F440937

General Info

Members Datasets Scaffolds Average Seq Length
425 247 850 97

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100369805|Ga0070672_1003698052
Length 112
Sequence VSAPKIDAEGVTNPSIDDLLTKTDSKYKLVLYSAKRARQINAYYSQLGEGLLEYVGPLVDTHVQEKPLSIALREINEDLLTCEDIDPEEAAAEALATAVPSPATPAAEPTVE

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
92 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
107 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
120 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
121 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
133 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
231 2643221576 Nocardioides sp. Root614 Isolate Unclassified
232 2643221590 Nocardioides sp. Root682 Isolate Unclassified
233 2643221604 Nocardioides sp. Root190 Isolate Unclassified
234 2643221617 Nocardioides sp. Root79 Isolate Unclassified
235 2643221620 Nocardioides sp. Root240 Isolate Unclassified
236 2643221641 Nocardioides sp. Root122 Isolate Unclassified
237 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
238 2738541305 Nocardioides sp. CF167 Isolate Unclassified
239 2739367898 Nocardioides sp. CF479 Isolate Unclassified
240 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
241 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
242 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
243 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
244 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
245 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
246 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
247 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.88
Metatranscriptomes 9.88
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 9.41
Nodule 0.24
Rhizoplane 6.12
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100369805 3300005543 Bacteria 1225
2 Ga0006778J45830_1016744 3300003162 Bacteria 524
3 Ga0006778J45830_1035498 3300003162 Bacteria 570
4 Ga0006759J45824_1014488 3300003163 Bacteria 519
5 JGI25406J46586_10010559 3300003203 Bacteria 4093
6 Ga0006562J51391_1033460 3300003578 Bacteria 1480
7 Ga0006562J51391_1033461 3300003578 Bacteria 2920
8 Ga0007429J51699_1014395 3300003579 Bacteria 537
9 Ga0032354_1032104 3300003693 Bacteria 836
10 Ga0058860_12063614 3300004801 Bacteria 513
11 Ga0070683_100394415 3300005329 Bacteria 1320
12 Ga0070670_101826828 3300005331 Bacteria 560
13 Ga0070668_101035345 3300005347 Bacteria 739
14 Ga0070671_100816089 3300005355 Bacteria 813
15 Ga0070674_100611617 3300005356 Bacteria 922
16 Ga0070674_100655548 3300005356 Bacteria 893
17 Ga0070674_101480823 3300005356 Bacteria 610
18 Ga0070659_100070023 3300005366 Bacteria 2785
19 Ga0070659_100915954 3300005366 Bacteria 767
20 Ga0070667_100893840 3300005367 Bacteria 827
21 Ga0070700_100424429 3300005441 Bacteria 1006
22 Ga0070700_100794213 3300005441 Bacteria 762
23 Ga0070700_100899766 3300005441 Bacteria 721
24 Ga0070678_100436828 3300005456 Bacteria 1144
25 Ga0070678_101953799 3300005456 Bacteria 554
26 Ga0070662_100580270 3300005457 Bacteria 942
27 Ga0070681_11625435 3300005458 Bacteria 572
28 Ga0068867_100333406 3300005459 Bacteria 1261
29 Ga0068867_100886763 3300005459 Bacteria 802
30 Ga0070685_10853858 3300005466 Bacteria 675
31 Ga0070699_100070177 3300005518 Bacteria 3046
32 Ga0070684_100792631 3300005535 Bacteria 886
33 Ga0070686_101740919 3300005544 Bacteria 530
34 Ga0070665_101341880 3300005548 Bacteria 725
35 Ga0070665_101452177 3300005548 Bacteria 695
36 Ga0070704_101873315 3300005549 Bacteria 556
37 Ga0068857_100507166 3300005577 Bacteria 1133
38 Ga0068856_101212418 3300005614 Bacteria 771
39 Ga0068852_100575307 3300005616 Bacteria 1129
40 Ga0068852_100636964 3300005616 Bacteria 1073
41 Ga0068852_101136675 3300005616 Bacteria 801
42 Ga0068859_101501965 3300005617 Bacteria 744
43 Ga0068864_101964601 3300005618 Bacteria 591
44 Ga0068861_100929947 3300005719 Bacteria 825
45 Ga0068861_101029190 3300005719 Bacteria 788
46 Ga0068870_10112372 3300005840 Bacteria 1557
47 Ga0068870_10391842 3300005840 Bacteria 902
48 Ga0068870_11380544 3300005840 Bacteria 515
49 Ga0068858_101393093 3300005842 Bacteria 691
50 Ga0068860_100000696 3300005843 Bacteria 38651
51 Ga0081455_10355669 3300005937 Bacteria 1031
52 Ga0081538_10004407 3300005981 Bacteria 12986
53 Ga0081538_10225967 3300005981 Bacteria 737
54 Ga0081539_10001125 3300005985 Bacteria 48453
55 Ga0075365_10295718 3300006038 Bacteria 1139
56 Ga0075365_10351288 3300006038 Bacteria 1039
57 Ga0075368_10003670 3300006042 Bacteria 5149
58 Ga0075364_10012417 3300006051 Bacteria 5209
59 Ga0075364_10047542 3300006051 Bacteria 2795
60 Ga0075364_10080837 3300006051 Bacteria 2148
61 Ga0075364_10127022 3300006051 Bacteria 1710
62 Ga0075364_10298926 3300006051 Bacteria 1096
63 Ga0075432_10403570 3300006058 Bacteria 591
64 Ga0075362_10702113 3300006177 Bacteria 528
65 Ga0075367_10020586 3300006178 Bacteria 3677
66 Ga0075367_10027074 3300006178 Bacteria 3258
67 Ga0075367_10195962 3300006178 Bacteria 1261
68 Ga0075370_10196440 3300006353 Bacteria 1190
69 Ga0075370_10431042 3300006353 Bacteria 792
70 Ga0097620_101501985 3300006931 Bacteria 744
71 Ga0075435_101058186 3300007076 Bacteria 709
72 Ga0111539_12882134 3300009094 Bacteria 557
73 Ga0105243_11127879 3300009148 Bacteria 794
74 Ga0105243_11136071 3300009148 Bacteria 791
75 Ga0105243_12262047 3300009148 Bacteria 581
76 Ga0105241_11849812 3300009174 Bacteria 590
77 Ga0105238_10723929 3300009551 Bacteria 1008
78 Ga0105249_10356478 3300009553 Bacteria 1483
79 Ga0105246_11238519 3300011119 Bacteria 689
80 Ga0105246_11528175 3300011119 Bacteria 628
81 Ga0105246_11701284 3300011119 Bacteria 599
82 Ga0157340_1011981 3300012473 Bacteria 632
83 Ga0157373_10498765 3300013100 Bacteria 879
84 Ga0157371_11352612 3300013102 Bacteria 552
85 Ga0157372_10999286 3300013307 Bacteria 969
86 Ga0157372_11567061 3300013307 Bacteria 758
87 Ga0157372_12280005 3300013307 Bacteria 622
88 Ga0157375_10343003 3300013308 Bacteria 1659
89 Ga0157375_11602825 3300013308 Bacteria 770
90 Ga0157375_12150682 3300013308 Bacteria 664
91 Ga0163163_12958518 3300014325 Bacteria 530
92 Ga0157380_11130771 3300014326 Bacteria 824
93 Ga0182007_10368607 3300015262 Bacteria 543
94 Ga0197907_10012661 3300020069 Bacteria 834
95 Ga0197907_11006598 3300020069 Bacteria 901
96 Ga0206356_10268958 3300020070 Bacteria 708
97 Ga0206351_10507852 3300020077 Bacteria 789
98 Ga0206350_10032790 3300020080 Bacteria 777
99 Ga0206354_10728162 3300020081 Bacteria 959
100 Ga0206353_10217021 3300020082 Bacteria 677
101 Ga0206353_11824255 3300020082 Bacteria 649
102 Ga0224712_10144035 3300022467 Bacteria 1051
103 Ga0207688_10657734 3300025901 Bacteria 662
104 Ga0207647_10052109 3300025904 Bacteria 2527
105 Ga0207657_10026283 3300025919 Bacteria 5352
106 Ga0207657_10078433 3300025919 Bacteria 2781
107 Ga0207652_10340334 3300025921 Bacteria 1354
108 Ga0207694_11360604 3300025924 Bacteria 600
109 Ga0207687_10151944 3300025927 Bacteria 1768
110 Ga0207664_10064457 3300025929 Bacteria 2931
111 Ga0207690_10117826 3300025932 Bacteria 1923
112 Ga0207690_10157918 3300025932 Bacteria 1688
113 Ga0207690_10720493 3300025932 Bacteria 821
114 Ga0207709_10312134 3300025935 Bacteria 1173
115 Ga0207709_10654872 3300025935 Bacteria 836
116 Ga0207669_10257552 3300025937 Bacteria 1303
117 Ga0207704_10432338 3300025938 Bacteria 1046
118 Ga0207661_10533730 3300025944 Bacteria 1074
119 Ga0207661_10732535 3300025944 Bacteria 910
120 Ga0207658_10020723 3300025986 Bacteria 4554
121 Ga0207658_10645858 3300025986 Bacteria 953
122 Ga0207678_11915226 3300026067 Bacteria 517
123 Ga0207708_11639082 3300026075 Bacteria 565
124 Ga0207648_11016443 3300026089 Bacteria 777
125 Ga0207674_10268287 3300026116 Bacteria 1654
126 Ga0207674_10485350 3300026116 Bacteria 1194
127 Ga0207675_100302868 3300026118 Bacteria 1557
128 Ga0207698_10654068 3300026142 Bacteria 1041
129 Ga0209813_10150983 3300027866 Bacteria 832
130 Ga0268266_12361287 3300028379 Bacteria 503
131 Ga0268264_10000697 3300028381 Bacteria 39075
132 Ga0268264_10882762 3300028381 Bacteria 897
133 Ga0316176_1128013 3300030732 Bacteria 711
134 Ga0316176_1202052 3300030732 Bacteria 2053
135 Ga0316181_1096648 3300030744 Bacteria 2585
136 Ga0316576_10024282 3300031727 Bacteria 4231
137 Ga0316576_10089364 3300031727 Bacteria 2294
138 Ga0316578_10219125 3300031728 Bacteria 1144
139 Ga0316578_10473400 3300031728 Bacteria 739
140 Ga0307405_10063499 3300031731 Bacteria 2343
141 Ga0307413_10093115 3300031824 Bacteria 1969
142 Ga0307413_10341209 3300031824 Bacteria 1152
143 Ga0307410_10013105 3300031852 Bacteria 4825
144 Ga0307410_10044553 3300031852 Bacteria 2948
145 Ga0307410_10480110 3300031852 Bacteria 1019
146 Ga0307410_10633256 3300031852 Bacteria 895
147 Ga0307406_10065228 3300031901 Bacteria 2366
148 Ga0307406_10205865 3300031901 Bacteria 1452
149 Ga0307406_11844066 3300031901 Bacteria 538
150 Ga0307407_10689746 3300031903 Bacteria 768
151 Ga0307407_11053421 3300031903 Bacteria 630
152 Ga0307412_11921700 3300031911 Bacteria 546
153 Ga0307409_100002918 3300031995 Bacteria 9084
154 Ga0307409_100022274 3300031995 Bacteria 4364
155 Ga0307409_100452080 3300031995 Bacteria 1240
156 Ga0307409_100672755 3300031995 Bacteria 1031
157 Ga0307409_101500216 3300031995 Bacteria 701
158 Ga0307409_101512706 3300031995 Bacteria 699
159 Ga0307416_100003189 3300032002 Bacteria 9606
160 Ga0307416_100213977 3300032002 Bacteria 1841
161 Ga0307416_100275541 3300032002 Bacteria 1655
162 Ga0307416_100521454 3300032002 Bacteria 1256
163 Ga0307416_100614031 3300032002 Bacteria 1169
164 Ga0307416_102721443 3300032002 Bacteria 591
165 Ga0307414_10808791 3300032004 Bacteria 855
166 Ga0307414_10902112 3300032004 Bacteria 810
167 Ga0307411_10553839 3300032005 Bacteria 981
168 Ga0307415_100025637 3300032126 Bacteria 3704
169 Ga0307415_100028061 3300032126 Bacteria 3575
170 Ga0307415_100139456 3300032126 Bacteria 1849
171 Ga0307415_100570416 3300032126 Bacteria 1002
172 Ga0316580_10094329 3300032139 Bacteria 916
173 Ga0316592_1042603 3300033524 Bacteria 1006
174 Ga0316592_1089033 3300033524 Bacteria 705
175 Ga0316596_1135083 3300033541 Bacteria 674
176 Ga0316596_1196191 3300033541 Bacteria 561
177 Ga0373958_0083931 3300034819 Bacteria 725
178 Ga0373961_0277995 3300035241 Bacteria 613
179 Ga0316574_0076599 3300035398 Bacteria 2119
180 Ga0373931_0182363 3300035691 Bacteria 1244
181 Ga0316582_0244810 3300036647 Bacteria 1229
182 Ga0316584_0020022 3300036712 Bacteria 4845
183 Ga0395900_0155774 3300037418 Bacteria 2333
184 Ga0395898_0061305 3300037466 Bacteria 3654
185 Ga0395898_0402527 3300037466 Bacteria 1305
186 Ga0395905_0131506 3300037471 Bacteria 2354
187 Ga0395901_0375134 3300038443 Bacteria 1465
188 Ga0439438_144550 3300041405 Bacteria 568
189 Ga0439447_080936 3300041407 Bacteria 750
190 Ga0451787_005266 3300041441 Bacteria 574
191 Ga0451797_1085820 3300041453 Bacteria 530
192 Ga0451835_0862698 3300041492 Bacteria 587
193 Ga0451837_0752076 3300041494 Bacteria 701
194 Ga0451845_0423552 3300041501 Bacteria 559
195 Ga0451853_0029808 3300041512 Bacteria 772
196 Ga0451853_1309202 3300041512 Bacteria 695
197 Ga0439431_0018247 3300041997 Bacteria 1658
198 Ga0439433_0047317 3300041999 Bacteria 1010
199 Ga0439445_0026480 3300042004 Bacteria 1485
200 Ga0439432_081772 3300042006 Bacteria 978
201 Ga0439463_037528 3300042016 Bacteria 1229
202 Ga0450920_109819 3300042122 Bacteria 576
203 Ga0450907_028990 3300042146 Bacteria 939
204 Ga0450907_036649 3300042146 Bacteria 838
205 Ga0439446_0046631 3300042156 Bacteria 1287
206 Ga0439434_0022577 3300042435 Bacteria 1891
207 Ga0466972_0027059 3300044658 Bacteria 2839
208 Ga0466965_0010721 3300044683 Bacteria 4284
209 Ga0466965_0083461 3300044683 Bacteria 1617
210 Ga0466966_0076777 3300044684 Bacteria 2085
211 Ga0466961_0060611 3300044693 Bacteria 2406
212 Ga0466961_0438098 3300044693 Bacteria 791
213 Ga0466963_0087335 3300044694 Bacteria 2120
214 Ga0466963_0208226 3300044694 Bacteria 1368
215 Ga0466964_0010440 3300044706 Bacteria 3503
216 Ga0466964_0112936 3300044706 Bacteria 1214
217 Ga0466971_0031613 3300044719 Bacteria 2370
218 Ga0466971_0101957 3300044719 Bacteria 1319
219 Ga0466968_0023951 3300044735 Bacteria 2492
220 Ga0466968_0146238 3300044735 Bacteria 1084
221 Ga0466970_0005381 3300044765 Bacteria 6350
222 Ga0466970_0011819 3300044765 Bacteria 4453
223 Ga0466970_0048969 3300044765 Bacteria 2253
224 Ga0466970_0263147 3300044765 Bacteria 968
225 Ga0466970_0274098 3300044765 Bacteria 948
226 Ga0466970_0530318 3300044765 Bacteria 679
227 Ga0466957_0014001 3300044842 Bacteria 4664
228 Ga0466957_0023535 3300044842 Bacteria 3641
229 Ga0466957_0068232 3300044842 Bacteria 2195
230 Ga0466957_0359058 3300044842 Bacteria 990
231 Ga0466957_0441575 3300044842 Bacteria 895
232 Ga0466960_0000704 3300044901 Bacteria 11646
233 Ga0466960_0000713 3300044901 Bacteria 11589
234 Ga0466960_0005401 3300044901 Bacteria 5060
235 Ga0466960_0185340 3300044901 Bacteria 1130
236 Ga0466959_0048850 3300045049 Bacteria 3109
237 Ga0466959_0296474 3300045049 Bacteria 1108
238 Ga0466958_0026449 3300045836 Bacteria 3429
239 Ga0466958_0387003 3300045836 Bacteria 902
240 Ga0466958_0808947 3300045836 Bacteria 611
241 Ga0466967_0047788 3300045976 Bacteria 3733
242 Ga0466967_0057197 3300045976 Bacteria 3442
243 Ga0466967_0113852 3300045976 Bacteria 2489
244 Ga0466967_0409956 3300045976 Bacteria 1319
245 Ga0466967_0881841 3300045976 Bacteria 889
246 Ga0495629_1130380 3300046459 Bacteria 505
247 Ga0495641_0223678 3300046461 Bacteria 844
248 Ga0495641_0304039 3300046461 Bacteria 719
249 Ga0495582_0427821 3300046473 Bacteria 764
250 Ga0495609_0397407 3300046538 Bacteria 552
251 Ga0495658_0497246 3300046683 Bacteria 780
252 Ga0495672_0249597 3300047320 Bacteria 862
253 Ga0495680_0725743 3300047322 Bacteria 654
254 Ga0496102_0091246 3300048905 Bacteria 2820
255 Ga0496102_1407044 3300048905 Bacteria 616
256 Ga0496103_0228530 3300048906 Bacteria 1197
257 Ga0496104_0712757 3300048907 Bacteria 911
258 Ga0496105_0284787 3300048908 Bacteria 1331
259 Ga0496106_0176728 3300048909 Bacteria 1694
260 Ga0496108_0348263 3300048911 Bacteria 1293
261 Ga0496108_0543053 3300048911 Bacteria 1014
262 Ga0496109_0177585 3300048912 Bacteria 1999
263 Ga0496109_0227839 3300048912 Bacteria 1753
264 Ga0496109_1956870 3300048912 Bacteria 518
265 Ga0496110_0007084 3300048913 Bacteria 8926
266 Ga0496110_0086345 3300048913 Bacteria 2801
267 Ga0496110_0177661 3300048913 Bacteria 1933
268 Ga0496110_0265361 3300048913 Bacteria 1563
269 Ga0496110_0411388 3300048913 Bacteria 1233
270 Ga0496110_1247547 3300048913 Bacteria 652
271 Ga0496111_0043963 3300048914 Bacteria 3211
272 Ga0496111_0119074 3300048914 Bacteria 1950
273 Ga0496114_0047467 3300048917 Bacteria 3572
274 Ga0496114_0087973 3300048917 Bacteria 2635
275 Ga0496114_0273992 3300048917 Bacteria 1487
276 Ga0496114_0541298 3300048917 Bacteria 1029
277 Ga0496115_0119502 3300048918 Bacteria 2168
278 Ga0501306_076460 3300049127 Bacteria 572
279 Ga0501308_020467 3300049128 Bacteria 824
280 Ga0501304_031512 3300049160 Bacteria 565
281 Ga0501305_023324 3300049161 Bacteria 926
282 Ga0501307_018161 3300049162 Bacteria 892
283 Ga0501307_021583 3300049162 Bacteria 841
284 Ga0501317_045906 3300049533 Bacteria 681
285 Ga0501318_010981 3300049534 Bacteria 1016
286 Ga0501318_015785 3300049534 Bacteria 906
287 Ga0501318_016634 3300049534 Bacteria 891
288 Ga0501320_048235 3300049536 Bacteria 574
289 Ga0501321_032938 3300049537 Bacteria 700
290 Ga0501325_017646 3300049541 Bacteria 724
291 Ga0501330_007256 3300049546 Bacteria 740
292 Ga0501335_043823 3300049551 Bacteria 533
293 Ga0501031_0017561 3300049568 Bacteria 4650
294 Ga0501031_0034163 3300049568 Bacteria 3319
295 Ga0501031_0271221 3300049568 Bacteria 1102
296 Ga0501031_0532145 3300049568 Bacteria 757
297 Ga0501032_0110724 3300049569 Bacteria 1817
298 Ga0501032_0846241 3300049569 Bacteria 577
299 Ga0501036_0013739 3300049572 Bacteria 6732
300 Ga0501036_0061004 3300049572 Bacteria 3194
301 Ga0501036_0170309 3300049572 Bacteria 1835
302 Ga0501037_0332077 3300049573 Bacteria 1051
303 Ga0501037_0727214 3300049573 Bacteria 659
304 Ga0501037_1046942 3300049573 Bacteria 530
305 Ga0501038_0406462 3300049574 Bacteria 1052
306 Ga0501038_0673878 3300049574 Bacteria 777
307 Ga0501039_0011269 3300049575 Bacteria 6810
308 Ga0501039_0044368 3300049575 Bacteria 3434
309 Ga0501039_0056325 3300049575 Bacteria 3045
310 Ga0501039_0082835 3300049575 Bacteria 2498
311 Ga0501040_0091435 3300049576 Bacteria 2115
312 Ga0501040_0211779 3300049576 Bacteria 1378
313 Ga0501040_0876104 3300049576 Bacteria 650
314 Ga0501041_0736081 3300049577 Bacteria 631
315 Ga0501041_0908139 3300049577 Bacteria 566
316 Ga0501042_0022275 3300049578 Bacteria 4426
317 Ga0501042_0140360 3300049578 Bacteria 1742
318 Ga0501042_0745551 3300049578 Bacteria 712
319 Ga0501042_1194909 3300049578 Bacteria 554
320 Ga0501043_0188408 3300049579 Bacteria 1605
321 Ga0501046_0086214 3300049580 Bacteria 2421
322 Ga0501048_0042404 3300049582 Bacteria 3258
323 Ga0501048_0209290 3300049582 Bacteria 1383
324 Ga0501048_0298972 3300049582 Bacteria 1145
325 Ga0501048_0440947 3300049582 Bacteria 932
326 Ga0501067_0330077 3300049583 Bacteria 850
327 Ga0501067_0742529 3300049583 Bacteria 552
328 Ga0501068_0439986 3300049584 Bacteria 843
329 Ga0501069_0101846 3300049585 Bacteria 1631
330 Ga0501069_0126062 3300049585 Bacteria 1464
331 Ga0501070_0106269 3300049586 Bacteria 2320
332 Ga0501070_0229959 3300049586 Bacteria 1519
333 Ga0501070_0548986 3300049586 Bacteria 925
334 Ga0501071_0174532 3300049587 Bacteria 1609
335 Ga0501071_0368136 3300049587 Bacteria 1095
336 Ga0501071_0401087 3300049587 Bacteria 1047
337 Ga0501071_0685710 3300049587 Bacteria 789
338 Ga0501072_0016003 3300049588 Bacteria 5751
339 Ga0501072_0213697 3300049588 Bacteria 1537
340 Ga0501072_0656948 3300049588 Bacteria 825
341 Ga0501074_0053621 3300049590 Bacteria 2908
342 Ga0501075_0105234 3300049591 Bacteria 2144
343 Ga0501075_0127392 3300049591 Bacteria 1939
344 Ga0501075_0376398 3300049591 Bacteria 1082
345 Ga0501076_0005489 3300049592 Bacteria 9133
346 Ga0501076_0191781 3300049592 Bacteria 1668
347 Ga0501076_0340028 3300049592 Bacteria 1232
348 Ga0501076_0696883 3300049592 Bacteria 838
349 Ga0501077_0011767 3300049593 Bacteria 5471
350 Ga0501079_0022810 3300049741 Bacteria 4804
351 Ga0501079_1589441 3300049741 Bacteria 514
352 Ga0501080_0700017 3300049742 Bacteria 894
353 Ga0501081_0014750 3300049743 Bacteria 5156
354 Ga0501083_0274956 3300049744 Bacteria 1096
355 Ga0501035_0348701 3300049822 Bacteria 1239
356 Ga0501044_0489984 3300049823 Bacteria 1131
357 Ga0501045_0010723 3300049824 Bacteria 6425
358 Ga0501045_0310130 3300049824 Bacteria 1174
359 Ga0501045_0798708 3300049824 Bacteria 695
360 nmdc:mga03n38_14924_c1 3300050490 Bacteria 2991
361 nmdc:mga03n38_429442_c1 3300050490 Bacteria 732
362 nmdc:mga03n38_4984_c1 3300050490 Bacteria 4468
363 nmdc:mga00v17_474375_c1 3300050491 Bacteria 812
364 nmdc:mga00v17_73079_c1 3300050491 Bacteria 2129
365 nmdc:mga00v17_94421_c1 3300050491 Bacteria 1882
366 nmdc:mga00v17_94825_c1 3300050491 Bacteria 1878
367 nmdc:mga0yw44_103315_c1 3300050492 Bacteria 1818
368 nmdc:mga0yw44_139170_c1 3300050492 Bacteria 1577
369 nmdc:mga0yw44_18198_c1 3300050492 Bacteria 3842
370 nmdc:mga0yw44_186881_c1 3300050492 Bacteria 1365
371 nmdc:mga0yw44_229193_c1 3300050492 Bacteria 1233
372 nmdc:mga0yw44_289511_c1 3300050492 Bacteria 1096
373 nmdc:mga0yw44_433_c1 3300050492 Bacteria 14713
374 nmdc:mga0yw44_998_c1 3300050492 Bacteria 10816
375 nmdc:mga06z11_1011847_c1 3300050494 Bacteria 507
376 nmdc:mga06z11_156172_c1 3300050494 Bacteria 1301
377 nmdc:mga06z11_174647_c1 3300050494 Bacteria 1236
378 nmdc:mga04h51_227643_c1 3300050495 Bacteria 741
379 nmdc:mga07m45_241338_c1 3300050496 Bacteria 1051
380 nmdc:mga07m45_245817_c1 3300050496 Bacteria 1041
381 nmdc:mga07m45_414110_c1 3300050496 Bacteria 782
382 nmdc:mga08y16_1747552_c1 3300050511 Bacteria 576
383 Ga0495595_0207681 3300053084 Bacteria 976
384 Ga0495595_0710670 3300053084 Bacteria 515
385 Ga0495619_0866378 3300053085 Bacteria 609
386 Ga0495619_1049736 3300053085 Bacteria 544
387 Ga0500644_0000284 3300053088 Bacteria 28069
388 Ga0500573_0145045 3300053140 Bacteria 1304
389 Ga0500573_0300225 3300053140 Bacteria 803
390 Ga0501084_0010784 3300054114 Bacteria 7566
391 Ga0501084_0380653 3300054114 Bacteria 1193
392 Ga0501084_0485868 3300054114 Bacteria 1044
393 Ga0501084_1022418 3300054114 Bacteria 694
394 Ga0590074_073486 3300059423 Bacteria 647
395 Ga0587066_046453 3300059490 Bacteria 838
396 Ga0587066_214118 3300059490 Bacteria 513
397 Ga0587082_182973 3300059504 Bacteria 515
398 Ga0587090_122130 3300059510 Bacteria 566
399 Ga0587098_088202 3300059604 Bacteria 526
400 Ga0587078_058443 3300059646 Bacteria 580
401 Ga0501082_0031888 3300060353 Bacteria 4545
402 Ga0466962_0012362 3300061719 Bacteria 4104
403 Ga0466962_0114278 3300061719 Bacteria 1300
404 Ga0530510_0020901 3300061734 Bacteria 4655
405 Ga0530510_0174019 3300061734 Bacteria 1595
406 Ga0530510_0257313 3300061734 Bacteria 1301
407 Ga0530510_0578372 3300061734 Bacteria 854
408 2515851139 2515154155 Bacteria 7985436
409 2643891673 2643221576 Bacteria 5214352
410 2643960721 2643221590 Bacteria 5214697
411 2644035761 2643221604 Bacteria 5014917
412 2644102349 2643221617 Bacteria 5139111
413 2644115573 2643221620 Bacteria 5134593
414 2644230352 2643221641 Bacteria 4490190
415 2676474975 2675903058 Bacteria 6822861
416 2738868125 2738541305 Bacteria 4910150
417 2740168976 2739367898 Bacteria 4367674
418 2774392332 2773857762 Bacteria 5971770
419 2809196141 2808606439 Bacteria 5952208
420 2812333127 2811994874 Bacteria 5367947
421 2812351735 2811994878 Bacteria 5992952
422 2827630857 2827628540 Bacteria 6858585
423 2891970637 2891968417 Bacteria 5821697
424 2984594657 2984592036 Bacteria 3670284
425 8054611192 8054609563 Bacteria 5170090
426 Ga0070672_100369805
427 Ga0006778J45830_1016744
428 Ga0006778J45830_1035498
429 Ga0006759J45824_1014488
430 JGI25406J46586_10010559
431 Ga0006562J51391_1033460
432 Ga0006562J51391_1033461
433 Ga0007429J51699_1014395
434 Ga0032354_1032104
435 Ga0058860_12063614
436 Ga0070683_100394415
437 Ga0070670_101826828
438 Ga0070668_101035345
439 Ga0070671_100816089
440 Ga0070674_100611617
441 Ga0070674_100655548
442 Ga0070674_101480823
443 Ga0070659_100070023
444 Ga0070659_100915954
445 Ga0070667_100893840
446 Ga0070700_100424429
447 Ga0070700_100794213
448 Ga0070700_100899766
449 Ga0070678_100436828
450 Ga0070678_101953799
451 Ga0070662_100580270
452 Ga0070681_11625435
453 Ga0068867_100333406
454 Ga0068867_100886763
455 Ga0070685_10853858
456 Ga0070699_100070177
457 Ga0070684_100792631
458 Ga0070686_101740919
459 Ga0070665_101341880
460 Ga0070665_101452177
461 Ga0070704_101873315
462 Ga0068857_100507166
463 Ga0068856_101212418
464 Ga0068852_100575307
465 Ga0068852_100636964
466 Ga0068852_101136675
467 Ga0068859_101501965
468 Ga0068864_101964601
469 Ga0068861_100929947
470 Ga0068861_101029190
471 Ga0068870_10112372
472 Ga0068870_10391842
473 Ga0068870_11380544
474 Ga0068858_101393093
475 Ga0068860_100000696
476 Ga0081455_10355669
477 Ga0081538_10004407
478 Ga0081538_10225967
479 Ga0081539_10001125
480 Ga0075365_10295718
481 Ga0075365_10351288
482 Ga0075368_10003670
483 Ga0075364_10012417
484 Ga0075364_10047542
485 Ga0075364_10080837
486 Ga0075364_10127022
487 Ga0075364_10298926
488 Ga0075432_10403570
489 Ga0075362_10702113
490 Ga0075367_10020586
491 Ga0075367_10027074
492 Ga0075367_10195962
493 Ga0075370_10196440
494 Ga0075370_10431042
495 Ga0097620_101501985
496 Ga0075435_101058186
497 Ga0111539_12882134
498 Ga0105243_11127879
499 Ga0105243_11136071
500 Ga0105243_12262047
501 Ga0105241_11849812
502 Ga0105238_10723929
503 Ga0105249_10356478
504 Ga0105246_11238519
505 Ga0105246_11528175
506 Ga0105246_11701284
507 Ga0157340_1011981
508 Ga0157373_10498765
509 Ga0157371_11352612
510 Ga0157372_10999286
511 Ga0157372_11567061
512 Ga0157372_12280005
513 Ga0157375_10343003
514 Ga0157375_11602825
515 Ga0157375_12150682
516 Ga0163163_12958518
517 Ga0157380_11130771
518 Ga0182007_10368607
519 Ga0197907_10012661
520 Ga0197907_11006598
521 Ga0206356_10268958
522 Ga0206351_10507852
523 Ga0206350_10032790
524 Ga0206354_10728162
525 Ga0206353_10217021
526 Ga0206353_11824255
527 Ga0224712_10144035
528 Ga0207688_10657734
529 Ga0207647_10052109
530 Ga0207657_10026283
531 Ga0207657_10078433
532 Ga0207652_10340334
533 Ga0207694_11360604
534 Ga0207687_10151944
535 Ga0207664_10064457
536 Ga0207690_10117826
537 Ga0207690_10157918
538 Ga0207690_10720493
539 Ga0207709_10312134
540 Ga0207709_10654872
541 Ga0207669_10257552
542 Ga0207704_10432338
543 Ga0207661_10533730
544 Ga0207661_10732535
545 Ga0207658_10020723
546 Ga0207658_10645858
547 Ga0207678_11915226
548 Ga0207708_11639082
549 Ga0207648_11016443
550 Ga0207674_10268287
551 Ga0207674_10485350
552 Ga0207675_100302868
553 Ga0207698_10654068
554 Ga0209813_10150983
555 Ga0268266_12361287
556 Ga0268264_10000697
557 Ga0268264_10882762
558 Ga0316176_1128013
559 Ga0316176_1202052
560 Ga0316181_1096648
561 Ga0316576_10024282
562 Ga0316576_10089364
563 Ga0316578_10219125
564 Ga0316578_10473400
565 Ga0307405_10063499
566 Ga0307413_10093115
567 Ga0307413_10341209
568 Ga0307410_10013105
569 Ga0307410_10044553
570 Ga0307410_10480110
571 Ga0307410_10633256
572 Ga0307406_10065228
573 Ga0307406_10205865
574 Ga0307406_11844066
575 Ga0307407_10689746
576 Ga0307407_11053421
577 Ga0307412_11921700
578 Ga0307409_100002918
579 Ga0307409_100022274
580 Ga0307409_100452080
581 Ga0307409_100672755
582 Ga0307409_101500216
583 Ga0307409_101512706
584 Ga0307416_100003189
585 Ga0307416_100213977
586 Ga0307416_100275541
587 Ga0307416_100521454
588 Ga0307416_100614031
589 Ga0307416_102721443
590 Ga0307414_10808791
591 Ga0307414_10902112
592 Ga0307411_10553839
593 Ga0307415_100025637
594 Ga0307415_100028061
595 Ga0307415_100139456
596 Ga0307415_100570416
597 Ga0316580_10094329
598 Ga0316592_1042603
599 Ga0316592_1089033
600 Ga0316596_1135083
601 Ga0316596_1196191
602 Ga0373958_0083931
603 Ga0373961_0277995
604 Ga0316574_0076599
605 Ga0373931_0182363
606 Ga0316582_0244810
607 Ga0316584_0020022
608 Ga0395900_0155774
609 Ga0395898_0061305
610 Ga0395898_0402527
611 Ga0395905_0131506
612 Ga0395901_0375134
613 Ga0439438_144550
614 Ga0439447_080936
615 Ga0451787_005266
616 Ga0451797_1085820
617 Ga0451835_0862698
618 Ga0451837_0752076
619 Ga0451845_0423552
620 Ga0451853_0029808
621 Ga0451853_1309202
622 Ga0439431_0018247
623 Ga0439433_0047317
624 Ga0439445_0026480
625 Ga0439432_081772
626 Ga0439463_037528
627 Ga0450920_109819
628 Ga0450907_028990
629 Ga0450907_036649
630 Ga0439446_0046631
631 Ga0439434_0022577
632 Ga0466972_0027059
633 Ga0466965_0010721
634 Ga0466965_0083461
635 Ga0466966_0076777
636 Ga0466961_0060611
637 Ga0466961_0438098
638 Ga0466963_0087335
639 Ga0466963_0208226
640 Ga0466964_0010440
641 Ga0466964_0112936
642 Ga0466971_0031613
643 Ga0466971_0101957
644 Ga0466968_0023951
645 Ga0466968_0146238
646 Ga0466970_0005381
647 Ga0466970_0011819
648 Ga0466970_0048969
649 Ga0466970_0263147
650 Ga0466970_0274098
651 Ga0466970_0530318
652 Ga0466957_0014001
653 Ga0466957_0023535
654 Ga0466957_0068232
655 Ga0466957_0359058
656 Ga0466957_0441575
657 Ga0466960_0000704
658 Ga0466960_0000713
659 Ga0466960_0005401
660 Ga0466960_0185340
661 Ga0466959_0048850
662 Ga0466959_0296474
663 Ga0466958_0026449
664 Ga0466958_0387003
665 Ga0466958_0808947
666 Ga0466967_0047788
667 Ga0466967_0057197
668 Ga0466967_0113852
669 Ga0466967_0409956
670 Ga0466967_0881841
671 Ga0495629_1130380
672 Ga0495641_0223678
673 Ga0495641_0304039
674 Ga0495582_0427821
675 Ga0495609_0397407
676 Ga0495658_0497246
677 Ga0495672_0249597
678 Ga0495680_0725743
679 Ga0496102_0091246
680 Ga0496102_1407044
681 Ga0496103_0228530
682 Ga0496104_0712757
683 Ga0496105_0284787
684 Ga0496106_0176728
685 Ga0496108_0348263
686 Ga0496108_0543053
687 Ga0496109_0177585
688 Ga0496109_0227839
689 Ga0496109_1956870
690 Ga0496110_0007084
691 Ga0496110_0086345
692 Ga0496110_0177661
693 Ga0496110_0265361
694 Ga0496110_0411388
695 Ga0496110_1247547
696 Ga0496111_0043963
697 Ga0496111_0119074
698 Ga0496114_0047467
699 Ga0496114_0087973
700 Ga0496114_0273992
701 Ga0496114_0541298
702 Ga0496115_0119502
703 Ga0501306_076460
704 Ga0501308_020467
705 Ga0501304_031512
706 Ga0501305_023324
707 Ga0501307_018161
708 Ga0501307_021583
709 Ga0501317_045906
710 Ga0501318_010981
711 Ga0501318_015785
712 Ga0501318_016634
713 Ga0501320_048235
714 Ga0501321_032938
715 Ga0501325_017646
716 Ga0501330_007256
717 Ga0501335_043823
718 Ga0501031_0017561
719 Ga0501031_0034163
720 Ga0501031_0271221
721 Ga0501031_0532145
722 Ga0501032_0110724
723 Ga0501032_0846241
724 Ga0501036_0013739
725 Ga0501036_0061004
726 Ga0501036_0170309
727 Ga0501037_0332077
728 Ga0501037_0727214
729 Ga0501037_1046942
730 Ga0501038_0406462
731 Ga0501038_0673878
732 Ga0501039_0011269
733 Ga0501039_0044368
734 Ga0501039_0056325
735 Ga0501039_0082835
736 Ga0501040_0091435
737 Ga0501040_0211779
738 Ga0501040_0876104
739 Ga0501041_0736081
740 Ga0501041_0908139
741 Ga0501042_0022275
742 Ga0501042_0140360
743 Ga0501042_0745551
744 Ga0501042_1194909
745 Ga0501043_0188408
746 Ga0501046_0086214
747 Ga0501048_0042404
748 Ga0501048_0209290
749 Ga0501048_0298972
750 Ga0501048_0440947
751 Ga0501067_0330077
752 Ga0501067_0742529
753 Ga0501068_0439986
754 Ga0501069_0101846
755 Ga0501069_0126062
756 Ga0501070_0106269
757 Ga0501070_0229959
758 Ga0501070_0548986
759 Ga0501071_0174532
760 Ga0501071_0368136
761 Ga0501071_0401087
762 Ga0501071_0685710
763 Ga0501072_0016003
764 Ga0501072_0213697
765 Ga0501072_0656948
766 Ga0501074_0053621
767 Ga0501075_0105234
768 Ga0501075_0127392
769 Ga0501075_0376398
770 Ga0501076_0005489
771 Ga0501076_0191781
772 Ga0501076_0340028
773 Ga0501076_0696883
774 Ga0501077_0011767
775 Ga0501079_0022810
776 Ga0501079_1589441
777 Ga0501080_0700017
778 Ga0501081_0014750
779 Ga0501083_0274956
780 Ga0501035_0348701
781 Ga0501044_0489984
782 Ga0501045_0010723
783 Ga0501045_0310130
784 Ga0501045_0798708
785 nmdc:mga03n38_14924_c1
786 nmdc:mga03n38_429442_c1
787 nmdc:mga03n38_4984_c1
788 nmdc:mga00v17_474375_c1
789 nmdc:mga00v17_73079_c1
790 nmdc:mga00v17_94421_c1
791 nmdc:mga00v17_94825_c1
792 nmdc:mga0yw44_103315_c1
793 nmdc:mga0yw44_139170_c1
794 nmdc:mga0yw44_18198_c1
795 nmdc:mga0yw44_186881_c1
796 nmdc:mga0yw44_229193_c1
797 nmdc:mga0yw44_289511_c1
798 nmdc:mga0yw44_433_c1
799 nmdc:mga0yw44_998_c1
800 nmdc:mga06z11_1011847_c1
801 nmdc:mga06z11_156172_c1
802 nmdc:mga06z11_174647_c1
803 nmdc:mga04h51_227643_c1
804 nmdc:mga07m45_241338_c1
805 nmdc:mga07m45_245817_c1
806 nmdc:mga07m45_414110_c1
807 nmdc:mga08y16_1747552_c1
808 Ga0495595_0207681
809 Ga0495595_0710670
810 Ga0495619_0866378
811 Ga0495619_1049736
812 Ga0500644_0000284
813 Ga0500573_0145045
814 Ga0500573_0300225
815 Ga0501084_0010784
816 Ga0501084_0380653
817 Ga0501084_0485868
818 Ga0501084_1022418
819 Ga0590074_073486
820 Ga0587066_046453
821 Ga0587066_214118
822 Ga0587082_182973
823 Ga0587090_122130
824 Ga0587098_088202
825 Ga0587078_058443
826 Ga0501082_0031888
827 Ga0466962_0012362
828 Ga0466962_0114278
829 Ga0530510_0020901
830 Ga0530510_0174019
831 Ga0530510_0257313
832 Ga0530510_0578372
833 2515851139
834 2643891673
835 2643960721
836 2644035761
837 2644102349
838 2644115573
839 2644230352
840 2676474975
841 2738868125
842 2740168976
843 2774392332
844 2809196141
845 2812333127
846 2812351735
847 2827630857
848 2891970637
849 2984594657
850 8054611192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

18

82

0.8

Map