_0599588
518 Ga0436362_0660519
519 Ga0439432_050828
520 Ga0451577_0000685
521 Ga0451577_0117349
522 Ga0466969_0001597
523 Ga0453683_0018675
524 Ga0453683_0161122
525 Ga0466966_0049519
526 Ga0466961_0000648
527 Ga0453684_0011030
528 Ga0453684_0556823
529 Ga0451576_0016385
530 Ga0495603_0002276
531 Ga0495590_0032029
532 Ga0495629_0069815
533 Ga0495580_0034869
534 Ga0495580_0140507
535 Ga0495594_0004341
536 Ga0495645_0045946
537 Ga0495667_0285530
538 Ga0495634_0008415
539 Ga0495634_0245524
540 Ga0495658_0001699
541 Ga0495613_0002986
542 Ga0495581_0003994
543 Ga0495604_0235729
544 Ga0495675_0217954
545 Ga0495684_0037954
546 Ga0495593_0018862
547 Ga0495614_0037065
548 Ga0496100_0012360
549 Ga0496100_0109119
550 Ga0496101_0001162
551 Ga0496102_0122694
552 Ga0496102_0528798
553 Ga0496103_0078552
554 Ga0496103_0156515
555 Ga0496104_0177666
556 Ga0496106_0005379
557 Ga0496108_0433233
558 Ga0496110_0160881
559 Ga0496114_0000528
560 Ga0496115_0000805
561 Ga0496116_0218198
562 Ga0496117_0002529
563 Ga0496117_0043023
564 Ga0496118_0058043
565 Ga0496118_0199444
566 Ga0496119_0040205
567 Ga0496120_0029324
568 Ga0496121_0000003
569 Ga0496122_0100700
570 Ga0496122_0128920
571 Ga0496123_0091509
572 Ga0496123_0315259
573 Ga0496124_0000308
574 Ga0496124_0010846
575 Ga0496125_0000039
576 Ga0496126_0000589
577 Ga0496126_0009857
578 Ga0496126_0203109
579 Ga0501306_006735
580 Ga0501306_008024
581 Ga0501306_017867
582 Ga0501343_002397
583 Ga0501343_005800
584 Ga0501345_01915
585 Ga0501305_004521
586 Ga0501305_009127
587 Ga0501312_001277
588 Ga0501312_010214
589 Ga0501312_016895
590 Ga0501313_002224
591 Ga0501313_004651
592 Ga0501313_013203
593 Ga0501314_009699
594 Ga0501315_005807
595 Ga0501316_000751
596 Ga0501316_011115
597 Ga0501316_016551
598 Ga0501317_005571
599 Ga0501317_014165
600 Ga0501317_020465
601 Ga0501318_001926
602 Ga0501320_003922
603 Ga0501321_004347
604 Ga0501323_012779
605 Ga0501325_010375
606 Ga0501327_03889
607 Ga0501332_00692
608 Ga0501332_01192
609 Ga0501334_03143
610 Ga0501334_04287
611 Ga0501335_003334
612 Ga0501335_012858
613 Ga0501335_013015
614 Ga0501336_001835
615 Ga0501337_001452
616 Ga0501338_05799
617 Ga0501032_0036839
618 Ga0501034_0393347
619 Ga0501034_0741643
620 Ga0501036_0018302
621 Ga0501038_0351367
622 Ga0501040_0272367
623 Ga0501047_0369823
624 Ga0501047_0560399
625 Ga0501223_001271
626 Ga0501079_0110891
627 Ga0501035_0002413
628 Ga0501044_0029661
629 Ga0501044_0458312
630 Ga0501044_0541970
631 nmdc:mga06r32_521_c1
632 nmdc:mga08y16_138968_c1
633 nmdc:mga08y16_321507_c1
634 nmdc:mga0rr50_12145_c1
635 nmdc:mga0rr50_37_c1
636 nmdc:mga08x19_276_c1
637 Ga0495601_0008166
638 Ga0495655_0000585
639 Ga0500562_004943
640 Ga0500607_058402
641 Ga0500634_0000230
642 Ga0590077_009155
643 2510304412
644 2511389793
645 2511502186
646 2513588094
647 2513617961
648 2513885527
649 2513903303
650 2515608965
651 2516204095
652 2516893565
653 2551674600
654 2551675818
655 2551684198
656 2551694574
657 2551703351
658 2551708432
659 2551723923
660 2551724814
661 2551746459
662 2644107345
663 2644150912
664 2644308740
665 2644335557
666 2644491982
667 2644539963
668 2644614681
669 2692315593
670 2712471001
671 2723876965
672 2738814163
673 2753461976
674 2770195381
675 2776270677
676 2776280500
677 2792626190
678 2793404254
679 2808916031
680 2837654431
681 2840767473
682 2842871891
683 2843694577
684 2844166624
685 2846034946
686 2846040623
687 2847419349
688 2855826287
689 2855841632
690 2855876114
691 2857631178
692 2858801748
693 2894656047
694 2894820323
695 2896388119
696 2904580677
697 2913299371
698 2915989434
699 2915998102
700 2916006877
701 2916013831
702 2916017563
703 2916025066
704 2916029202
705 2916041640
706 2916044026
707 2916054207
708 2916061725
709 2916070350
710 2916077780
711 2919121609
712 2921205143
713 2921214533
714 2921239580
715 2921245419
716 2921261244
717 2921264445
718 2921285882
719 2921289431
720 2921302073
721 2924148416
722 2924158044
723 2924159222
724 2924166741
725 2924174337
726 2924183735
727 2924188304
728 2924197969
729 2924204731
730 2924211477
731 2924225763
732 2924233040
733 2928523822
734 2929140812
735 2936999665
736 2937007374
737 2937012896
738 2937022572
739 2937026907
740 2937045609
741 2937053655
742 2937063378
743 2937070705
744 2937071697
745 2937098175
746 2937102548
747 2937109216
748 2937124066
749 2937130610
750 2941502194
751 2952254447
752 2954016107
753 2957383405
754 2957392933
755 2957395951
756 2957406684
757 2957410745
758 2957423694
759 2957434326
760 2957454749
761 2957461957
762 2957468667
763 2957476443
764 2957484702
765 2957488677
766 2957496946
767 2957503255
768 2957510560
769 2960587481
770 2960602469
771 2960606426
772 2960612372
773 2960630808
774 2960638617
775 2960649986
776 2960654503
777 2960671755
778 2960678324
779 2960692169
780 2964614481
781 2964621086
782 2964625703
783 2964632964
784 2964640170
785 2964646860
786 2964655364
787 2964663197
788 2964668274
789 2964676061
790 2964681570
791 2964691366
792 2964698300
793 2964705074
794 2964709852
795 2964716502
796 2964721560
797 2967666444
798 2967675886
799 2967684480
800 2967699796
801 2967704913
802 2967711522
803 2967714819
804 2967725787
805 2967738835
806 2967745241
807 2967753543
808 2967758979
809 2967768504
810 2967773872
811 2967777940
812 2970023469
813 2970040235
814 2970042107
815 2970053990
816 2970059309
817 2970065634
818 2970075467
819 2970080217
820 2970087757
821 2970093244
822 2970100095
823 2970108054
824 2970113909
825 2970117300
826 2970133226
827 2970140483
828 2970155992
829 2970161068
830 2970168453
831 2970171881
832 2970182871
833 2970188722
834 2970196341
835 2977518454
836 2977541996
837 2977558377
838 2977562704
839 2977570247
840 2977577048
841 2977583601
842 2989349580
843 2989774228
844 2998345966
845 3002144705
846 3003933962
847 648740516
848 8003994108
849 8054462923
850 8057163093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

301

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ix6-assembly1.cif.gz_A crystal structure of thymidylate synthase thya from brucella melitensis 0.9872 1 251
3ix6-assembly1.cif.gz_A crystal structure of thymidylate synthase thya from brucella melitensis 0.9832 1 251
3b5b-assembly1.cif.gz_B crystal structure of the thymidylate synthase k48q 0.9809 1 264
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9809 3 262
1nce-assembly1.cif.gz_B crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 0.9806 3 264
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9785 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9741 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9672 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9655 2 262 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9513 2 251 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9908 119 249
AF-A0A2E8YSB0-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9902 145 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9899 99 229 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A059WNC8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9885 116 240 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A352HMS8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9883 151 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map