F440752

General Info

Members Datasets Scaffolds Average Seq Length
424 289 848 170

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10121412|Ga0157374_101214121
Length 191
Sequence MKAEELRAVQAPLKERYRETPNAALVTLRAQGRLGDGVSCKIETGKALVVAGLHPATGGSGQAACSGDMLLEALVACAGVTLNAVATALGIQLRDASLQAEGDLDFRGTLGVSKEVPVGFQNIRLQISLDTDASEEQVATLLRLTERYCVVFQTLAHPPALEVVRLAQLGVGAVEAVELLPLCIQISEEAS

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
247 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
257 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
258 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
259 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
260 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
261 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
262 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
265 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
266 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
267 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
268 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
269 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
272 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
273 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
274 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
275 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 1.42
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10121412 3300013296 Bacteria 2522
2 Ga0058859_11660433 3300004798 Bacteria 1081
3 Ga0058860_10669902 3300004801 Bacteria 624
4 Ga0065715_10120258 3300005293 Bacteria 2184
5 Ga0070658_11351898 3300005327 Bacteria 618
6 Ga0070676_10010671 3300005328 Bacteria 4985
7 Ga0070690_100193492 3300005330 Bacteria 1411
8 Ga0070690_101245589 3300005330 Bacteria 595
9 Ga0068869_100029655 3300005334 Bacteria 3835
10 Ga0070666_10088103 3300005335 Bacteria 2129
11 Ga0070666_10167882 3300005335 Bacteria 1536
12 Ga0068868_100064282 3300005338 Bacteria 2913
13 Ga0068868_100069482 3300005338 Bacteria 2807
14 Ga0068868_100252342 3300005338 Bacteria 1485
15 Ga0070660_100454902 3300005339 Bacteria 1062
16 Ga0070687_100152695 3300005343 Bacteria 1357
17 Ga0070661_100409646 3300005344 Bacteria 1073
18 Ga0070692_10291406 3300005345 Unclassified 993
19 Ga0070668_100080690 3300005347 Bacteria 2549
20 Ga0070669_100264670 3300005353 Bacteria 1373
21 Ga0070671_100005385 3300005355 Bacteria 10203
22 Ga0070671_100006816 3300005355 Bacteria 9143
23 Ga0070671_100095247 3300005355 Bacteria 2495
24 Ga0070671_100185998 3300005355 Bacteria 1760
25 Ga0070671_100270232 3300005355 Bacteria 1445
26 Ga0070674_100088714 3300005356 Bacteria 2226
27 Ga0070673_100495019 3300005364 Bacteria 1105
28 Ga0070659_101207182 3300005366 Bacteria 669
29 Ga0070667_100002072 3300005367 Bacteria 17742
30 Ga0070709_10002897 3300005434 Bacteria 9250
31 Ga0070709_10756397 3300005434 Bacteria 760
32 Ga0070714_100073634 3300005435 Bacteria 2960
33 Ga0070714_100255332 3300005435 Bacteria 1622
34 Ga0070713_100000007 3300005436 Bacteria 186402
35 Ga0070710_10003527 3300005437 Bacteria 7413
36 Ga0070701_10046729 3300005438 Bacteria 2227
37 Ga0070711_100271237 3300005439 Bacteria 1339
38 Ga0070705_100016876 3300005440 Bacteria 3802
39 Ga0070694_100002025 3300005444 Bacteria 12030
40 Ga0070694_100015679 3300005444 Bacteria 4763
41 Ga0070708_100180451 3300005445 Bacteria 1973
42 Ga0070708_100477545 3300005445 Bacteria 1176
43 Ga0070663_100498957 3300005455 Unclassified 1010
44 Ga0070678_100180239 3300005456 Bacteria 1728
45 Ga0070678_101074089 3300005456 Bacteria 742
46 Ga0070662_100065353 3300005457 Bacteria 2666
47 Ga0070662_100113980 3300005457 Bacteria 2063
48 Ga0070662_100225651 3300005457 Bacteria 1496
49 Ga0070681_10621358 3300005458 Bacteria 995
50 Ga0068867_100047824 3300005459 Bacteria 3146
51 Ga0068867_100242113 3300005459 Bacteria 1463
52 Ga0068867_100246675 3300005459 Bacteria 1451
53 Ga0070685_10199615 3300005466 Bacteria 1299
54 Ga0070685_10498038 3300005466 Bacteria 862
55 Ga0070698_100007624 3300005471 Bacteria 11713
56 Ga0070698_100213770 3300005471 Bacteria 1863
57 Ga0070698_100335768 3300005471 Bacteria 1443
58 Ga0070699_100075866 3300005518 Bacteria 2926
59 Ga0070679_100105113 3300005530 Bacteria 2810
60 Ga0070679_100260430 3300005530 Bacteria 1690
61 Ga0070684_100347474 3300005535 Unclassified 1364
62 Ga0070672_100106420 3300005543 Unclassified 2282
63 Ga0070672_100125080 3300005543 Bacteria 2108
64 Ga0070672_100208669 3300005543 Bacteria 1635
65 Ga0070686_100155852 3300005544 Unclassified 1604
66 Ga0070695_100004574 3300005545 Bacteria 8115
67 Ga0070695_100230611 3300005545 Bacteria 1338
68 Ga0070696_100058959 3300005546 Bacteria 2682
69 Ga0070693_100072048 3300005547 Bacteria 2037
70 Ga0070665_100671813 3300005548 Bacteria 1049
71 Ga0070665_101049949 3300005548 Bacteria 827
72 Ga0070704_100072456 3300005549 Bacteria 2506
73 Ga0068855_100010598 3300005563 Bacteria 11112
74 Ga0068855_101000838 3300005563 Bacteria 878
75 Ga0068855_101489638 3300005563 Bacteria 695
76 Ga0070664_100282891 3300005564 Bacteria 1496
77 Ga0070664_101284399 3300005564 Bacteria 691
78 Ga0068857_101756228 3300005577 Bacteria 607
79 Ga0068854_100278080 3300005578 Bacteria 1347
80 Ga0068854_100310550 3300005578 Bacteria 1279
81 Ga0068856_100001159 3300005614 Bacteria 27719
82 Ga0070702_100058804 3300005615 Bacteria 2229
83 Ga0070702_100437884 3300005615 Bacteria 945
84 Ga0070702_100587340 3300005615 Bacteria 833
85 Ga0068852_100030285 3300005616 Bacteria 4453
86 Ga0068852_100252280 3300005616 Bacteria 1691
87 Ga0068852_100582390 3300005616 Bacteria 1122
88 Ga0068852_100959573 3300005616 Bacteria 873
89 Ga0068852_101069927 3300005616 Unclassified 826
90 Ga0068852_101071597 3300005616 Bacteria 826
91 Ga0068859_100253395 3300005617 Bacteria 1851
92 Ga0068859_100403480 3300005617 Bacteria 1463
93 Ga0068859_100916263 3300005617 Bacteria 961
94 Ga0068859_100990733 3300005617 Bacteria 923
95 Ga0068864_100574726 3300005618 Bacteria 1091
96 Ga0068866_10001847 3300005718 Bacteria 8881
97 Ga0068861_100184403 3300005719 Bacteria 1739
98 Ga0068851_10189106 3300005834 Bacteria 1144
99 Ga0068863_100145148 3300005841 Bacteria 2269
100 Ga0068863_100696188 3300005841 Bacteria 1010
101 Ga0068858_100123644 3300005842 Bacteria 2421
102 Ga0068860_100191137 3300005843 Bacteria 1981
103 Ga0068860_100200724 3300005843 Bacteria 1932
104 Ga0070715_10291563 3300006163 Bacteria 869
105 Ga0070716_100028277 3300006173 Bacteria 3019
106 Ga0070716_101098503 3300006173 Unclassified 634
107 Ga0070712_100000032 3300006175 Bacteria 72134
108 Ga0075362_10094380 3300006177 Bacteria 1392
109 Ga0075366_10001656 3300006195 Bacteria 11187
110 Ga0075366_10093763 3300006195 Bacteria 1799
111 Ga0097621_100422389 3300006237 Bacteria 1197
112 Ga0075370_10000289 3300006353 Bacteria 18028
113 Ga0068871_100053505 3300006358 Bacteria 3272
114 Ga0068871_100197085 3300006358 Bacteria 1737
115 Ga0068871_101052013 3300006358 Bacteria 760
116 Ga0075428_100104470 3300006844 Bacteria 3089
117 Ga0075434_100696896 3300006871 Bacteria 1033
118 Ga0075429_100121196 3300006880 Bacteria 2286
119 Ga0068865_100347547 3300006881 Bacteria 1200
120 Ga0075436_100000213 3300006914 Bacteria 35642
121 Ga0097620_100253379 3300006931 Bacteria 1851
122 Ga0097620_100403398 3300006931 Bacteria 1463
123 Ga0097620_100916321 3300006931 Bacteria 961
124 Ga0097620_100990850 3300006931 Bacteria 923
125 Ga0075435_100153497 3300007076 Bacteria 1937
126 Ga0105240_10009431 3300009093 Bacteria 13816
127 Ga0105245_10102057 3300009098 Bacteria 2656
128 Ga0105245_10201870 3300009098 Bacteria 1910
129 Ga0114129_10049253 3300009147 Bacteria 5920
130 Ga0105241_10088076 3300009174 Bacteria 2444
131 Ga0105241_10221953 3300009174 Bacteria 1589
132 Ga0105242_10022548 3300009176 Bacteria 4954
133 Ga0105242_10076218 3300009176 Bacteria 2795
134 Ga0105248_10088772 3300009177 Bacteria 3480
135 Ga0105248_10140612 3300009177 Bacteria 2723
136 Ga0105248_10155405 3300009177 Bacteria 2581
137 Ga0105249_10231854 3300009553 Bacteria 1821
138 Ga0157374_10020062 3300013296 Bacteria 5926
139 Ga0157374_10252661 3300013296 Bacteria 1735
140 Ga0157374_12066975 3300013296 Bacteria 596
141 Ga0157375_10022015 3300013308 Bacteria 5861
142 Ga0157375_10168883 3300013308 Unclassified 2334
143 Ga0157375_10330067 3300013308 Bacteria 1690
144 Ga0157375_11344358 3300013308 Bacteria 841
145 Ga0157380_10117751 3300014326 Bacteria 2244
146 Ga0157379_10000451 3300014968 Bacteria 33228
147 Ga0157379_10034172 3300014968 Bacteria 4532
148 Ga0157379_10050386 3300014968 Bacteria 3717
149 Ga0157379_10434029 3300014968 Bacteria 1211
150 Ga0157379_11532319 3300014968 Bacteria 649
151 Ga0157376_10352319 3300014969 Bacteria 1409
152 Ga0157376_10589647 3300014969 Bacteria 1105
153 Ga0163161_10130855 3300017792 Bacteria 1893
154 Ga0207697_10006785 3300025315 Bacteria 5148
155 Ga0207682_10001614 3300025893 Bacteria 10359
156 Ga0207692_10045276 3300025898 Bacteria 2200
157 Ga0207642_10249072 3300025899 Bacteria 1007
158 Ga0207688_10096594 3300025901 Bacteria 1702
159 Ga0207680_10357836 3300025903 Bacteria 1026
160 Ga0207685_10281444 3300025905 Bacteria 816
161 Ga0207699_10000708 3300025906 Bacteria 15908
162 Ga0207699_10050972 3300025906 Bacteria 2444
163 Ga0207645_10004010 3300025907 Bacteria 10979
164 Ga0207645_10012014 3300025907 Bacteria 5888
165 Ga0207643_10011159 3300025908 Bacteria 4851
166 Ga0207654_10055408 3300025911 Bacteria 2295
167 Ga0207693_10000117 3300025915 Bacteria 71032
168 Ga0207663_10057659 3300025916 Bacteria 2448
169 Ga0207657_11016736 3300025919 Bacteria 636
170 Ga0207649_10466971 3300025920 Bacteria 955
171 Ga0207646_10109309 3300025922 Bacteria 2481
172 Ga0207646_10317554 3300025922 Bacteria 1408
173 Ga0207681_10321411 3300025923 Bacteria 1231
174 Ga0207650_10529762 3300025925 Bacteria 986
175 Ga0207659_10134364 3300025926 Bacteria 1913
176 Ga0207659_10579624 3300025926 Bacteria 955
177 Ga0207687_10023700 3300025927 Bacteria 4094
178 Ga0207700_10000014 3300025928 Bacteria 229475
179 Ga0207664_10229053 3300025929 Bacteria 1615
180 Ga0207664_10433496 3300025929 Bacteria 1172
181 Ga0207644_10011653 3300025931 Bacteria 5823
182 Ga0207644_10014988 3300025931 Bacteria 5198
183 Ga0207644_10055238 3300025931 Bacteria 2862
184 Ga0207644_10098246 3300025931 Bacteria 2194
185 Ga0207644_10400234 3300025931 Bacteria 1122
186 Ga0207706_10016779 3300025933 Bacteria 6608
187 Ga0207706_10252841 3300025933 Bacteria 1539
188 Ga0207686_10132192 3300025934 Bacteria 1713
189 Ga0207709_10095703 3300025935 Bacteria 1952
190 Ga0207670_10014600 3300025936 Bacteria 4670
191 Ga0207704_10130062 3300025938 Bacteria 1742
192 Ga0207665_10008948 3300025939 Bacteria 6573
193 Ga0207691_10088903 3300025940 Unclassified 2770
194 Ga0207691_10125566 3300025940 Bacteria 2271
195 Ga0207711_10615712 3300025941 Bacteria 1013
196 Ga0207711_10736414 3300025941 Bacteria 919
197 Ga0207679_10359543 3300025945 Bacteria 1271
198 Ga0207679_10377197 3300025945 Bacteria 1242
199 Ga0207679_10673506 3300025945 Bacteria 937
200 Ga0207667_10043457 3300025949 Bacteria 4769
201 Ga0207667_11241644 3300025949 Bacteria 723
202 Ga0207651_10281107 3300025960 Bacteria 1375
203 Ga0207651_11156686 3300025960 Bacteria 694
204 Ga0207668_10052523 3300025972 Bacteria 2820
205 Ga0207640_10082431 3300025981 Bacteria 2202
206 Ga0207640_10174337 3300025981 Bacteria 1606
207 Ga0207658_10002349 3300025986 Bacteria 13901
208 Ga0207677_10073357 3300026023 Bacteria 2423
209 Ga0207677_10212770 3300026023 Bacteria 1545
210 Ga0207677_10648094 3300026023 Bacteria 932
211 Ga0207678_10567339 3300026067 Unclassified 993
212 Ga0207678_11037498 3300026067 Unclassified 726
213 Ga0207708_10003003 3300026075 Bacteria 12428
214 Ga0207702_10001629 3300026078 Bacteria 22196
215 Ga0207702_10362416 3300026078 Bacteria 1390
216 Ga0207641_10925534 3300026088 Bacteria 866
217 Ga0207641_11073987 3300026088 Bacteria 803
218 Ga0207648_10010662 3300026089 Bacteria 8688
219 Ga0207648_10027502 3300026089 Bacteria 5049
220 Ga0207648_10153912 3300026089 Bacteria 2029
221 Ga0207648_10248432 3300026089 Bacteria 1586
222 Ga0207676_10188581 3300026095 Bacteria 1812
223 Ga0207674_10074219 3300026116 Bacteria 3414
224 Ga0207675_100115456 3300026118 Bacteria 2537
225 Ga0207683_10099027 3300026121 Bacteria 2602
226 Ga0207683_10128814 3300026121 Bacteria 2275
227 Ga0207683_10502764 3300026121 Bacteria 1120
228 Ga0207698_10740410 3300026142 Bacteria 981
229 Ga0207698_10791124 3300026142 Bacteria 950
230 Ga0207698_11354265 3300026142 Bacteria 727
231 Ga0209969_1001143 3300027360 Bacteria 3642
232 Ga0209996_1007656 3300027395 Bacteria 1409
233 Ga0209999_1020454 3300027543 Bacteria 1215
234 Ga0209999_1039559 3300027543 Unclassified 883
235 Ga0209970_1032895 3300027614 Bacteria 906
236 Ga0209966_1001391 3300027695 Unclassified 4234
237 Ga0209998_10000412 3300027717 Bacteria 12143
238 Ga0209998_10051655 3300027717 Unclassified 953
239 Ga0209974_10005520 3300027876 Bacteria 4445
240 Ga0209974_10010747 3300027876 Unclassified 3084
241 Ga0207428_10167101 3300027907 Bacteria 1668
242 Ga0268266_10371030 3300028379 Bacteria 1348
243 Ga0268266_10555378 3300028379 Bacteria 1100
244 Ga0268264_10431848 3300028381 Bacteria 1272
245 Ga0268264_10540783 3300028381 Bacteria 1141
246 Ga0268264_11194842 3300028381 Bacteria 770
247 Ga0265318_10094697 3300028577 Bacteria 1099
248 Ga0307517_10186872 3300028786 Bacteria 1324
249 Ga0265338_10420735 3300028800 Bacteria 950
250 Ga0265330_10002071 3300031235 Bacteria 11094
251 Ga0265332_10006450 3300031238 Bacteria 5321
252 Ga0265332_10022420 3300031238 Bacteria 2786
253 Ga0265328_10001783 3300031239 Bacteria 9814
254 Ga0265320_10297964 3300031240 Bacteria 713
255 Ga0265325_10099145 3300031241 Bacteria 1428
256 Ga0265329_10013914 3300031242 Bacteria 2855
257 Ga0265329_10014484 3300031242 Bacteria 2781
258 Ga0265331_10001197 3300031250 Bacteria 19582
259 Ga0265331_10030326 3300031250 Bacteria 2692
260 Ga0265327_10002888 3300031251 Bacteria 17278
261 Ga0265316_10030767 3300031344 Bacteria 4395
262 Ga0265316_10095272 3300031344 Bacteria 2267
263 Ga0307513_10075840 3300031456 Bacteria 3490
264 Ga0307509_10266468 3300031507 Bacteria 1484
265 Ga0307408_100037023 3300031548 Bacteria 3434
266 Ga0316575_10160518 3300031665 Bacteria 929
267 Ga0265314_10012154 3300031711 Bacteria 7050
268 Ga0265314_10154924 3300031711 Bacteria 1400
269 Ga0265342_10009761 3300031712 Bacteria 6720
270 Ga0265342_10031379 3300031712 Bacteria 3285
271 Ga0307405_10058480 3300031731 Bacteria 2426
272 Ga0307413_10206110 3300031824 Bacteria 1424
273 Ga0307406_10392621 3300031901 Bacteria 1097
274 Ga0307412_10388020 3300031911 Bacteria 1133
275 Ga0307409_100011634 3300031995 Bacteria 5561
276 Ga0307414_10435672 3300032004 Bacteria 1146
277 Ga0307411_10645495 3300032005 Bacteria 916
278 Ga0307415_100610811 3300032126 Bacteria 972
279 Ga0307507_10219046 3300033179 Bacteria 1283
280 Ga0373926_0014492 3300035083 Bacteria 2681
281 Ga0373934_0000391 3300035086 Bacteria 15305
282 Ga0373934_0064185 3300035086 Bacteria 1465
283 Ga0373944_0043634 3300035089 Bacteria 1394
284 Ga0373923_0016826 3300035111 Bacteria 2786
285 Ga0373936_0013565 3300035113 Bacteria 3110
286 Ga0373945_0046134 3300035116 Bacteria 1589
287 Ga0373953_0005028 3300035117 Bacteria 4260
288 Ga0373954_0003733 3300035118 Bacteria 6490
289 Ga0373954_0129632 3300035118 Bacteria 1227
290 Ga0373956_0042419 3300035119 Bacteria 2022
291 Ga0373956_0047763 3300035119 Bacteria 1915
292 Ga0373957_0005284 3300035120 Bacteria 3996
293 Ga0373957_0061179 3300035120 Bacteria 1458
294 Ga0373960_0339827 3300035121 Unclassified 567
295 Ga0373943_0022072 3300035170 Bacteria 2945
296 Ga0373943_0182422 3300035170 Bacteria 1154
297 Ga0373943_0188803 3300035170 Bacteria 1136
298 Ga0373946_0011661 3300035171 Bacteria 3286
299 Ga0373946_0060149 3300035171 Bacteria 1614
300 Ga0373955_0020045 3300035172 Bacteria 3354
301 Ga0373955_0201272 3300035172 Bacteria 1185
302 Ga0373924_0007500 3300035410 Bacteria 3940
303 Ga0373924_0140118 3300035410 Bacteria 1055
304 Ga0373935_0047959 3300035692 Bacteria 2703
305 Ga0373935_0095081 3300035692 Bacteria 1956
306 Ga0373927_0007084 3300035695 Bacteria 7605
307 Ga0373927_0037132 3300035695 Bacteria 3167
308 Ga0373933_0016236 3300035724 Bacteria 4160
309 Ga0373947_0077445 3300035725 Bacteria 2051
310 Ga0373937_0046346 3300036401 Bacteria 3975
311 Ga0373937_0072137 3300036401 Bacteria 3184
312 Ga0373925_0009673 3300037068 Bacteria 7014
313 Ga0373925_0079114 3300037068 Bacteria 2497
314 Ga0373925_0321918 3300037068 Bacteria 1251
315 Ga0451851_1293879 3300041507 Bacteria 769
316 Ga0450920_020263 3300042122 Bacteria 1280
317 Ga0439434_0044989 3300042435 Bacteria 1361
318 Ga0450918_000280 3300042531 Bacteria 11555
319 Ga0451577_0261051 3300042876 Bacteria 1568
320 Ga0451576_0332235 3300045051 Bacteria 1591
321 Ga0451576_0725165 3300045051 Bacteria 1044
322 Ga0495592_0020234 3300046454 Bacteria 5063
323 Ga0495641_0001105 3300046461 Bacteria 23196
324 Ga0495651_0019307 3300046462 Bacteria 5283
325 Ga0495653_0033920 3300046463 Bacteria 4040
326 Ga0495580_0074360 3300046472 Bacteria 2371
327 Ga0495580_0075899 3300046472 Bacteria 2344
328 Ga0495580_0294264 3300046472 Bacteria 1106
329 Ga0495582_0593489 3300046473 Bacteria 641
330 Ga0495639_0003744 3300046475 Bacteria 6541
331 Ga0495662_0338877 3300046476 Bacteria 739
332 Ga0495664_0009587 3300046477 Bacteria 5419
333 Ga0495594_0098181 3300046499 Bacteria 1646
334 Ga0495608_0022815 3300046511 Bacteria 4293
335 Ga0495618_0130867 3300046514 Bacteria 1605
336 Ga0495628_0051087 3300046516 Bacteria 3269
337 Ga0495630_0007499 3300046517 Bacteria 7796
338 Ga0495666_0024216 3300046526 Bacteria 2999
339 Ga0495642_0043679 3300046528 Bacteria 1828
340 Ga0495652_0148131 3300046529 Bacteria 1837
341 Ga0495665_0017766 3300046531 Bacteria 3823
342 Ga0495640_0064569 3300046533 Bacteria 2474
343 Ga0495586_0057382 3300046535 Bacteria 2112
344 Ga0495586_0100380 3300046535 Bacteria 1605
345 Ga0495587_0009256 3300046536 Bacteria 6321
346 Ga0495587_0500967 3300046536 Bacteria 671
347 Ga0495598_0049140 3300046537 Bacteria 1263
348 Ga0495598_0179399 3300046537 Archaea 755
349 Ga0495667_0006961 3300046559 Bacteria 7671
350 Ga0495667_0108506 3300046559 Bacteria 1793
351 Ga0495634_0174911 3300046642 Bacteria 1347
352 Ga0495635_0021565 3300046663 Bacteria 4490
353 Ga0495657_0003049 3300046675 Bacteria 13865
354 Ga0495599_0001790 3300046678 Bacteria 12465
355 Ga0495647_0027585 3300046681 Bacteria 2087
356 Ga0495658_0179683 3300046683 Bacteria 1312
357 Ga0495669_0112343 3300046684 Bacteria 1273
358 Ga0495613_0065179 3300046689 Bacteria 2662
359 Ga0495624_0126061 3300046690 Bacteria 1571
360 Ga0495600_0134620 3300046809 Bacteria 1605
361 Ga0495604_0012321 3300047317 Bacteria 6797
362 Ga0495604_0125088 3300047317 Bacteria 1855
363 Ga0495674_0000463 3300047319 Bacteria 36736
364 Ga0495680_0019856 3300047322 Bacteria 5664
365 Ga0495675_0059916 3300047444 Bacteria 2413
366 Ga0495684_0001586 3300047471 Bacteria 18214
367 Ga0495684_0211317 3300047471 Bacteria 1426
368 Ga0495614_0043421 3300048089 Bacteria 1928
369 Ga0496102_0385950 3300048905 Bacteria 1318
370 Ga0496109_0495790 3300048912 Unclassified 1153
371 Ga0496110_0943570 3300048913 Bacteria 769
372 Ga0496111_0076599 3300048914 Bacteria 2438
373 Ga0496111_0417002 3300048914 Bacteria 992
374 Ga0496114_0459750 3300048917 Bacteria 1127
375 Ga0501290_005489 3300049513 Bacteria 1584
376 Ga0501303_010158 3300049526 Bacteria 878
377 Ga0501032_0000884 3300049569 Bacteria 24301
378 Ga0501037_0245136 3300049573 Bacteria 1255
379 Ga0501043_0009227 3300049579 Bacteria 7753
380 Ga0501046_0028200 3300049580 Bacteria 4574
381 Ga0501046_0036045 3300049580 Bacteria 3982
382 Ga0501047_0012043 3300049581 Bacteria 8184
383 Ga0501047_0418564 3300049581 Bacteria 1171
384 Ga0501048_0406471 3300049582 Bacteria 973
385 Ga0501069_0047783 3300049585 Bacteria 2376
386 Ga0501071_0881456 3300049587 Bacteria 690
387 Ga0501202_014149 3300049652 Bacteria 1525
388 Ga0501207_108985 3300049654 Bacteria 564
389 Ga0501209_134144 3300049656 Bacteria 740
390 Ga0501217_017166 3300049661 Bacteria 1667
391 Ga0501223_016350 3300049663 Bacteria 1466
392 Ga0501224_005270 3300049664 Bacteria 1847
393 Ga0501227_011510 3300049665 Bacteria 1928
394 Ga0501235_000102 3300049669 Bacteria 13604
395 Ga0501251_022558 3300049681 Bacteria 847
396 Ga0501258_003188 3300049687 Bacteria 1489
397 Ga0501259_001175 3300049688 Bacteria 4364
398 Ga0501261_004361 3300049690 Bacteria 1747
399 Ga0501229_030787 3300049706 Bacteria 735
400 Ga0501245_011436 3300049708 Bacteria 1292
401 Ga0501080_0527639 3300049742 Bacteria 1053
402 Ga0501232_077845 3300049757 Bacteria 557
403 Ga0501262_031704 3300049759 Bacteria 763
404 Ga0501268_000024 3300049765 Bacteria 13303
405 Ga0501270_001147 3300049767 Bacteria 2464
406 Ga0501272_052788 3300049769 Bacteria 567
407 Ga0501035_0000271 3300049822 Bacteria 61480
408 Ga0501044_0000080 3300049823 Bacteria 116837
409 Ga0501204_003090 3300049850 Bacteria 1729
410 nmdc:mga03683_148226_c1 3300050489 Bacteria 1058
411 nmdc:mga0k408_2301_c2 3300050493 Bacteria 9577
412 nmdc:mga0k408_3321_c1 3300050493 Bacteria 8513
413 nmdc:mga07m45_282_c1 3300050496 Bacteria 20415
414 nmdc:mga06r32_251728_c1 3300050510 Bacteria 1754
415 nmdc:mga06r32_426741_c1 3300050510 Bacteria 1307
416 nmdc:mga0rr50_129383_c1 3300050513 Bacteria 2019
417 nmdc:mga0rr50_638619_c1 3300050513 Bacteria 908
418 nmdc:mga08x19_247_c1 3300050514 Bacteria 41045
419 Ga0495601_0057261 3300053077 Bacteria 2469
420 Ga0495595_0026886 3300053084 Bacteria 2559
421 Ga0495595_0226413 3300053084 Bacteria 934
422 Ga0495619_0000944 3300053085 Bacteria 19038
423 Ga0500566_0231266 3300053094 Bacteria 912
424 Ga0530510_0163163 3300061734 Bacteria 1649
425 Ga0157374_10121412
426 Ga0058859_11660433
427 Ga0058860_10669902
428 Ga0065715_10120258
429 Ga0070658_11351898
430 Ga0070676_10010671
431 Ga0070690_100193492
432 Ga0070690_101245589
433 Ga0068869_100029655
434 Ga0070666_10088103
435 Ga0070666_10167882
436 Ga0068868_100064282
437 Ga0068868_100069482
438 Ga0068868_100252342
439 Ga0070660_100454902
440 Ga0070687_100152695
441 Ga0070661_100409646
442 Ga0070692_10291406
443 Ga0070668_100080690
444 Ga0070669_100264670
445 Ga0070671_100005385
446 Ga0070671_100006816
447 Ga0070671_100095247
448 Ga0070671_100185998
449 Ga0070671_100270232
450 Ga0070674_100088714
451 Ga0070673_100495019
452 Ga0070659_101207182
453 Ga0070667_100002072
454 Ga0070709_10002897
455 Ga0070709_10756397
456 Ga0070714_100073634
457 Ga0070714_100255332
458 Ga0070713_100000007
459 Ga0070710_10003527
460 Ga0070701_10046729
461 Ga0070711_100271237
462 Ga0070705_100016876
463 Ga0070694_100002025
464 Ga0070694_100015679
465 Ga0070708_100180451
466 Ga0070708_100477545
467 Ga0070663_100498957
468 Ga0070678_100180239
469 Ga0070678_101074089
470 Ga0070662_100065353
471 Ga0070662_100113980
472 Ga0070662_100225651
473 Ga0070681_10621358
474 Ga0068867_100047824
475 Ga0068867_100242113
476 Ga0068867_100246675
477 Ga0070685_10199615
478 Ga0070685_10498038
479 Ga0070698_100007624
480 Ga0070698_100213770
481 Ga0070698_100335768
482 Ga0070699_100075866
483 Ga0070679_100105113
484 Ga0070679_100260430
485 Ga0070684_100347474
486 Ga0070672_100106420
487 Ga0070672_100125080
488 Ga0070672_100208669
489 Ga0070686_100155852
490 Ga0070695_100004574
491 Ga0070695_100230611
492 Ga0070696_100058959
493 Ga0070693_100072048
494 Ga0070665_100671813
495 Ga0070665_101049949
496 Ga0070704_100072456
497 Ga0068855_100010598
498 Ga0068855_101000838
499 Ga0068855_101489638
500 Ga0070664_100282891
501 Ga0070664_101284399
502 Ga0068857_101756228
503 Ga0068854_100278080
504 Ga0068854_100310550
505 Ga0068856_100001159
506 Ga0070702_100058804
507 Ga0070702_100437884
508 Ga0070702_100587340
509 Ga0068852_100030285
510 Ga0068852_100252280
511 Ga0068852_100582390
512 Ga0068852_100959573
513 Ga0068852_101069927
514 Ga0068852_101071597
515 Ga0068859_100253395
516 Ga0068859_100403480
517 Ga0068859_100916263
518 Ga0068859_100990733
519 Ga0068864_100574726
520 Ga0068866_10001847
521 Ga0068861_100184403
522 Ga0068851_10189106
523 Ga0068863_100145148
524 Ga0068863_100696188
525 Ga0068858_100123644
526 Ga0068860_100191137
527 Ga0068860_100200724
528 Ga0070715_10291563
529 Ga0070716_100028277
530 Ga0070716_101098503
531 Ga0070712_100000032
532 Ga0075362_10094380
533 Ga0075366_10001656
534 Ga0075366_10093763
535 Ga0097621_100422389
536 Ga0075370_10000289
537 Ga0068871_100053505
538 Ga0068871_100197085
539 Ga0068871_101052013
540 Ga0075428_100104470
541 Ga0075434_100696896
542 Ga0075429_100121196
543 Ga0068865_100347547
544 Ga0075436_100000213
545 Ga0097620_100253379
546 Ga0097620_100403398
547 Ga0097620_100916321
548 Ga0097620_100990850
549 Ga0075435_100153497
550 Ga0105240_10009431
551 Ga0105245_10102057
552 Ga0105245_10201870
553 Ga0114129_10049253
554 Ga0105241_10088076
555 Ga0105241_10221953
556 Ga0105242_10022548
557 Ga0105242_10076218
558 Ga0105248_10088772
559 Ga0105248_10140612
560 Ga0105248_10155405
561 Ga0105249_10231854
562 Ga0157374_10020062
563 Ga0157374_10252661
564 Ga0157374_12066975
565 Ga0157375_10022015
566 Ga0157375_10168883
567 Ga0157375_10330067
568 Ga0157375_11344358
569 Ga0157380_10117751
570 Ga0157379_10000451
571 Ga0157379_10034172
572 Ga0157379_10050386
573 Ga0157379_10434029
574 Ga0157379_11532319
575 Ga0157376_10352319
576 Ga0157376_10589647
577 Ga0163161_10130855
578 Ga0207697_10006785
579 Ga0207682_10001614
580 Ga0207692_10045276
581 Ga0207642_10249072
582 Ga0207688_10096594
583 Ga0207680_10357836
584 Ga0207685_10281444
585 Ga0207699_10000708
586 Ga0207699_10050972
587 Ga0207645_10004010
588 Ga0207645_10012014
589 Ga0207643_10011159
590 Ga0207654_10055408
591 Ga0207693_10000117
592 Ga0207663_10057659
593 Ga0207657_11016736
594 Ga0207649_10466971
595 Ga0207646_10109309
596 Ga0207646_10317554
597 Ga0207681_10321411
598 Ga0207650_10529762
599 Ga0207659_10134364
600 Ga0207659_10579624
601 Ga0207687_10023700
602 Ga0207700_10000014
603 Ga0207664_10229053
604 Ga0207664_10433496
605 Ga0207644_10011653
606 Ga0207644_10014988
607 Ga0207644_10055238
608 Ga0207644_10098246
609 Ga0207644_10400234
610 Ga0207706_10016779
611 Ga0207706_10252841
612 Ga0207686_10132192
613 Ga0207709_10095703
614 Ga0207670_10014600
615 Ga0207704_10130062
616 Ga0207665_10008948
617 Ga0207691_10088903
618 Ga0207691_10125566
619 Ga0207711_10615712
620 Ga0207711_10736414
621 Ga0207679_10359543
622 Ga0207679_10377197
623 Ga0207679_10673506
624 Ga0207667_10043457
625 Ga0207667_11241644
626 Ga0207651_10281107
627 Ga0207651_11156686
628 Ga0207668_10052523
629 Ga0207640_10082431
630 Ga0207640_10174337
631 Ga0207658_10002349
632 Ga0207677_10073357
633 Ga0207677_10212770
634 Ga0207677_10648094
635 Ga0207678_10567339
636 Ga0207678_11037498
637 Ga0207708_10003003
638 Ga0207702_10001629
639 Ga0207702_10362416
640 Ga0207641_10925534
641 Ga0207641_11073987
642 Ga0207648_10010662
643 Ga0207648_10027502
644 Ga0207648_10153912
645 Ga0207648_10248432
646 Ga0207676_10188581
647 Ga0207674_10074219
648 Ga0207675_100115456
649 Ga0207683_10099027
650 Ga0207683_10128814
651 Ga0207683_10502764
652 Ga0207698_10740410
653 Ga0207698_10791124
654 Ga0207698_11354265
655 Ga0209969_1001143
656 Ga0209996_1007656
657 Ga0209999_1020454
658 Ga0209999_1039559
659 Ga0209970_1032895
660 Ga0209966_1001391
661 Ga0209998_10000412
662 Ga0209998_10051655
663 Ga0209974_10005520
664 Ga0209974_10010747
665 Ga0207428_10167101
666 Ga0268266_10371030
667 Ga0268266_10555378
668 Ga0268264_10431848
669 Ga0268264_10540783
670 Ga0268264_11194842
671 Ga0265318_10094697
672 Ga0307517_10186872
673 Ga0265338_10420735
674 Ga0265330_10002071
675 Ga0265332_10006450
676 Ga0265332_10022420
677 Ga0265328_10001783
678 Ga0265320_10297964
679 Ga0265325_10099145
680 Ga0265329_10013914
681 Ga0265329_10014484
682 Ga0265331_10001197
683 Ga0265331_10030326
684 Ga0265327_10002888
685 Ga0265316_10030767
686 Ga0265316_10095272
687 Ga0307513_10075840
688 Ga0307509_10266468
689 Ga0307408_100037023
690 Ga0316575_10160518
691 Ga0265314_10012154
692 Ga0265314_10154924
693 Ga0265342_10009761
694 Ga0265342_10031379
695 Ga0307405_10058480
696 Ga0307413_10206110
697 Ga0307406_10392621
698 Ga0307412_10388020
699 Ga0307409_100011634
700 Ga0307414_10435672
701 Ga0307411_10645495
702 Ga0307415_100610811
703 Ga0307507_10219046
704 Ga0373926_0014492
705 Ga0373934_0000391
706 Ga0373934_0064185
707 Ga0373944_0043634
708 Ga0373923_0016826
709 Ga0373936_0013565
710 Ga0373945_0046134
711 Ga0373953_0005028
712 Ga0373954_0003733
713 Ga0373954_0129632
714 Ga0373956_0042419
715 Ga0373956_0047763
716 Ga0373957_0005284
717 Ga0373957_0061179
718 Ga0373960_0339827
719 Ga0373943_0022072
720 Ga0373943_0182422
721 Ga0373943_0188803
722 Ga0373946_0011661
723 Ga0373946_0060149
724 Ga0373955_0020045
725 Ga0373955_0201272
726 Ga0373924_0007500
727 Ga0373924_0140118
728 Ga0373935_0047959
729 Ga0373935_0095081
730 Ga0373927_0007084
731 Ga0373927_0037132
732 Ga0373933_0016236
733 Ga0373947_0077445
734 Ga0373937_0046346
735 Ga0373937_0072137
736 Ga0373925_0009673
737 Ga0373925_0079114
738 Ga0373925_0321918
739 Ga0451851_1293879
740 Ga0450920_020263
741 Ga0439434_0044989
742 Ga0450918_000280
743 Ga0451577_0261051
744 Ga0451576_0332235
745 Ga0451576_0725165
746 Ga0495592_0020234
747 Ga0495641_0001105
748 Ga0495651_0019307
749 Ga0495653_0033920
750 Ga0495580_0074360
751 Ga0495580_0075899
752 Ga0495580_0294264
753 Ga0495582_0593489
754 Ga0495639_0003744
755 Ga0495662_0338877
756 Ga0495664_0009587
757 Ga0495594_0098181
758 Ga0495608_0022815
759 Ga0495618_0130867
760 Ga0495628_0051087
761 Ga0495630_0007499
762 Ga0495666_0024216
763 Ga0495642_0043679
764 Ga0495652_0148131
765 Ga0495665_0017766
766 Ga0495640_0064569
767 Ga0495586_0057382
768 Ga0495586_0100380
769 Ga0495587_0009256
770 Ga0495587_0500967
771 Ga0495598_0049140
772 Ga0495598_0179399
773 Ga0495667_0006961
774 Ga0495667_0108506
775 Ga0495634_0174911
776 Ga0495635_0021565
777 Ga0495657_0003049
778 Ga0495599_0001790
779 Ga0495647_0027585
780 Ga0495658_0179683
781 Ga0495669_0112343
782 Ga0495613_0065179
783 Ga0495624_0126061
784 Ga0495600_0134620
785 Ga0495604_0012321
786 Ga0495604_0125088
787 Ga0495674_0000463
788 Ga0495680_0019856
789 Ga0495675_0059916
790 Ga0495684_0001586
791 Ga0495684_0211317
792 Ga0495614_0043421
793 Ga0496102_0385950
794 Ga0496109_0495790
795 Ga0496110_0943570
796 Ga0496111_0076599
797 Ga0496111_0417002
798 Ga0496114_0459750
799 Ga0501290_005489
800 Ga0501303_010158
801 Ga0501032_0000884
802 Ga0501037_0245136
803 Ga0501043_0009227
804 Ga0501046_0028200
805 Ga0501046_0036045
806 Ga0501047_0012043
807 Ga0501047_0418564
808 Ga0501048_0406471
809 Ga0501069_0047783
810 Ga0501071_0881456
811 Ga0501202_014149
812 Ga0501207_108985
813 Ga0501209_134144
814 Ga0501217_017166
815 Ga0501223_016350
816 Ga0501224_005270
817 Ga0501227_011510
818 Ga0501235_000102
819 Ga0501251_022558
820 Ga0501258_003188
821 Ga0501259_001175
822 Ga0501261_004361
823 Ga0501229_030787
824 Ga0501245_011436
825 Ga0501080_0527639
826 Ga0501232_077845
827 Ga0501262_031704
828 Ga0501268_000024
829 Ga0501270_001147
830 Ga0501272_052788
831 Ga0501035_0000271
832 Ga0501044_0000080
833 Ga0501204_003090
834 nmdc:mga03683_148226_c1
835 nmdc:mga0k408_2301_c2
836 nmdc:mga0k408_3321_c1
837 nmdc:mga07m45_282_c1
838 nmdc:mga06r32_251728_c1
839 nmdc:mga06r32_426741_c1
840 nmdc:mga0rr50_129383_c1
841 nmdc:mga0rr50_638619_c1
842 nmdc:mga08x19_247_c1
843 Ga0495601_0057261
844 Ga0495595_0026886
845 Ga0495595_0226413
846 Ga0495619_0000944
847 Ga0500566_0231266
848 Ga0530510_0163163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

59

164

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3byr-assembly1.cif.gz_A-2 mode of action of a putative zinc transporter czrb (zn form) 0.7186 109 153
2zzt-assembly1.cif.gz_A-2 crystal structure of the cytosolic domain of the cation diffusion facilitator family protein 0.6968 109 152
8f6h-assembly1.cif.gz_A cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.6835 109 153
5ho5-assembly1.cif.gz_B mamb 0.6831 109 153
5hok-assembly1.cif.gz_D-2 mamb-ctd mutant - d247a 0.6784 109 153
ID Description Score Start End Superfamily
af_K7MEW7_16_561_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.7218 109 154 3.40.50.12780
af_Q2FWA9_216_326_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.7156 109 153 3.30.70.1350
4hlbA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7096 108 152 3.30.70.2960
af_Q10LJ2_305_379_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.6921 109 153 3.30.70.1350
af_Q2FZW2_1_80_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.6868 108 150 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A3L7PN37-F1-model_v4 OsmC family peroxiredoxin 0.8213 1 115
AF-A0A2V6HIQ5-F1-model_v4 Peroxiredoxin 0.7689 1 141
AF-A0A847B506-F1-model_v4 Ribosome maturation factor RimP 0.7681 109 154 GO:0000028
GO:0005829
GO:0006412
AF-A0A395KC67-F1-model_v4 deleted 0.7605 1 146
AF-X6GQ80-F1-model_v4 Peroxiredoxin 0.7598 1 146

Map