F440779

General Info

Members Datasets Scaffolds Average Seq Length
424 199 848 333

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10010733|Ga0207689_100107335
Length 394
Sequence LRFQFPRPKIHDECVKSLDRPGQVSVRPKNQLQEAVVRSNDFLLSYQYQLLFKRKHTVQDMAESFSTISQALELPNSSLNPTWKEWRFHILLFVFTIITTILSGVMLVMPELDTPSPSLRRPLDYLLYIPVTYFNTVVDFFTFVAKHPELMLQGITFSASLLAILLSHEMGHYLACRYYGINATLPFFIPAPPLFLAGTFGAFIKIRSPIPNRRALFDVGLAGPLAGFVIAVPIAIAGILSIGQPLHLGSGIYFNDPLMFRLLARLLGVQLNPDSPINPYYMAAWIGLLVTSLNLMPVGQLDGGHGTFAVFGQRAHKIIGRLAFASVALLAILGFLWHGSPSGFLYTVLLGVMLRVRHPAPPQMESLGTKRILVGILTLIVFGLCFLPFPITIL

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
172 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
177 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
186 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
189 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
190 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
191 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.18
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 30.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10010733 3300025942 Bacteria 7882
2 SwRhRL3b_contig_1519857 2162886006 Unclassified 1091
3 SwRhRL2b_contig_845468 2162886007 Unclassified 1555
4 MBSR1b_contig_12882258 2162886012 Bacteria 1208
5 JGI24751J29686_10000003 3300002459 Bacteria 157815
6 JGI25406J46586_10002532 3300003203 Bacteria 8647
7 rootH2_10122934 3300003320 Bacteria 1676
8 rootL2_10094511 3300003322 Bacteria 2476
9 Ga0065714_10064425 3300005288 Bacteria 189652
10 Ga0065704_10001506 3300005289 Bacteria 12849
11 Ga0065704_10011641 3300005289 Bacteria 2463
12 Ga0065704_10074150 3300005289 Bacteria 6490
13 Ga0065712_10001188 3300005290 Bacteria 6527
14 Ga0065712_10067727 3300005290 Bacteria 189643
15 Ga0065712_10155387 3300005290 Unclassified 1339
16 Ga0065715_10009943 3300005293 Unclassified 2550
17 Ga0065707_10000669 3300005295 Bacteria 21770
18 Ga0070690_100007988 3300005330 Bacteria 6073
19 Ga0070690_100095802 3300005330 Unclassified 1960
20 Ga0070690_100256955 3300005330 Bacteria 1238
21 Ga0070670_100000167 3300005331 Bacteria 59452
22 Ga0070670_100005870 3300005331 Bacteria 10377
23 Ga0070670_100057889 3300005331 Bacteria 3326
24 Ga0070670_100063589 3300005331 Bacteria 3167
25 Ga0070670_100247723 3300005331 Unclassified 1552
26 Ga0070670_100419784 3300005331 Unclassified 1182
27 Ga0068869_100001808 3300005334 Bacteria 12846
28 Ga0068869_100054819 3300005334 Bacteria 2904
29 Ga0068869_100078320 3300005334 Bacteria 2461
30 Ga0068869_100156661 3300005334 Unclassified 1770
31 Ga0070666_10005120 3300005335 Bacteria 8024
32 Ga0070680_100001034 3300005336 Bacteria 19934
33 Ga0070680_100253281 3300005336 Bacteria 1489
34 Ga0070680_100270795 3300005336 Bacteria 1438
35 Ga0070682_100004202 3300005337 Bacteria 7989
36 Ga0068868_100118107 3300005338 Bacteria 2161
37 Ga0068868_100328502 3300005338 Bacteria 1305
38 Ga0070689_100009282 3300005340 Bacteria 6969
39 Ga0070691_10152702 3300005341 Bacteria 1185
40 Ga0070687_100124632 3300005343 Bacteria 1478
41 Ga0070661_100015315 3300005344 Bacteria 5411
42 Ga0070692_10009702 3300005345 Bacteria 4354
43 Ga0070692_10074969 3300005345 Bacteria 1811
44 Ga0070669_100002809 3300005353 Bacteria 12569
45 Ga0070669_100009819 3300005353 Bacteria 6817
46 Ga0070669_100051069 3300005353 Unclassified 3021
47 Ga0070675_100134227 3300005354 Bacteria 2111
48 Ga0070675_100188286 3300005354 Bacteria 1787
49 Ga0070671_100008257 3300005355 Bacteria 8334
50 Ga0070671_100052446 3300005355 Unclassified 3391
51 Ga0070671_100053673 3300005355 Bacteria 3351
52 Ga0070673_100403334 3300005364 Bacteria 1223
53 Ga0070659_100018959 3300005366 Bacteria 5201
54 Ga0070659_100037396 3300005366 Bacteria 3784
55 Ga0070659_100065761 3300005366 Bacteria 2872
56 Ga0070667_100160093 3300005367 Unclassified 1982
57 Ga0070701_10114135 3300005438 Unclassified 1513
58 Ga0070705_100043841 3300005440 Bacteria 2566
59 Ga0070700_100000228 3300005441 Bacteria 30994
60 Ga0070700_100015627 3300005441 Bacteria 4309
61 Ga0070700_100016509 3300005441 Bacteria 4206
62 Ga0070700_100054577 3300005441 Bacteria 2498
63 Ga0070694_100026498 3300005444 Bacteria 3757
64 Ga0070694_100066930 3300005444 Unclassified 2465
65 Ga0070694_100112814 3300005444 Unclassified 1939
66 Ga0070694_100173768 3300005444 Unclassified 1589
67 Ga0070662_100062161 3300005457 Bacteria 2728
68 Ga0070681_10001694 3300005458 Bacteria 19718
69 Ga0070681_10166124 3300005458 Unclassified 2129
70 Ga0068867_100006107 3300005459 Bacteria 8528
71 Ga0068867_100103331 3300005459 Bacteria 2179
72 Ga0070706_100000053 3300005467 Bacteria 139565
73 Ga0070706_100021996 3300005467 Bacteria 5872
74 Ga0070706_100224950 3300005467 Bacteria 1751
75 Ga0070707_100018687 3300005468 Bacteria 6523
76 Ga0070698_100002114 3300005471 Bacteria 22082
77 Ga0070698_100049930 3300005471 Bacteria 4268
78 Ga0070698_100186277 3300005471 Bacteria 2013
79 Ga0070699_100001150 3300005518 Bacteria 24554
80 Ga0070699_100062584 3300005518 Bacteria 3225
81 Ga0070679_100001724 3300005530 Bacteria 19718
82 Ga0070679_100030693 3300005530 Bacteria 5308
83 Ga0070679_100148117 3300005530 Bacteria 2325
84 Ga0070697_100030982 3300005536 Bacteria 4299
85 Ga0070697_100089390 3300005536 Bacteria 2545
86 Ga0070697_100325507 3300005536 Bacteria 1324
87 Ga0068853_100005108 3300005539 Bacteria 10253
88 Ga0068853_100072537 3300005539 Unclassified 3000
89 Ga0070672_100093965 3300005543 Unclassified 2423
90 Ga0070695_100024694 3300005545 Bacteria 3705
91 Ga0070695_100025595 3300005545 Bacteria 3645
92 Ga0070695_100045691 3300005545 Unclassified 2792
93 Ga0070695_100176194 3300005545 Bacteria 1512
94 Ga0070696_100087078 3300005546 Bacteria 2218
95 Ga0070696_100292183 3300005546 Bacteria 1245
96 Ga0070696_100388395 3300005546 Unclassified 1089
97 Ga0070693_100090609 3300005547 Unclassified 1842
98 Ga0070665_100046703 3300005548 Unclassified 4348
99 Ga0070704_100199312 3300005549 Bacteria 1615
100 Ga0070704_100385404 3300005549 Bacteria 1192
101 Ga0068855_100042889 3300005563 Bacteria 5361
102 Ga0068857_100069054 3300005577 Bacteria 3146
103 Ga0068857_100070203 3300005577 Bacteria 3120
104 Ga0068857_100138686 3300005577 Unclassified 2197
105 Ga0068857_100174028 3300005577 Unclassified 1957
106 Ga0068857_100371022 3300005577 Bacteria 1328
107 Ga0068854_100100996 3300005578 Bacteria 2163
108 Ga0068854_100110329 3300005578 Bacteria 2074
109 Ga0068854_100143268 3300005578 Bacteria 1836
110 Ga0070702_100027678 3300005615 Bacteria 3062
111 Ga0070702_100096991 3300005615 Unclassified 1800
112 Ga0068852_100138729 3300005616 Bacteria 2248
113 Ga0068859_100000994 3300005617 Bacteria 29030
114 Ga0068859_100011729 3300005617 Bacteria 8806
115 Ga0068859_100027173 3300005617 Bacteria 5741
116 Ga0068859_100070789 3300005617 Unclassified 3523
117 Ga0068859_100099877 3300005617 Bacteria 2957
118 Ga0068859_100150303 3300005617 Unclassified 2404
119 Ga0068859_100166210 3300005617 Bacteria 2286
120 Ga0068859_100289644 3300005617 Unclassified 1730
121 Ga0068859_100307929 3300005617 Unclassified 1677
122 Ga0068859_100339091 3300005617 Unclassified 1597
123 Ga0068859_100390890 3300005617 Unclassified 1487
124 Ga0068864_100002954 3300005618 Bacteria 14055
125 Ga0068864_100105280 3300005618 Unclassified 2507
126 Ga0068864_100307973 3300005618 Unclassified 1484
127 Ga0068864_100314781 3300005618 Unclassified 1468
128 Ga0068864_100429904 3300005618 Unclassified 1259
129 Ga0068861_100031612 3300005719 Bacteria 3890
130 Ga0068861_100160325 3300005719 Bacteria 1855
131 Ga0068851_10006646 3300005834 Bacteria 5292
132 Ga0068851_10150073 3300005834 Unclassified 1273
133 Ga0068870_10048215 3300005840 Bacteria 2242
134 Ga0068863_100012803 3300005841 Bacteria 8089
135 Ga0068863_100033603 3300005841 Bacteria 4886
136 Ga0068863_100034835 3300005841 Unclassified 4795
137 Ga0068863_100150589 3300005841 Unclassified 2226
138 Ga0068863_100192441 3300005841 Bacteria 1960
139 Ga0068863_100311804 3300005841 Bacteria 1527
140 Ga0068863_100501175 3300005841 Bacteria 1196
141 Ga0068858_100015277 3300005842 Bacteria 7224
142 Ga0068858_100033218 3300005842 Unclassified 4790
143 Ga0068858_100054762 3300005842 Bacteria 3688
144 Ga0068858_100559723 3300005842 Bacteria 1107
145 Ga0068860_100009347 3300005843 Bacteria 9739
146 Ga0068860_100018750 3300005843 Bacteria 6723
147 Ga0068860_100122168 3300005843 Unclassified 2494
148 Ga0068860_100154238 3300005843 Bacteria 2213
149 Ga0068860_100201425 3300005843 Bacteria 1929
150 Ga0068860_100235805 3300005843 Unclassified 1779
151 Ga0068860_100258981 3300005843 Bacteria 1695
152 Ga0081539_10001126 3300005985 Bacteria 48444
153 Ga0075432_10022457 3300006058 Unclassified 2158
154 Ga0097621_100006570 3300006237 Bacteria 8258
155 Ga0068871_100003178 3300006358 Bacteria 11281
156 Ga0068871_100011532 3300006358 Bacteria 6482
157 Ga0068871_100051366 3300006358 Unclassified 3337
158 Ga0068871_100129686 3300006358 Bacteria 2137
159 Ga0075428_100078419 3300006844 Unclassified 3606
160 Ga0075430_100013584 3300006846 Bacteria 6938
161 Ga0075431_100120501 3300006847 Unclassified 2707
162 Ga0075433_10018022 3300006852 Bacteria 5861
163 Ga0075433_10021522 3300006852 Bacteria 5408
164 Ga0075434_100019314 3300006871 Bacteria 6595
165 Ga0075434_100028639 3300006871 Bacteria 5476
166 Ga0075434_100089150 3300006871 Unclassified 3086
167 Ga0075434_100193080 3300006871 Bacteria 2057
168 Ga0075434_100255062 3300006871 Bacteria 1773
169 Ga0075429_100061884 3300006880 Bacteria 3261
170 Ga0075429_100141019 3300006880 Unclassified 2110
171 Ga0068865_100023447 3300006881 Unclassified 4041
172 Ga0068865_100109172 3300006881 Bacteria 2038
173 Ga0097620_100000994 3300006931 Bacteria 29030
174 Ga0097620_100011729 3300006931 Bacteria 8806
175 Ga0097620_100027173 3300006931 Bacteria 5741
176 Ga0097620_100070793 3300006931 Unclassified 3523
177 Ga0097620_100099876 3300006931 Bacteria 2957
178 Ga0097620_100111905 3300006931 Bacteria 2793
179 Ga0097620_100150306 3300006931 Unclassified 2404
180 Ga0097620_100166211 3300006931 Bacteria 2286
181 Ga0097620_100289646 3300006931 Unclassified 1730
182 Ga0097620_100307934 3300006931 Unclassified 1677
183 Ga0097620_100339088 3300006931 Unclassified 1597
184 Ga0097620_100390886 3300006931 Unclassified 1487
185 Ga0075435_100012283 3300007076 Bacteria 6335
186 Ga0075435_100178927 3300007076 Bacteria 1792
187 Ga0105240_10258299 3300009093 Bacteria 2011
188 Ga0111539_10001706 3300009094 Bacteria 29249
189 Ga0111539_10049506 3300009094 Bacteria 5010
190 Ga0111539_10183597 3300009094 Bacteria 2443
191 Ga0111539_10760572 3300009094 Unclassified 1128
192 Ga0105245_10406399 3300009098 Unclassified 1362
193 Ga0114129_10037625 3300009147 Bacteria 6832
194 Ga0114129_10578386 3300009147 Bacteria 1458
195 Ga0105243_10004535 3300009148 Bacteria 10972
196 Ga0105243_10006086 3300009148 Bacteria 9327
197 Ga0105243_10022334 3300009148 Unclassified 4808
198 Ga0105241_10009798 3300009174 Bacteria 7041
199 Ga0105241_10276557 3300009174 Bacteria 1432
200 Ga0105242_10002161 3300009176 Bacteria 15503
201 Ga0105242_10297941 3300009176 Bacteria 1471
202 Ga0105242_10375593 3300009176 Bacteria 1320
203 Ga0105248_10005966 3300009177 Bacteria 13384
204 Ga0105248_10012443 3300009177 Bacteria 9387
205 Ga0105248_10043902 3300009177 Bacteria 5013
206 Ga0105248_10087033 3300009177 Unclassified 3516
207 Ga0105248_10104694 3300009177 Bacteria 3190
208 Ga0105248_10510751 3300009177 Unclassified 1355
209 Ga0105237_10001338 3300009545 Bacteria 32668
210 Ga0105237_10054375 3300009545 Bacteria 4011
211 Ga0105238_10006965 3300009551 Bacteria 11296
212 Ga0105238_10008039 3300009551 Bacteria 10552
213 Ga0105249_10071398 3300009553 Bacteria 3207
214 Ga0105249_10083725 3300009553 Bacteria 2969
215 Ga0105249_10278306 3300009553 Unclassified 1670
216 Ga0105239_10037099 3300010375 Bacteria 5346
217 Ga0105239_10648650 3300010375 Bacteria 1206
218 Ga0105246_10089250 3300011119 Unclassified 2217
219 Ga0105246_10144075 3300011119 Unclassified 1795
220 Ga0105246_10183159 3300011119 Bacteria 1614
221 Ga0157373_10022502 3300013100 Bacteria 4574
222 Ga0157371_10087768 3300013102 Unclassified 2202
223 Ga0157374_10008722 3300013296 Bacteria 8673
224 Ga0157374_10066785 3300013296 Bacteria 3380
225 Ga0157374_10258881 3300013296 Unclassified 1713
226 Ga0157378_10001621 3300013297 Bacteria 20349
227 Ga0157378_10014769 3300013297 Bacteria 6840
228 Ga0157378_10017588 3300013297 Bacteria 6277
229 Ga0157378_10019969 3300013297 Bacteria 5892
230 Ga0157378_10075147 3300013297 Unclassified 3041
231 Ga0163162_10001376 3300013306 Bacteria 22623
232 Ga0163162_10029684 3300013306 Bacteria 5412
233 Ga0163162_10164607 3300013306 Bacteria 2341
234 Ga0163162_10389540 3300013306 Bacteria 1526
235 Ga0157372_10380718 3300013307 Bacteria 1644
236 Ga0157375_10013404 3300013308 Bacteria 7293
237 Ga0157375_10018850 3300013308 Bacteria 6264
238 Ga0163163_10000298 3300014325 Bacteria 49128
239 Ga0163163_10000769 3300014325 Bacteria 27193
240 Ga0163163_10002579 3300014325 Bacteria 15355
241 Ga0163163_10012060 3300014325 Bacteria 7862
242 Ga0163163_10014737 3300014325 Bacteria 7194
243 Ga0163163_10270845 3300014325 Bacteria 1749
244 Ga0163163_10354321 3300014325 Bacteria 1524
245 Ga0157380_10078384 3300014326 Bacteria 2695
246 Ga0157377_10042660 3300014745 Bacteria 2520
247 Ga0157377_10101064 3300014745 Bacteria 1718
248 Ga0157379_10017218 3300014968 Bacteria 6366
249 Ga0157376_10059595 3300014969 Unclassified 3201
250 Ga0163161_10011109 3300017792 Bacteria 6239
251 Ga0207656_10006874 3300025321 Bacteria 4120
252 Ga0207653_10004935 3300025885 Bacteria 4168
253 Ga0207710_10000575 3300025900 Bacteria 21826
254 Ga0207688_10092032 3300025901 Unclassified 1742
255 Ga0207680_10056806 3300025903 Unclassified 2366
256 Ga0207647_10029076 3300025904 Bacteria 3581
257 Ga0207643_10001070 3300025908 Bacteria 16179
258 Ga0207643_10012091 3300025908 Bacteria 4663
259 Ga0207643_10040914 3300025908 Unclassified 2611
260 Ga0207684_10000053 3300025910 Bacteria 225260
261 Ga0207684_10066395 3300025910 Bacteria 3064
262 Ga0207654_10061249 3300025911 Unclassified 2201
263 Ga0207654_10111879 3300025911 Bacteria 1700
264 Ga0207707_10000033 3300025912 Bacteria 158362
265 Ga0207707_10024311 3300025912 Bacteria 5303
266 Ga0207707_10063868 3300025912 Bacteria 3204
267 Ga0207671_10130266 3300025914 Bacteria 1930
268 Ga0207660_10000364 3300025917 Bacteria 29558
269 Ga0207660_10132655 3300025917 Bacteria 1897
270 Ga0207662_10001312 3300025918 Bacteria 11980
271 Ga0207662_10002574 3300025918 Bacteria 9138
272 Ga0207649_10144140 3300025920 Unclassified 1633
273 Ga0207652_10000032 3300025921 Bacteria 143319
274 Ga0207652_10041807 3300025921 Unclassified 3899
275 Ga0207652_10107532 3300025921 Unclassified 2471
276 Ga0207646_10037964 3300025922 Bacteria 4341
277 Ga0207681_10008845 3300025923 Bacteria 6153
278 Ga0207681_10034545 3300025923 Bacteria 3325
279 Ga0207694_10005155 3300025924 Bacteria 10087
280 Ga0207650_10000007 3300025925 Bacteria 530810
281 Ga0207650_10003532 3300025925 Bacteria 10729
282 Ga0207650_10165054 3300025925 Unclassified 1757
283 Ga0207687_10104751 3300025927 Unclassified 2089
284 Ga0207644_10001852 3300025931 Bacteria 13770
285 Ga0207644_10113558 3300025931 Bacteria 2051
286 Ga0207690_10145910 3300025932 Unclassified 1749
287 Ga0207706_10045479 3300025933 Unclassified 3889
288 Ga0207706_10053637 3300025933 Bacteria 3559
289 Ga0207709_10002610 3300025935 Bacteria 11221
290 Ga0207670_10000302 3300025936 Bacteria 29606
291 Ga0207670_10040031 3300025936 Unclassified 3074
292 Ga0207670_10075042 3300025936 Bacteria 2349
293 Ga0207704_10116913 3300025938 Unclassified 1815
294 Ga0207691_10003495 3300025940 Bacteria 15288
295 Ga0207691_10119104 3300025940 Unclassified 2341
296 Ga0207711_10006732 3300025941 Bacteria 9670
297 Ga0207711_10022200 3300025941 Bacteria 5307
298 Ga0207711_10024891 3300025941 Bacteria 5021
299 Ga0207711_10078058 3300025941 Unclassified 2887
300 Ga0207711_10085147 3300025941 Unclassified 2769
301 Ga0207711_10154112 3300025941 Unclassified 2075
302 Ga0207689_10002931 3300025942 Bacteria 15750
303 Ga0207689_10190448 3300025942 Bacteria 1692
304 Ga0207689_10348695 3300025942 Bacteria 1230
305 Ga0207679_10243825 3300025945 Bacteria 1524
306 Ga0207651_10215317 3300025960 Unclassified 1549
307 Ga0207712_10044696 3300025961 Bacteria 3063
308 Ga0207712_10153245 3300025961 Unclassified 1782
309 Ga0207640_10068563 3300025981 Bacteria 2378
310 Ga0207658_10223266 3300025986 Bacteria 1586
311 Ga0207677_10012372 3300026023 Unclassified 4904
312 Ga0207677_10018190 3300026023 Bacteria 4213
313 Ga0207703_10007918 3300026035 Bacteria 8402
314 Ga0207703_10094852 3300026035 Unclassified 2516
315 Ga0207703_10119766 3300026035 Bacteria 2258
316 Ga0207703_10181170 3300026035 Unclassified 1859
317 Ga0207639_10014288 3300026041 Bacteria 5579
318 Ga0207639_10456998 3300026041 Bacteria 1160
319 Ga0207708_10000096 3300026075 Bacteria 67574
320 Ga0207708_10010643 3300026075 Bacteria 6832
321 Ga0207708_10017998 3300026075 Bacteria 5317
322 Ga0207708_10033522 3300026075 Bacteria 3902
323 Ga0207708_10083556 3300026075 Unclassified 2455
324 Ga0207702_10017905 3300026078 Bacteria 5863
325 Ga0207641_10182422 3300026088 Unclassified 1923
326 Ga0207641_10182505 3300026088 Bacteria 1923
327 Ga0207641_10188298 3300026088 Bacteria 1895
328 Ga0207641_10212168 3300026088 Bacteria 1791
329 Ga0207641_10294213 3300026088 Unclassified 1531
330 Ga0207641_10321750 3300026088 Bacteria 1467
331 Ga0207648_10001293 3300026089 Bacteria 27927
332 Ga0207676_10000399 3300026095 Bacteria 36665
333 Ga0207676_10014424 3300026095 Bacteria 5686
334 Ga0207676_10041329 3300026095 Bacteria 3538
335 Ga0207676_10101625 3300026095 Unclassified 2384
336 Ga0207674_10000058 3300026116 Bacteria 113012
337 Ga0207674_10011925 3300026116 Bacteria 9744
338 Ga0207674_10052620 3300026116 Bacteria 4153
339 Ga0207674_10057789 3300026116 Bacteria 3932
340 Ga0207674_10117780 3300026116 Unclassified 2626
341 Ga0207674_10243059 3300026116 Unclassified 1747
342 Ga0207675_100001820 3300026118 Bacteria 21377
343 Ga0207675_100004324 3300026118 Bacteria 13722
344 Ga0207675_100019317 3300026118 Bacteria 6358
345 Ga0207675_100019836 3300026118 Bacteria 6274
346 Ga0207698_10036731 3300026142 Unclassified 3600
347 Ga0207698_10147730 3300026142 Unclassified 2035
348 Ga0207428_10004223 3300027907 Bacteria 13752
349 Ga0207428_10022597 3300027907 Bacteria 5304
350 Ga0268264_10012212 3300028381 Bacteria 7068
351 Ga0268264_10013749 3300028381 Bacteria 6657
352 Ga0268264_10024562 3300028381 Bacteria 4920
353 Ga0268264_10027735 3300028381 Unclassified 4629
354 Ga0268264_10108580 3300028381 Unclassified 2426
355 Ga0268264_10128970 3300028381 Bacteria 2239
356 Ga0307408_100219365 3300031548 Unclassified 1551
357 Ga0307405_10018719 3300031731 Bacteria 3828
358 Ga0307405_10035287 3300031731 Unclassified 2985
359 Ga0307405_10182458 3300031731 Unclassified 1508
360 Ga0307412_10119640 3300031911 Bacteria 1894
361 Ga0307409_100100009 3300031995 Unclassified 2403
362 Ga0307416_100001340 3300032002 Bacteria 13264
363 Ga0307416_100262859 3300032002 Bacteria 1688
364 Ga0307414_10002865 3300032004 Bacteria 9109
365 Ga0307414_10234309 3300032004 Unclassified 1516
366 Ga0307411_10012047 3300032005 Bacteria 4698
367 Ga0307411_10022297 3300032005 Unclassified 3725
368 Ga0307415_100044322 3300032126 Bacteria 2973
369 Ga0307415_100153005 3300032126 Bacteria 1778
370 Ga0307415_100156503 3300032126 Unclassified 1760
371 Ga0373939_0072543 3300035114 Unclassified 1125
372 Ga0395900_0172382 3300037418 Bacteria 2202
373 Ga0395898_0037076 3300037466 Unclassified 4838
374 Ga0395898_0062313 3300037466 Bacteria 3622
375 Ga0242420_000546 3300038996 Bacteria 4334
376 Ga0242420_028435 3300038996 Bacteria 1029
377 Ga0439448_0002694 3300042005 Bacteria 4849
378 Ga0439458_0005906 3300042157 Unclassified 2742
379 Ga0453683_0054188 3300044673 Unclassified 2510
380 Ga0451576_0110714 3300045051 Bacteria 2858
381 Ga0496102_0348628 3300048905 Bacteria 1394
382 Ga0496104_0116608 3300048907 Bacteria 2563
383 Ga0496106_0008743 3300048909 Bacteria 7490
384 Ga0496108_0048646 3300048911 Bacteria 3545
385 Ga0496112_0149559 3300048915 Unclassified 2303
386 Ga0501292_003761 3300049515 Bacteria 2044
387 Ga0501292_005343 3300049515 Unclassified 1789
388 Ga0501292_014246 3300049515 Bacteria 1231
389 Ga0501296_001348 3300049519 Unclassified 2483
390 Ga0501298_009427 3300049521 Bacteria 1661
391 Ga0501299_000194 3300049522 Bacteria 6846
392 Ga0501077_0167766 3300049593 Unclassified 1395
393 Ga0501198_003557 3300049649 Unclassified 2133
394 Ga0501202_008620 3300049652 Unclassified 1860
395 Ga0501217_001441 3300049661 Bacteria 4459
396 Ga0501223_003849 3300049663 Bacteria 3242
397 Ga0501224_003884 3300049664 Bacteria 2105
398 Ga0501235_003577 3300049669 Bacteria 3358
399 Ga0501243_011667 3300049675 Bacteria 1380
400 Ga0501249_059098 3300049679 Unclassified 887
401 Ga0501257_055209 3300049686 Unclassified 996
402 Ga0501259_025603 3300049688 Bacteria 1081
403 Ga0501261_022150 3300049690 Unclassified 918
404 Ga0501225_0000502 3300049705 Bacteria 12197
405 Ga0501265_017790 3300049762 Unclassified 935
406 Ga0501273_012338 3300049770 Unclassified 1075
407 Ga0501283_009538 3300049779 Unclassified 1416
408 Ga0501212_005858 3300049851 Unclassified 1640
409 nmdc:mga05p37_269548_c1 3300050507 Bacteria 2035
410 nmdc:mga05p37_83335_c1 3300050507 Bacteria 3939
411 nmdc:mga05p37_928421_c1 3300050507 Unclassified 934
412 nmdc:mga09592_166202_c1 3300050508 Unclassified 1907
413 nmdc:mga0qj67_15233_c1 3300050509 Bacteria 5820
414 nmdc:mga08y16_221438_c1 3300050511 Bacteria 1959
415 nmdc:mga08y16_35054_c1 3300050511 Bacteria 5271
416 nmdc:mga0n895_131914_c1 3300050512 Bacteria 2524
417 nmdc:mga0n895_166177_c1 3300050512 Bacteria 2238
418 nmdc:mga0n895_240145_c1 3300050512 Bacteria 1838
419 nmdc:mga0rr50_91185_c1 3300050513 Unclassified 2373
420 nmdc:mga0a205_305652_c1 3300050515 Unclassified 1463
421 nmdc:mga0a205_40091_c1 3300050515 Bacteria 4508
422 nmdc:mga0a205_55906_c1 3300050515 Unclassified 3810
423 nmdc:mga0a205_87333_c1 3300050515 Unclassified 3013
424 Ga0530510_0021381 3300061734 Bacteria 4604
425 Ga0207689_10010733
426 SwRhRL3b_contig_1519857
427 SwRhRL2b_contig_845468
428 MBSR1b_contig_12882258
429 JGI24751J29686_10000003
430 JGI25406J46586_10002532
431 rootH2_10122934
432 rootL2_10094511
433 Ga0065714_10064425
434 Ga0065704_10001506
435 Ga0065704_10011641
436 Ga0065704_10074150
437 Ga0065712_10001188
438 Ga0065712_10067727
439 Ga0065712_10155387
440 Ga0065715_10009943
441 Ga0065707_10000669
442 Ga0070690_100007988
443 Ga0070690_100095802
444 Ga0070690_100256955
445 Ga0070670_100000167
446 Ga0070670_100005870
447 Ga0070670_100057889
448 Ga0070670_100063589
449 Ga0070670_100247723
450 Ga0070670_100419784
451 Ga0068869_100001808
452 Ga0068869_100054819
453 Ga0068869_100078320
454 Ga0068869_100156661
455 Ga0070666_10005120
456 Ga0070680_100001034
457 Ga0070680_100253281
458 Ga0070680_100270795
459 Ga0070682_100004202
460 Ga0068868_100118107
461 Ga0068868_100328502
462 Ga0070689_100009282
463 Ga0070691_10152702
464 Ga0070687_100124632
465 Ga0070661_100015315
466 Ga0070692_10009702
467 Ga0070692_10074969
468 Ga0070669_100002809
469 Ga0070669_100009819
470 Ga0070669_100051069
471 Ga0070675_100134227
472 Ga0070675_100188286
473 Ga0070671_100008257
474 Ga0070671_100052446
475 Ga0070671_100053673
476 Ga0070673_100403334
477 Ga0070659_100018959
478 Ga0070659_100037396
479 Ga0070659_100065761
480 Ga0070667_100160093
481 Ga0070701_10114135
482 Ga0070705_100043841
483 Ga0070700_100000228
484 Ga0070700_100015627
485 Ga0070700_100016509
486 Ga0070700_100054577
487 Ga0070694_100026498
488 Ga0070694_100066930
489 Ga0070694_100112814
490 Ga0070694_100173768
491 Ga0070662_100062161
492 Ga0070681_10001694
493 Ga0070681_10166124
494 Ga0068867_100006107
495 Ga0068867_100103331
496 Ga0070706_100000053
497 Ga0070706_100021996
498 Ga0070706_100224950
499 Ga0070707_100018687
500 Ga0070698_100002114
501 Ga0070698_100049930
502 Ga0070698_100186277
503 Ga0070699_100001150
504 Ga0070699_100062584
505 Ga0070679_100001724
506 Ga0070679_100030693
507 Ga0070679_100148117
508 Ga0070697_100030982
509 Ga0070697_100089390
510 Ga0070697_100325507
511 Ga0068853_100005108
512 Ga0068853_100072537
513 Ga0070672_100093965
514 Ga0070695_100024694
515 Ga0070695_100025595
516 Ga0070695_100045691
517 Ga0070695_100176194
518 Ga0070696_100087078
519 Ga0070696_100292183
520 Ga0070696_100388395
521 Ga0070693_100090609
522 Ga0070665_100046703
523 Ga0070704_100199312
524 Ga0070704_100385404
525 Ga0068855_100042889
526 Ga0068857_100069054
527 Ga0068857_100070203
528 Ga0068857_100138686
529 Ga0068857_100174028
530 Ga0068857_100371022
531 Ga0068854_100100996
532 Ga0068854_100110329
533 Ga0068854_100143268
534 Ga0070702_100027678
535 Ga0070702_100096991
536 Ga0068852_100138729
537 Ga0068859_100000994
538 Ga0068859_100011729
539 Ga0068859_100027173
540 Ga0068859_100070789
541 Ga0068859_100099877
542 Ga0068859_100150303
543 Ga0068859_100166210
544 Ga0068859_100289644
545 Ga0068859_100307929
546 Ga0068859_100339091
547 Ga0068859_100390890
548 Ga0068864_100002954
549 Ga0068864_100105280
550 Ga0068864_100307973
551 Ga0068864_100314781
552 Ga0068864_100429904
553 Ga0068861_100031612
554 Ga0068861_100160325
555 Ga0068851_10006646
556 Ga0068851_10150073
557 Ga0068870_10048215
558 Ga0068863_100012803
559 Ga0068863_100033603
560 Ga0068863_100034835
561 Ga0068863_100150589
562 Ga0068863_100192441
563 Ga0068863_100311804
564 Ga0068863_100501175
565 Ga0068858_100015277
566 Ga0068858_100033218
567 Ga0068858_100054762
568 Ga0068858_100559723
569 Ga0068860_100009347
570 Ga0068860_100018750
571 Ga0068860_100122168
572 Ga0068860_100154238
573 Ga0068860_100201425
574 Ga0068860_100235805
575 Ga0068860_100258981
576 Ga0081539_10001126
577 Ga0075432_10022457
578 Ga0097621_100006570
579 Ga0068871_100003178
580 Ga0068871_100011532
581 Ga0068871_100051366
582 Ga0068871_100129686
583 Ga0075428_100078419
584 Ga0075430_100013584
585 Ga0075431_100120501
586 Ga0075433_10018022
587 Ga0075433_10021522
588 Ga0075434_100019314
589 Ga0075434_100028639
590 Ga0075434_100089150
591 Ga0075434_100193080
592 Ga0075434_100255062
593 Ga0075429_100061884
594 Ga0075429_100141019
595 Ga0068865_100023447
596 Ga0068865_100109172
597 Ga0097620_100000994
598 Ga0097620_100011729
599 Ga0097620_100027173
600 Ga0097620_100070793
601 Ga0097620_100099876
602 Ga0097620_100111905
603 Ga0097620_100150306
604 Ga0097620_100166211
605 Ga0097620_100289646
606 Ga0097620_100307934
607 Ga0097620_100339088
608 Ga0097620_100390886
609 Ga0075435_100012283
610 Ga0075435_100178927
611 Ga0105240_10258299
612 Ga0111539_10001706
613 Ga0111539_10049506
614 Ga0111539_10183597
615 Ga0111539_10760572
616 Ga0105245_10406399
617 Ga0114129_10037625
618 Ga0114129_10578386
619 Ga0105243_10004535
620 Ga0105243_10006086
621 Ga0105243_10022334
622 Ga0105241_10009798
623 Ga0105241_10276557
624 Ga0105242_10002161
625 Ga0105242_10297941
626 Ga0105242_10375593
627 Ga0105248_10005966
628 Ga0105248_10012443
629 Ga0105248_10043902
630 Ga0105248_10087033
631 Ga0105248_10104694
632 Ga0105248_10510751
633 Ga0105237_10001338
634 Ga0105237_10054375
635 Ga0105238_10006965
636 Ga0105238_10008039
637 Ga0105249_10071398
638 Ga0105249_10083725
639 Ga0105249_10278306
640 Ga0105239_10037099
641 Ga0105239_10648650
642 Ga0105246_10089250
643 Ga0105246_10144075
644 Ga0105246_10183159
645 Ga0157373_10022502
646 Ga0157371_10087768
647 Ga0157374_10008722
648 Ga0157374_10066785
649 Ga0157374_10258881
650 Ga0157378_10001621
651 Ga0157378_10014769
652 Ga0157378_10017588
653 Ga0157378_10019969
654 Ga0157378_10075147
655 Ga0163162_10001376
656 Ga0163162_10029684
657 Ga0163162_10164607
658 Ga0163162_10389540
659 Ga0157372_10380718
660 Ga0157375_10013404
661 Ga0157375_10018850
662 Ga0163163_10000298
663 Ga0163163_10000769
664 Ga0163163_10002579
665 Ga0163163_10012060
666 Ga0163163_10014737
667 Ga0163163_10270845
668 Ga0163163_10354321
669 Ga0157380_10078384
670 Ga0157377_10042660
671 Ga0157377_10101064
672 Ga0157379_10017218
673 Ga0157376_10059595
674 Ga0163161_10011109
675 Ga0207656_10006874
676 Ga0207653_10004935
677 Ga0207710_10000575
678 Ga0207688_10092032
679 Ga0207680_10056806
680 Ga0207647_10029076
681 Ga0207643_10001070
682 Ga0207643_10012091
683 Ga0207643_10040914
684 Ga0207684_10000053
685 Ga0207684_10066395
686 Ga0207654_10061249
687 Ga0207654_10111879
688 Ga0207707_10000033
689 Ga0207707_10024311
690 Ga0207707_10063868
691 Ga0207671_10130266
692 Ga0207660_10000364
693 Ga0207660_10132655
694 Ga0207662_10001312
695 Ga0207662_10002574
696 Ga0207649_10144140
697 Ga0207652_10000032
698 Ga0207652_10041807
699 Ga0207652_10107532
700 Ga0207646_10037964
701 Ga0207681_10008845
702 Ga0207681_10034545
703 Ga0207694_10005155
704 Ga0207650_10000007
705 Ga0207650_10003532
706 Ga0207650_10165054
707 Ga0207687_10104751
708 Ga0207644_10001852
709 Ga0207644_10113558
710 Ga0207690_10145910
711 Ga0207706_10045479
712 Ga0207706_10053637
713 Ga0207709_10002610
714 Ga0207670_10000302
715 Ga0207670_10040031
716 Ga0207670_10075042
717 Ga0207704_10116913
718 Ga0207691_10003495
719 Ga0207691_10119104
720 Ga0207711_10006732
721 Ga0207711_10022200
722 Ga0207711_10024891
723 Ga0207711_10078058
724 Ga0207711_10085147
725 Ga0207711_10154112
726 Ga0207689_10002931
727 Ga0207689_10190448
728 Ga0207689_10348695
729 Ga0207679_10243825
730 Ga0207651_10215317
731 Ga0207712_10044696
732 Ga0207712_10153245
733 Ga0207640_10068563
734 Ga0207658_10223266
735 Ga0207677_10012372
736 Ga0207677_10018190
737 Ga0207703_10007918
738 Ga0207703_10094852
739 Ga0207703_10119766
740 Ga0207703_10181170
741 Ga0207639_10014288
742 Ga0207639_10456998
743 Ga0207708_10000096
744 Ga0207708_10010643
745 Ga0207708_10017998
746 Ga0207708_10033522
747 Ga0207708_10083556
748 Ga0207702_10017905
749 Ga0207641_10182422
750 Ga0207641_10182505
751 Ga0207641_10188298
752 Ga0207641_10212168
753 Ga0207641_10294213
754 Ga0207641_10321750
755 Ga0207648_10001293
756 Ga0207676_10000399
757 Ga0207676_10014424
758 Ga0207676_10041329
759 Ga0207676_10101625
760 Ga0207674_10000058
761 Ga0207674_10011925
762 Ga0207674_10052620
763 Ga0207674_10057789
764 Ga0207674_10117780
765 Ga0207674_10243059
766 Ga0207675_100001820
767 Ga0207675_100004324
768 Ga0207675_100019317
769 Ga0207675_100019836
770 Ga0207698_10036731
771 Ga0207698_10147730
772 Ga0207428_10004223
773 Ga0207428_10022597
774 Ga0268264_10012212
775 Ga0268264_10013749
776 Ga0268264_10024562
777 Ga0268264_10027735
778 Ga0268264_10108580
779 Ga0268264_10128970
780 Ga0307408_100219365
781 Ga0307405_10018719
782 Ga0307405_10035287
783 Ga0307405_10182458
784 Ga0307412_10119640
785 Ga0307409_100100009
786 Ga0307416_100001340
787 Ga0307416_100262859
788 Ga0307414_10002865
789 Ga0307414_10234309
790 Ga0307411_10012047
791 Ga0307411_10022297
792 Ga0307415_100044322
793 Ga0307415_100153005
794 Ga0307415_100156503
795 Ga0373939_0072543
796 Ga0395900_0172382
797 Ga0395898_0037076
798 Ga0395898_0062313
799 Ga0242420_000546
800 Ga0242420_028435
801 Ga0439448_0002694
802 Ga0439458_0005906
803 Ga0453683_0054188
804 Ga0451576_0110714
805 Ga0496102_0348628
806 Ga0496104_0116608
807 Ga0496106_0008743
808 Ga0496108_0048646
809 Ga0496112_0149559
810 Ga0501292_003761
811 Ga0501292_005343
812 Ga0501292_014246
813 Ga0501296_001348
814 Ga0501298_009427
815 Ga0501299_000194
816 Ga0501077_0167766
817 Ga0501198_003557
818 Ga0501202_008620
819 Ga0501217_001441
820 Ga0501223_003849
821 Ga0501224_003884
822 Ga0501235_003577
823 Ga0501243_011667
824 Ga0501249_059098
825 Ga0501257_055209
826 Ga0501259_025603
827 Ga0501261_022150
828 Ga0501225_0000502
829 Ga0501265_017790
830 Ga0501273_012338
831 Ga0501283_009538
832 Ga0501212_005858
833 nmdc:mga05p37_269548_c1
834 nmdc:mga05p37_83335_c1
835 nmdc:mga05p37_928421_c1
836 nmdc:mga09592_166202_c1
837 nmdc:mga0qj67_15233_c1
838 nmdc:mga08y16_221438_c1
839 nmdc:mga08y16_35054_c1
840 nmdc:mga0n895_131914_c1
841 nmdc:mga0n895_166177_c1
842 nmdc:mga0n895_240145_c1
843 nmdc:mga0rr50_91185_c1
844 nmdc:mga0a205_305652_c1
845 nmdc:mga0a205_40091_c1
846 nmdc:mga0a205_55906_c1
847 nmdc:mga0a205_87333_c1
848 Ga0530510_0021381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

156

336

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iqj-assembly3.cif.gz_C 1.9 angstrom crystal structure of protein with unknown function from vibrio cholerae. 0.7281 103 181
5iqj-assembly2.cif.gz_B 1.9 angstrom crystal structure of protein with unknown function from vibrio cholerae. 0.6096 103 182
3b4r-assembly1.cif.gz_B site-2 protease from methanocaldococcus jannaschii 0.5197 73 303
7w6x-assembly1.cif.gz_A crystal structure of e. coli rsep in complex with batimastat 0.4816 98 202
3b4r-assembly1.cif.gz_B site-2 protease from methanocaldococcus jannaschii 0.4776 73 303
ID Description Score Start End Superfamily
af_P9WL19_2_134_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5147 101 192 3.30.300.20
af_P9WL19_2_134_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.389 101 192 3.30.300.20
2h8oA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.3457 25 298 1.10.600.10
af_Q21304_71_257_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.3254 103 297 1.20.1510.10
af_Q4CNX6_1_105_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.3122 95 169 3.30.300.10
ID Description Score Start End GO Terms
AF-A0A838RY46-F1-model_v4 Site-2 protease family protein 0.9541 30 242 GO:0006508
GO:0008233
GO:0016020
AF-A0A2V8QZC9-F1-model_v4 Peptidase M50 domain-containing protein 0.9449 18 337 GO:0006508
GO:0016020
AF-A0A838RY46-F1-model_v4 Site-2 protease family protein 0.9413 30 242 GO:0006508
GO:0008233
GO:0016020
AF-A0A2V8QZC9-F1-model_v4 Peptidase M50 domain-containing protein 0.9336 18 337 GO:0006508
GO:0016020
AF-A0A357F0Z1-F1-model_v4 Peptidase M50 domain-containing protein 0.9321 224 337 GO:0006508
GO:0016020

Map