F440751

General Info

Members Datasets Scaffolds Average Seq Length
424 220 417 136

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10068304|Ga0157371_100683043
Length 161
Sequence MVHYIIPRDHSVAVRAEIQEWMDMAMNSGGTAGQPMMDINTTPLIDVLLVLLIMFIITIPMQTHAVKVDTPQGAPPIKLLTKNEVAVTGQNRVLWNGAPVNLITLRQYLDQSQTLDPIPELHIRPAPDAHYELVDKVLAVAKRANVTKMGFVGNEAYARDF

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
156 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
202 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 2.83
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004956 3300001904 Bacteria 2259
2 JGI24736J21556_1009367 3300001904 Bacteria 1616
3 JGI24736J21556_1011161 3300001904 Bacteria 1464
4 JGI24736J21556_1056618 3300001904 Bacteria 605
5 JGI24740J21852_10005435 3300001979 Bacteria 5386
6 JGI24739J22299_10000499 3300001989 Bacteria 13899
7 JGI24739J22299_10002846 3300001989 Bacteria 6640
8 JGI24739J22299_10007494 3300001989 Bacteria 4092
9 JGI24737J22298_10000425 3300001990 Bacteria 14488
10 JGI24737J22298_10004152 3300001990 Bacteria 5062
11 JGI24737J22298_10016120 3300001990 Bacteria 2413
12 JGI24737J22298_10070336 3300001990 Bacteria 1045
13 JGI24737J22298_10084113 3300001990 Bacteria 946
14 JGI24737J22298_10173614 3300001990 Bacteria 636
15 JGI24743J22301_10032774 3300001991 Bacteria 1027
16 JGI24735J21928_10008328 3300002067 Bacteria 3357
17 JGI24735J21928_10008594 3300002067 Bacteria 3296
18 JGI24735J21928_10010197 3300002067 Bacteria 3001
19 JGI24735J21928_10013019 3300002067 Bacteria 2622
20 JGI24735J21928_10014717 3300002067 Bacteria 2448
21 JGI24735J21928_10017244 3300002067 Bacteria 2233
22 JGI24735J21928_10017843 3300002067 Bacteria 2192
23 JGI24735J21928_10034138 3300002067 Bacteria 1501
24 JGI24735J21928_10046550 3300002067 Bacteria 1258
25 JGI24735J21928_10079014 3300002067 Bacteria 942
26 JGI24735J21928_10110931 3300002067 Bacteria 789
27 JGI24735J21928_10118887 3300002067 Bacteria 760
28 JGI24735J21928_10119910 3300002067 Bacteria 757
29 JGI24738J21930_10000040 3300002075 Bacteria 25176
30 JGI24749J21850_1000218 3300002076 Bacteria 8932
31 JGI24744J21845_10000530 3300002077 Bacteria 6827
32 JGI24034J26672_10056361 3300002239 Bacteria 683
33 JGI25157J39369_1026212 3300002741 Bacteria 677
34 JGI25157J39369_1027831 3300002741 Bacteria 653
35 JGI25165J46597_1000082 3300003214 Bacteria 174736
36 rootH1_10023776 3300003316 Bacteria 1412
37 rootL2_10067612 3300003322 Bacteria 1072
38 rootL2_10111258 3300003322 Bacteria 1272
39 Ga0065712_10025333 3300005290 Bacteria 1396
40 Ga0065715_10151206 3300005293 Bacteria 1689
41 Ga0065707_10093614 3300005295 Bacteria 3603
42 Ga0065707_10548540 3300005295 Bacteria 722
43 Ga0070658_10017222 3300005327 Bacteria 5783
44 Ga0070658_10226419 3300005327 Bacteria 1582
45 Ga0070658_10439342 3300005327 Bacteria 1123
46 Ga0070676_10000043 3300005328 Bacteria 38508
47 Ga0070670_100054445 3300005331 Bacteria 3435
48 Ga0070670_100402937 3300005331 Bacteria 1208
49 Ga0068869_100000014 3300005334 Bacteria 73206
50 Ga0070666_10118705 3300005335 Bacteria 1833
51 Ga0070666_10508584 3300005335 Bacteria 874
52 Ga0068868_100000015 3300005338 Bacteria 104058
53 Ga0070660_100000280 3300005339 Bacteria 33943
54 Ga0070660_100049239 3300005339 Bacteria 3239
55 Ga0070660_100066952 3300005339 Bacteria 2798
56 Ga0070687_100133034 3300005343 Bacteria 1438
57 Ga0070661_100716557 3300005344 Bacteria 816
58 Ga0070668_100104725 3300005347 Bacteria 2246
59 Ga0070668_100105017 3300005347 Bacteria 2243
60 Ga0070668_100614786 3300005347 Bacteria 952
61 Ga0070669_100000119 3300005353 Bacteria 73001
62 Ga0070669_100055434 3300005353 Bacteria 2904
63 Ga0070669_100092353 3300005353 Bacteria 2272
64 Ga0070669_101748860 3300005353 Bacteria 542
65 Ga0070675_100002667 3300005354 Bacteria 13418
66 Ga0070675_100099795 3300005354 Bacteria 2444
67 Ga0070675_100836555 3300005354 Bacteria 842
68 Ga0070671_100009712 3300005355 Bacteria 7730
69 Ga0070671_100026971 3300005355 Bacteria 4726
70 Ga0070671_100155494 3300005355 Bacteria 1932
71 Ga0070674_100030763 3300005356 Bacteria 3551
72 Ga0070674_100036788 3300005356 Bacteria 3289
73 Ga0070674_100100296 3300005356 Bacteria 2108
74 Ga0070673_100000098 3300005364 Bacteria 38913
75 Ga0070673_100129468 3300005364 Bacteria 2115
76 Ga0070659_100037250 3300005366 Bacteria 3791
77 Ga0070659_100466548 3300005366 Bacteria 1073
78 Ga0070659_101551939 3300005366 Bacteria 591
79 Ga0070667_100000407 3300005367 Bacteria 46001
80 Ga0070663_100731927 3300005455 Bacteria 843
81 Ga0070663_101522061 3300005455 Bacteria 595
82 Ga0070663_102024314 3300005455 Bacteria 518
83 Ga0070678_100079236 3300005456 Bacteria 2484
84 Ga0070662_100003287 3300005457 Bacteria 10067
85 Ga0070662_100213695 3300005457 Bacteria 1536
86 Ga0070662_100566653 3300005457 Bacteria 953
87 Ga0070681_10276139 3300005458 Bacteria 1592
88 Ga0068867_100000008 3300005459 Bacteria 143488
89 Ga0068867_101316418 3300005459 Bacteria 667
90 Ga0068853_100112950 3300005539 Bacteria 2415
91 Ga0068853_100233976 3300005539 Bacteria 1682
92 Ga0068853_100373534 3300005539 Bacteria 1331
93 Ga0070672_100018323 3300005543 Bacteria 5059
94 Ga0070672_100597351 3300005543 Bacteria 961
95 Ga0070693_100037937 3300005547 Bacteria 2690
96 Ga0070665_100865204 3300005548 Bacteria 917
97 Ga0068855_100036032 3300005563 Bacteria 5890
98 Ga0068855_100509389 3300005563 Bacteria 1307
99 Ga0070664_100098528 3300005564 Bacteria 2540
100 Ga0070664_100159508 3300005564 Bacteria 1995
101 Ga0070664_101476807 3300005564 Bacteria 643
102 Ga0068857_100359816 3300005577 Bacteria 1349
103 Ga0068856_100002832 3300005614 Bacteria 17765
104 Ga0068856_100177323 3300005614 Bacteria 2144
105 Ga0070702_100974338 3300005615 Bacteria 669
106 Ga0068852_100065803 3300005616 Bacteria 3164
107 Ga0068852_100685589 3300005616 Bacteria 1034
108 Ga0068852_101234667 3300005616 Bacteria 769
109 Ga0068852_101571947 3300005616 Bacteria 680
110 Ga0068859_100010149 3300005617 Bacteria 9485
111 Ga0068864_100272404 3300005618 Bacteria 1578
112 Ga0068861_100234548 3300005719 Bacteria 1558
113 Ga0068861_101791336 3300005719 Bacteria 609
114 Ga0068870_10060481 3300005840 Bacteria 2033
115 Ga0068863_100003363 3300005841 Bacteria 15795
116 Ga0068863_100110100 3300005841 Bacteria 2622
117 Ga0068862_100000011 3300005844 Bacteria 270105
118 Ga0068862_100469141 3300005844 Bacteria 1189
119 Ga0075368_10286108 3300006042 Bacteria 709
120 Ga0075366_10039836 3300006195 Bacteria 2778
121 Ga0075366_10107099 3300006195 Bacteria 1681
122 Ga0068865_100000036 3300006881 Bacteria 82943
123 Ga0068865_100358037 3300006881 Bacteria 1184
124 Ga0097620_100010149 3300006931 Bacteria 9485
125 Ga0105240_10131648 3300009093 Bacteria 2999
126 Ga0105240_11586149 3300009093 Bacteria 685
127 Ga0105245_10003374 3300009098 Bacteria 14312
128 Ga0105243_10000625 3300009148 Bacteria 35272
129 Ga0105242_10010105 3300009176 Bacteria 7227
130 Ga0105248_10900509 3300009177 Bacteria 999
131 Ga0105237_10032435 3300009545 Bacteria 5289
132 Ga0105237_10692829 3300009545 Bacteria 1025
133 Ga0105238_11017600 3300009551 Bacteria 850
134 Ga0105249_10014632 3300009553 Bacteria 6938
135 Ga0105239_10349003 3300010375 Bacteria 1670
136 Ga0105246_10045191 3300011119 Bacteria 2997
137 Ga0105246_10169600 3300011119 Bacteria 1670
138 Ga0105246_11564434 3300011119 Bacteria 622
139 Ga0157326_1000156 3300012513 Bacteria 7474
140 Ga0157373_10069981 3300013100 Bacteria 2480
141 Ga0157373_10128281 3300013100 Bacteria 1784
142 Ga0157373_10249373 3300013100 Bacteria 1256
143 Ga0157373_10420567 3300013100 Bacteria 959
144 Ga0157373_10439398 3300013100 Bacteria 938
145 Ga0157373_10881285 3300013100 Bacteria 663
146 Ga0157371_10068304 3300013102 Bacteria 2515
147 Ga0157371_10146437 3300013102 Bacteria 1683
148 Ga0157371_10192669 3300013102 Bacteria 1460
149 Ga0157371_10499091 3300013102 Bacteria 899
150 Ga0157371_11317769 3300013102 Bacteria 559
151 Ga0157370_10000112 3300013104 Bacteria 94316
152 Ga0157370_11388877 3300013104 Bacteria 632
153 Ga0157369_10042823 3300013105 Bacteria 4939
154 Ga0157369_10112726 3300013105 Bacteria 2889
155 Ga0157369_10183560 3300013105 Bacteria 2200
156 Ga0157369_10615207 3300013105 Bacteria 1121
157 Ga0157369_10878774 3300013105 Bacteria 920
158 Ga0157374_10001100 3300013296 Bacteria 23248
159 Ga0157374_11600617 3300013296 Bacteria 675
160 Ga0157374_12174880 3300013296 Bacteria 582
161 Ga0157378_10001248 3300013297 Bacteria 22962
162 Ga0163162_10323260 3300013306 Bacteria 1675
163 Ga0163162_10809640 3300013306 Bacteria 1054
164 Ga0157372_10060831 3300013307 Bacteria 4226
165 Ga0157372_10135043 3300013307 Bacteria 2840
166 Ga0157372_10421967 3300013307 Bacteria 1555
167 Ga0157372_10442129 3300013307 Bacteria 1515
168 Ga0157372_10659122 3300013307 Bacteria 1219
169 Ga0157372_10869228 3300013307 Bacteria 1047
170 Ga0157372_11108161 3300013307 Bacteria 916
171 Ga0157372_11187732 3300013307 Bacteria 882
172 Ga0157375_10009204 3300013308 Bacteria 8660
173 Ga0157380_10001430 3300014326 Bacteria 15629
174 Ga0157380_10150058 3300014326 Bacteria 2014
175 Ga0157380_10728580 3300014326 Bacteria 1000
176 Ga0157377_10055679 3300014745 Bacteria 2243
177 Ga0157376_10000033 3300014969 Bacteria 163952
178 Ga0163161_10384187 3300017792 Bacteria 1123
179 Ga0163161_11055953 3300017792 Bacteria 696
180 Ga0207427_100526 3300025231 Bacteria 19933
181 Ga0209026_1005392 3300025250 Bacteria 3456
182 Ga0209148_1000127 3300025254 Bacteria 181586
183 Ga0209148_1004200 3300025254 Bacteria 3614
184 Ga0209233_1000041 3300025261 Bacteria 515463
185 Ga0209455_1034575 3300025272 Bacteria 821
186 Ga0207682_10035217 3300025893 Bacteria 2021
187 Ga0207642_10348765 3300025899 Bacteria 873
188 Ga0207688_10054407 3300025901 Bacteria 2245
189 Ga0207680_10012735 3300025903 Bacteria 4295
190 Ga0207680_10061914 3300025903 Bacteria 2284
191 Ga0207680_10240402 3300025903 Bacteria 1248
192 Ga0207647_10002638 3300025904 Bacteria 13550
193 Ga0207647_10012142 3300025904 Bacteria 6011
194 Ga0207647_10026436 3300025904 Bacteria 3798
195 Ga0207647_10027184 3300025904 Bacteria 3733
196 Ga0207647_10052284 3300025904 Bacteria 2522
197 Ga0207647_10114276 3300025904 Bacteria 1595
198 Ga0207647_10243382 3300025904 Bacteria 1033
199 Ga0207645_10000117 3300025907 Bacteria 60207
200 Ga0207645_10171794 3300025907 Bacteria 1421
201 Ga0207705_10002415 3300025909 Bacteria 14419
202 Ga0207705_10358257 3300025909 Bacteria 1125
203 Ga0207705_10848091 3300025909 Bacteria 708
204 Ga0207707_10471975 3300025912 Bacteria 1072
205 Ga0207695_10053176 3300025913 Bacteria 4237
206 Ga0207671_10133601 3300025914 Bacteria 1906
207 Ga0207671_10460294 3300025914 Bacteria 1013
208 Ga0207657_10000983 3300025919 Bacteria 30231
209 Ga0207657_10014533 3300025919 Bacteria 7676
210 Ga0207657_10015601 3300025919 Bacteria 7350
211 Ga0207681_10000001 3300025923 Bacteria 1105841
212 Ga0207681_10909913 3300025923 Bacteria 737
213 Ga0207694_10278257 3300025924 Bacteria 1374
214 Ga0207650_10000018 3300025925 Bacteria 352120
215 Ga0207650_10058848 3300025925 Bacteria 2862
216 Ga0207650_10487178 3300025925 Bacteria 1029
217 Ga0207659_10005343 3300025926 Bacteria 7782
218 Ga0207659_11033178 3300025926 Bacteria 707
219 Ga0207687_10000372 3300025927 Bacteria 29996
220 Ga0207644_10083792 3300025931 Bacteria 2362
221 Ga0207644_10169876 3300025931 Bacteria 1701
222 Ga0207644_10786152 3300025931 Bacteria 796
223 Ga0207690_10020269 3300025932 Bacteria 4106
224 Ga0207690_10043589 3300025932 Bacteria 2953
225 Ga0207690_10293626 3300025932 Bacteria 1270
226 Ga0207690_10612900 3300025932 Bacteria 889
227 Ga0207690_11430362 3300025932 Bacteria 578
228 Ga0207706_10003421 3300025933 Bacteria 15153
229 Ga0207706_10045597 3300025933 Bacteria 3884
230 Ga0207706_10103166 3300025933 Bacteria 2509
231 Ga0207706_10220286 3300025933 Bacteria 1661
232 Ga0207706_10309401 3300025933 Bacteria 1376
233 Ga0207706_10912649 3300025933 Bacteria 741
234 Ga0207709_10000102 3300025935 Bacteria 132562
235 Ga0207669_10148371 3300025937 Bacteria 1639
236 Ga0207704_10000014 3300025938 Bacteria 164052
237 Ga0207704_10310008 3300025938 Bacteria 1213
238 Ga0207691_10059814 3300025940 Bacteria 3463
239 Ga0207691_10672399 3300025940 Bacteria 874
240 Ga0207689_10000364 3300025942 Bacteria 42763
241 Ga0207679_11855002 3300025945 Bacteria 550
242 Ga0207667_10490765 3300025949 Bacteria 1246
243 Ga0207667_10594441 3300025949 Bacteria 1116
244 Ga0207651_10000015 3300025960 Bacteria 164178
245 Ga0207651_10306421 3300025960 Bacteria 1323
246 Ga0207712_10007151 3300025961 Bacteria 7039
247 Ga0207668_10308355 3300025972 Bacteria 1309
248 Ga0207668_10548057 3300025972 Bacteria 1001
249 Ga0207658_10001469 3300025986 Bacteria 18347
250 Ga0207658_11297866 3300025986 Bacteria 666
251 Ga0207677_10000097 3300026023 Bacteria 71753
252 Ga0207639_10260661 3300026041 Bacteria 1516
253 Ga0207678_10127930 3300026067 Bacteria 2167
254 Ga0207678_10674959 3300026067 Bacteria 908
255 Ga0207678_11900625 3300026067 Bacteria 519
256 Ga0207702_10003314 3300026078 Bacteria 14805
257 Ga0207641_10103806 3300026088 Bacteria 2508
258 Ga0207641_10262573 3300026088 Bacteria 1617
259 Ga0207648_10000014 3300026089 Bacteria 163862
260 Ga0207648_10368805 3300026089 Bacteria 1296
261 Ga0207676_10000004 3300026095 Bacteria 725417
262 Ga0207676_11060667 3300026095 Bacteria 800
263 Ga0207674_10019434 3300026116 Bacteria 7356
264 Ga0207674_10253942 3300026116 Bacteria 1705
265 Ga0207675_100001128 3300026118 Bacteria 26498
266 Ga0207675_102257398 3300026118 Bacteria 559
267 Ga0207683_10007411 3300026121 Bacteria 9408
268 Ga0207698_10096358 3300026142 Bacteria 2438
269 Ga0207698_10427291 3300026142 Bacteria 1273
270 Ga0207698_11444009 3300026142 Bacteria 703
271 Ga0209967_1058565 3300027364 Bacteria 596
272 Ga0209974_10012483 3300027876 Bacteria 2840
273 Ga0268266_11607873 3300028379 Bacteria 625
274 Ga0268265_10000002 3300028380 Bacteria 1035381
275 Ga0268265_11634818 3300028380 Bacteria 649
276 Ga0307408_100053439 3300031548 Bacteria 2917
277 Ga0307408_100089281 3300031548 Bacteria 2323
278 Ga0307405_10032752 3300031731 Bacteria 3075
279 Ga0307405_10054703 3300031731 Bacteria 2493
280 Ga0307405_10215897 3300031731 Bacteria 1404
281 Ga0307405_10412961 3300031731 Bacteria 1060
282 Ga0307413_10011941 3300031824 Bacteria 4298
283 Ga0307413_10220232 3300031824 Bacteria 1386
284 Ga0307410_10082320 3300031852 Bacteria 2264
285 Ga0307410_10120430 3300031852 Bacteria 1913
286 Ga0307410_10422557 3300031852 Bacteria 1081
287 Ga0307406_10119809 3300031901 Bacteria 1827
288 Ga0307406_10330853 3300031901 Bacteria 1182
289 Ga0307407_10009986 3300031903 Bacteria 4452
290 Ga0307407_10690161 3300031903 Bacteria 768
291 Ga0307412_10357262 3300031911 Bacteria 1175
292 Ga0307412_10397357 3300031911 Bacteria 1121
293 Ga0307409_100009926 3300031995 Bacteria 5880
294 Ga0307409_100526073 3300031995 Bacteria 1156
295 Ga0307409_100632998 3300031995 Bacteria 1061
296 Ga0307409_101609992 3300031995 Bacteria 678
297 Ga0307409_101741278 3300031995 Bacteria 652
298 Ga0307416_100111611 3300032002 Bacteria 2411
299 Ga0307416_100307378 3300032002 Bacteria 1580
300 Ga0307416_100396394 3300032002 Bacteria 1416
301 Ga0307416_100960569 3300032002 Bacteria 957
302 Ga0307414_10043188 3300032004 Bacteria 3069
303 Ga0307414_10046104 3300032004 Bacteria 2989
304 Ga0307414_10512816 3300032004 Bacteria 1063
305 Ga0307414_11054679 3300032004 Bacteria 749
306 Ga0307411_10001850 3300032005 Bacteria 8989
307 Ga0307411_10014110 3300032005 Bacteria 4435
308 Ga0307411_10200650 3300032005 Unclassified 1531
309 Ga0307415_100006164 3300032126 Bacteria 6437
310 Ga0307415_100028330 3300032126 Bacteria 3562
311 Ga0307415_100387004 3300032126 Bacteria 1189
312 Ga0307415_100967333 3300032126 Bacteria 789
313 Ga0373931_0201526 3300035691 Bacteria 1189
314 Ga0395899_0003962 3300037312 Bacteria 11669
315 Ga0395900_0017530 3300037418 Bacteria 7307
316 Ga0395900_0829123 3300037418 Bacteria 851
317 Ga0395898_1576289 3300037466 Bacteria 581
318 Ga0395905_1460781 3300037471 Bacteria 588
319 Ga0451801_08754 3300041455 Bacteria 815
320 Ga0451798_0509006 3300041458 Bacteria 940
321 Ga0451800_0865922 3300041459 Bacteria 2350
322 Ga0451802_1436532 3300041460 Bacteria 1273
323 Ga0451805_038156 3300041461 Bacteria 1603
324 Ga0451806_833252 3300041462 Bacteria 1095
325 Ga0451804_0204772 3300041463 Bacteria 510
326 Ga0451841_0836323 3300041498 Bacteria 870
327 Ga0439445_0002495 3300042004 Bacteria 4094
328 Ga0439448_0011460 3300042005 Bacteria 2643
329 Ga0439448_0031254 3300042005 Bacteria 1690
330 Ga0439448_0186494 3300042005 Bacteria 725
331 Ga0439449_0016276 3300042007 Bacteria 2795
332 Ga0439455_0006341 3300042012 Bacteria 2451
333 Ga0439455_0016446 3300042012 Bacteria 1711
334 Ga0439455_0025859 3300042012 Bacteria 1429
335 Ga0439455_0052748 3300042012 Bacteria 1065
336 Ga0450920_021578 3300042122 Bacteria 1246
337 Ga0439458_0001585 3300042157 Bacteria 5680
338 Ga0451577_0454094 3300042876 Bacteria 1164
339 Ga0466965_0009881 3300044683 Bacteria 4439
340 Ga0466966_0128710 3300044684 Bacteria 1551
341 Ga0466961_0021721 3300044693 Bacteria 4129
342 Ga0466961_0498378 3300044693 Bacteria 735
343 Ga0466968_0052416 3300044735 Bacteria 1745
344 Ga0466970_0018629 3300044765 Bacteria 3597
345 Ga0466957_0544323 3300044842 Bacteria 808
346 Ga0466959_0002221 3300045049 Bacteria 12362
347 Ga0466967_0917539 3300045976 Bacteria 871
348 Ga0495583_0000038 3300046506 Bacteria 243395
349 Ga0495606_0015264 3300046507 Bacteria 5928
350 Ga0495606_0027801 3300046507 Bacteria 4003
351 Ga0495606_0342005 3300046507 Bacteria 797
352 Ga0495648_0306787 3300046524 Bacteria 741
353 Ga0495621_0048483 3300046539 Bacteria 1513
354 Ga0495661_0193296 3300046665 Bacteria 1070
355 Ga0495669_0002940 3300046684 Bacteria 7002
356 Ga0495669_0294119 3300046684 Bacteria 782
357 Ga0495670_0026006 3300046691 Bacteria 2897
358 Ga0495683_0137165 3300047323 Bacteria 1149
359 Ga0495687_108284 3300047443 Bacteria 1027
360 Ga0495686_0001180 3300047472 Bacteria 30452
361 Ga0495686_0013900 3300047472 Bacteria 5570
362 Ga0495686_0026515 3300047472 Bacteria 3790
363 Ga0495626_0260771 3300048091 Bacteria 693
364 Ga0496102_0221274 3300048905 Bacteria 1785
365 Ga0496108_0532274 3300048911 Bacteria 1026
366 Ga0496109_0168390 3300048912 Bacteria 2055
367 Ga0496110_0148557 3300048913 Bacteria 2121
368 Ga0496111_0146911 3300048914 Bacteria 1748
369 Ga0496117_0170373 3300048920 Bacteria 1264
370 Ga0496118_0014286 3300048921 Bacteria 7447
371 Ga0496118_0108997 3300048921 Bacteria 1844
372 Ga0496118_0293506 3300048921 Bacteria 897
373 Ga0496118_0324667 3300048921 Bacteria 833
374 Ga0496119_0021258 3300048922 Bacteria 4697
375 Ga0496120_0188712 3300048923 Bacteria 1006
376 Ga0496121_0013505 3300048924 Bacteria 8766
377 Ga0496121_0034647 3300048924 Bacteria 4542
378 Ga0496121_0835333 3300048924 Bacteria 537
379 Ga0496122_0002498 3300048925 Bacteria 25978
380 Ga0496122_0020308 3300048925 Bacteria 6011
381 Ga0496123_0005014 3300048926 Bacteria 13555
382 Ga0496123_0011998 3300048926 Bacteria 7432
383 Ga0496123_0090761 3300048926 Bacteria 1815
384 Ga0496124_0012349 3300048927 Bacteria 8435
385 Ga0496124_0317582 3300048927 Bacteria 1117
386 Ga0496124_0384695 3300048927 Bacteria 980
387 Ga0496124_0743469 3300048927 Bacteria 615
388 Ga0496124_0815600 3300048927 Bacteria 576
389 Ga0496125_0048028 3300048928 Bacteria 3563
390 Ga0496125_0074479 3300048928 Bacteria 2632
391 Ga0496125_0117667 3300048928 Bacteria 1905
392 Ga0496125_0629238 3300048928 Bacteria 581
393 Ga0496126_0948736 3300048929 Bacteria 649
394 Ga0495682_0173415 3300049460 Bacteria 767
395 Ga0501290_005933 3300049513 Bacteria 1523
396 Ga0501300_002856 3300049523 Bacteria 2581
397 Ga0501067_0010483 3300049583 Bacteria 5131
398 Ga0501249_002715 3300049679 Bacteria 3565
399 Ga0501257_000127 3300049686 Bacteria 17543
400 Ga0501280_006279 3300049776 Bacteria 1678
401 nmdc:mga00v17_162212_c1 3300050491 Bacteria 1439
402 nmdc:mga0k408_47641_c1 3300050493 Bacteria 2477
403 nmdc:mga0k408_52517_c1 3300050493 Bacteria 2362
404 nmdc:mga0qj67_40214_c1 3300050509 Bacteria 3675
405 Ga0500643_206581 3300053087 Bacteria 527
406 Ga0500555_008517 3300053103 Bacteria 2925
407 Ga0500555_014599 3300053103 Bacteria 2264
408 Ga0500556_0163608 3300053104 Bacteria 878
409 Ga0500564_145270 3300053138 Bacteria 1015
410 Ga0500577_0056447 3300053142 Bacteria 1495
411 Ga0500616_0099575 3300053153 Bacteria 1423
412 Ga0500616_0110614 3300053153 Bacteria 1327
413 Ga0590071_166141 3300059421 Bacteria 575
414 Ga0587101_005154 3300059623 Bacteria 1436
415 Ga0587128_000880 3300059630 Bacteria 2589
416 Ga0587124_000300 3300059660 Bacteria 2526
417 Ga0466962_0039928 3300061719 Bacteria 2247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0917539 Ga0466967_0917539_14_346 110
2 3300005353 Ga0070669_101748860 Ga0070669_1017488601 111
3 3300005616 Ga0068852_101571947 Ga0068852_1015719471 111
4 3300005719 Ga0068861_100234548 Ga0068861_1002345482 111
5 3300042005 Ga0439448_0031254 Ga0439448_0031254_1315_1668 114
6 3300042012 Ga0439455_0052748 Ga0439455_0052748_699_1052 114
7 3300002067 JGI24735J21928_10010197 JGI24735J21928_100101974 120
8 3300002067 JGI24735J21928_10017244 JGI24735J21928_100172442 120
9 3300002067 JGI24735J21928_10079014 JGI24735J21928_100790141 120
10 3300005327 Ga0070658_10017222 Ga0070658_100172225 120
11 3300005339 Ga0070660_100066952 Ga0070660_1000669523 120
12 3300005366 Ga0070659_100037250 Ga0070659_1000372503 120
13 3300005563 Ga0068855_100036032 Ga0068855_1000360322 120
14 3300009093 Ga0105240_11586149 Ga0105240_115861492 120
15 3300009551 Ga0105238_11017600 Ga0105238_110176001 120
16 3300013296 Ga0157374_11600617 Ga0157374_116006171 120
17 3300025254 Ga0209148_1004200 Ga0209148_10042002 120
18 3300025904 Ga0207647_10012142 Ga0207647_100121422 120
19 3300025909 Ga0207705_10002415 Ga0207705_1000241510 120
20 3300025919 Ga0207657_10014533 Ga0207657_100145333 120
21 3300025924 Ga0207694_10278257 Ga0207694_102782573 120
22 3300025932 Ga0207690_10043589 Ga0207690_100435893 120
23 3300025949 Ga0207667_10594441 Ga0207667_105944412 120
24 3300001990 JGI24737J22298_10004152 JGI24737J22298_100041523 121
25 3300002067 JGI24735J21928_10008594 JGI24735J21928_100085943 121
26 3300002077 JGI24744J21845_10000530 JGI24744J21845_100005303 121
27 3300005339 Ga0070660_100049239 Ga0070660_1000492392 121
28 3300005354 Ga0070675_100002667 Ga0070675_1000026675 121
29 3300005355 Ga0070671_100155494 Ga0070671_1001554944 121
30 3300005356 Ga0070674_100036788 Ga0070674_1000367883 121
31 3300005456 Ga0070678_100079236 Ga0070678_1000792362 121
32 3300005539 Ga0068853_100233976 Ga0068853_1002339761 121
33 3300005543 Ga0070672_100018323 Ga0070672_1000183231 121
34 3300006881 Ga0068865_100358037 Ga0068865_1003580371 121
35 3300017792 Ga0163161_10384187 Ga0163161_103841872 121
36 3300025901 Ga0207688_10054407 Ga0207688_100544074 121
37 3300025904 Ga0207647_10027184 Ga0207647_100271844 121
38 3300025907 Ga0207645_10171794 Ga0207645_101717943 121
39 3300025919 Ga0207657_10015601 Ga0207657_100156017 121
40 3300025926 Ga0207659_10005343 Ga0207659_100053433 121
41 3300025931 Ga0207644_10169876 Ga0207644_101698763 121
42 3300025938 Ga0207704_10310008 Ga0207704_103100081 121
43 3300025940 Ga0207691_10059814 Ga0207691_100598142 121
44 3300026121 Ga0207683_10007411 Ga0207683_100074117 121
45 3300005366 Ga0070659_100466548 Ga0070659_1004665481 125
46 3300013306 Ga0163162_10323260 Ga0163162_103232602 125
47 3300046506 Ga0495583_0000038 Ga0495583_0000038_170825_171250 125
48 3300046665 Ga0495661_0193296 Ga0495661_0193296_158_583 125
49 3300046691 Ga0495670_0026006 Ga0495670_0026006_355_780 125
50 3300053103 Ga0500555_014599 Ga0500555_014599_1299_1724 125
51 3300059623 Ga0587101_005154 Ga0587101_005154_991_1425 125
52 3300059630 Ga0587128_000880 Ga0587128_000880_30_464 125
53 3300059660 Ga0587124_000300 Ga0587124_000300_18_452 125
54 3300005617 Ga0068859_100010149 Ga0068859_10001014911 126
55 3300006931 Ga0097620_100010149 Ga0097620_10001014911 126
56 3300041463 Ga0451804_0204772 Ga0451804_0204772_14_406 126
57 3300046539 Ga0495621_0048483 Ga0495621_0048483_483_911 126
58 3300005457 Ga0070662_100566653 Ga0070662_1005666531 127
59 3300025933 Ga0207706_10912649 Ga0207706_109126491 127
60 3300042122 Ga0450920_021578 Ga0450920_021578_607_1041 127
61 3300050509 nmdc:mga0qj67_40214_c1 nmdc:mga0qj67_40214_c1_2821_3252 127
62 3300059421 Ga0590071_166141 Ga0590071_166141_88_522 127
63 3300011119 Ga0105246_11564434 Ga0105246_115644341 128
64 3300013102 Ga0157371_10146437 Ga0157371_101464372 128
65 3300013307 Ga0157372_10135043 Ga0157372_101350432 128
66 3300013307 Ga0157372_10421967 Ga0157372_104219673 128
67 3300013307 Ga0157372_11108161 Ga0157372_111081612 128
68 3300042005 Ga0439448_0186494 Ga0439448_0186494_44_430 128
69 3300042012 Ga0439455_0025859 Ga0439455_0025859_18_404 128
70 3300031548 Ga0307408_100053439 Ga0307408_1000534393 129
71 3300031731 Ga0307405_10215897 Ga0307405_102158971 129
72 3300031911 Ga0307412_10357262 Ga0307412_103572622 129
73 3300032126 Ga0307415_100967333 Ga0307415_1009673331 129
74 3300027364 Ga0209967_1058565 Ga0209967_10585651 131
75 3300001990 JGI24737J22298_10070336 JGI24737J22298_100703362 132
76 3300002067 JGI24735J21928_10119910 JGI24735J21928_101199102 132
77 3300005327 Ga0070658_10226419 Ga0070658_102264191 132
78 3300011119 Ga0105246_10045191 Ga0105246_100451914 132
79 3300013296 Ga0157374_10001100 Ga0157374_100011006 132
80 3300014745 Ga0157377_10055679 Ga0157377_100556791 132
81 3300025909 Ga0207705_10848091 Ga0207705_108480911 132
82 3300041498 Ga0451841_0836323 Ga0451841_0836323_81_509 132
83 3300002067 JGI24735J21928_10034138 JGI24735J21928_100341382 133
84 3300002076 JGI24749J21850_1000218 JGI24749J21850_10002183 133
85 3300002741 JGI25157J39369_1026212 JGI25157J39369_10262121 133
86 3300003214 JGI25165J46597_1000082 JGI25165J46597_100008219 133
87 3300005295 Ga0065707_10093614 Ga0065707_100936144 133
88 3300005327 Ga0070658_10439342 Ga0070658_104393422 133
89 3300005335 Ga0070666_10508584 Ga0070666_105085842 133
90 3300005338 Ga0068868_100000015 Ga0068868_10000001583 133
91 3300005347 Ga0070668_100614786 Ga0070668_1006147862 133
92 3300005353 Ga0070669_100000119 Ga0070669_10000011917 133
93 3300005367 Ga0070667_100000407 Ga0070667_10000040738 133
94 3300005614 Ga0068856_100002832 Ga0068856_10000283211 133
95 3300005719 Ga0068861_101791336 Ga0068861_1017913362 133
96 3300005844 Ga0068862_100000011 Ga0068862_100000011235 133
97 3300013105 Ga0157369_10042823 Ga0157369_100428232 133
98 3300013306 Ga0163162_10809640 Ga0163162_108096402 133
99 3300014326 Ga0157380_10001430 Ga0157380_1000143011 133
100 3300014326 Ga0157380_10150058 Ga0157380_101500583 133
101 3300025231 Ga0207427_100526 Ga0207427_10052615 133
102 3300025250 Ga0209026_1005392 Ga0209026_10053923 133
103 3300025261 Ga0209233_1000041 Ga0209233_100004118 133
104 3300025272 Ga0209455_1034575 Ga0209455_10345751 133
105 3300025903 Ga0207680_10240402 Ga0207680_102404023 133
106 3300025904 Ga0207647_10052284 Ga0207647_100522843 133
107 3300025909 Ga0207705_10358257 Ga0207705_103582572 133
108 3300025923 Ga0207681_10000001 Ga0207681_10000001658 133
109 3300025925 Ga0207650_10000018 Ga0207650_100000182 133
110 3300025972 Ga0207668_10548057 Ga0207668_105480572 133
111 3300025986 Ga0207658_10001469 Ga0207658_100014695 133
112 3300026023 Ga0207677_10000097 Ga0207677_1000009716 133
113 3300026078 Ga0207702_10003314 Ga0207702_1000331412 133
114 3300026095 Ga0207676_10000004 Ga0207676_10000004395 133
115 3300026118 Ga0207675_100001128 Ga0207675_1000011283 133
116 3300026118 Ga0207675_102257398 Ga0207675_1022573981 133
117 3300028380 Ga0268265_10000002 Ga0268265_10000002675 133
118 3300031995 Ga0307409_100526073 Ga0307409_1005260732 133
119 3300037312 Ga0395899_0003962 Ga0395899_0003962_4539_4961 133
120 3300037418 Ga0395900_0017530 Ga0395900_0017530_6460_6882 133
121 3300037418 Ga0395900_0829123 Ga0395900_0829123_135_557 133
122 3300037466 Ga0395898_1576289 Ga0395898_1576289_60_482 133
123 3300042004 Ga0439445_0002495 Ga0439445_0002495_3237_3671 133
124 3300001991 JGI24743J22301_10032774 JGI24743J22301_100327741 134
125 3300005328 Ga0070676_10000043 Ga0070676_1000004312 134
126 3300005334 Ga0068869_100000014 Ga0068869_1000000145 134
127 3300005364 Ga0070673_100000098 Ga0070673_10000009816 134
128 3300005459 Ga0068867_100000008 Ga0068867_10000000816 134
129 3300006042 Ga0075368_10286108 Ga0075368_102861082 134
130 3300006195 Ga0075366_10039836 Ga0075366_100398364 134
131 3300006881 Ga0068865_100000036 Ga0068865_10000003616 134
132 3300009098 Ga0105245_10003374 Ga0105245_100033746 134
133 3300009148 Ga0105243_10000625 Ga0105243_1000062516 134
134 3300009176 Ga0105242_10010105 Ga0105242_100101054 134
135 3300009553 Ga0105249_10014632 Ga0105249_100146327 134
136 3300013297 Ga0157378_10001248 Ga0157378_100012486 134
137 3300013308 Ga0157375_10009204 Ga0157375_100092045 134
138 3300014969 Ga0157376_10000033 Ga0157376_10000033150 134
139 3300025899 Ga0207642_10348765 Ga0207642_103487652 134
140 3300025907 Ga0207645_10000117 Ga0207645_1000011716 134
141 3300025927 Ga0207687_10000372 Ga0207687_100003724 134
142 3300025935 Ga0207709_10000102 Ga0207709_10000102120 134
143 3300025938 Ga0207704_10000014 Ga0207704_10000014150 134
144 3300025942 Ga0207689_10000364 Ga0207689_1000036421 134
145 3300025960 Ga0207651_10000015 Ga0207651_1000001517 134
146 3300025961 Ga0207712_10007151 Ga0207712_100071514 134
147 3300026089 Ga0207648_10000014 Ga0207648_1000001416 134
148 3300044735 Ga0466968_0052416 Ga0466968_0052416_1273_1695 134
149 3300050493 nmdc:mga0k408_47641_c1 nmdc:mga0k408_47641_c1_378_806 134
150 3300053104 Ga0500556_0163608 Ga0500556_0163608_201_629 134
151 3300005457 Ga0070662_100213695 Ga0070662_1002136952 135
152 3300005458 Ga0070681_10276139 Ga0070681_102761392 135
153 3300005841 Ga0068863_100110100 Ga0068863_1001101004 135
154 3300006195 Ga0075366_10107099 Ga0075366_101070992 135
155 3300025912 Ga0207707_10471975 Ga0207707_104719752 135
156 3300025932 Ga0207690_10020269 Ga0207690_100202696 135
157 3300025933 Ga0207706_10220286 Ga0207706_102202862 135
158 3300026088 Ga0207641_10262573 Ga0207641_102625733 135
159 3300046684 Ga0495669_0294119 Ga0495669_0294119_261_689 135
160 3300047472 Ga0495686_0001180 Ga0495686_0001180_9097_9516 135
161 3300048091 Ga0495626_0260771 Ga0495626_0260771_152_580 135
162 3300049583 Ga0501067_0010483 Ga0501067_0010483_68_496 135
163 3300050491 nmdc:mga00v17_162212_c1 nmdc:mga00v17_162212_c1_438_866 135
164 3300050493 nmdc:mga0k408_52517_c1 nmdc:mga0k408_52517_c1_1911_2339 135
165 3300005290 Ga0065712_10025333 Ga0065712_100253332 136
166 3300005293 Ga0065715_10151206 Ga0065715_101512062 136
167 3300005331 Ga0070670_100054445 Ga0070670_1000544453 136
168 3300005343 Ga0070687_100133034 Ga0070687_1001330342 136
169 3300005344 Ga0070661_100716557 Ga0070661_1007165571 136
170 3300005347 Ga0070668_100105017 Ga0070668_1001050174 136
171 3300005353 Ga0070669_100055434 Ga0070669_1000554344 136
172 3300005353 Ga0070669_100092353 Ga0070669_1000923534 136
173 3300005354 Ga0070675_100099795 Ga0070675_1000997951 136
174 3300005364 Ga0070673_100129468 Ga0070673_1001294681 136
175 3300005455 Ga0070663_101522061 Ga0070663_1015220611 136
176 3300005459 Ga0068867_101316418 Ga0068867_1013164181 136
177 3300005543 Ga0070672_100597351 Ga0070672_1005973512 136
178 3300005564 Ga0070664_100098528 Ga0070664_1000985282 136
179 3300005564 Ga0070664_101476807 Ga0070664_1014768071 136
180 3300005615 Ga0070702_100974338 Ga0070702_1009743381 136
181 3300005618 Ga0068864_100272404 Ga0068864_1002724042 136
182 3300005840 Ga0068870_10060481 Ga0068870_100604814 136
183 3300005844 Ga0068862_100469141 Ga0068862_1004691412 136
184 3300013100 Ga0157373_10439398 Ga0157373_104393982 136
185 3300013102 Ga0157371_10499091 Ga0157371_104990912 136
186 3300014326 Ga0157380_10728580 Ga0157380_107285801 136
187 3300025893 Ga0207682_10035217 Ga0207682_100352172 136
188 3300025923 Ga0207681_10909913 Ga0207681_109099131 136
189 3300025925 Ga0207650_10058848 Ga0207650_100588483 136
190 3300025926 Ga0207659_11033178 Ga0207659_110331782 136
191 3300025931 Ga0207644_10786152 Ga0207644_107861521 136
192 3300025932 Ga0207690_10612900 Ga0207690_106129002 136
193 3300025933 Ga0207706_10309401 Ga0207706_103094011 136
194 3300025945 Ga0207679_11855002 Ga0207679_118550021 136
195 3300025960 Ga0207651_10306421 Ga0207651_103064212 136
196 3300025986 Ga0207658_11297866 Ga0207658_112978661 136
197 3300026067 Ga0207678_10674959 Ga0207678_106749591 136
198 3300026089 Ga0207648_10368805 Ga0207648_103688051 136
199 3300026095 Ga0207676_11060667 Ga0207676_110606671 136
200 3300026116 Ga0207674_10019434 Ga0207674_100194348 136
201 3300027876 Ga0209974_10012483 Ga0209974_100124834 136
202 3300031548 Ga0307408_100089281 Ga0307408_1000892812 136
203 3300031731 Ga0307405_10032752 Ga0307405_100327522 136
204 3300031731 Ga0307405_10054703 Ga0307405_100547032 136
205 3300031731 Ga0307405_10412961 Ga0307405_104129612 136
206 3300031824 Ga0307413_10011941 Ga0307413_100119412 136
207 3300031824 Ga0307413_10220232 Ga0307413_102202322 136
208 3300031852 Ga0307410_10082320 Ga0307410_100823204 136
209 3300031852 Ga0307410_10120430 Ga0307410_101204301 136
210 3300031852 Ga0307410_10422557 Ga0307410_104225571 136
211 3300031901 Ga0307406_10119809 Ga0307406_101198091 136
212 3300031901 Ga0307406_10330853 Ga0307406_103308532 136
213 3300031903 Ga0307407_10009986 Ga0307407_100099867 136
214 3300031903 Ga0307407_10690161 Ga0307407_106901611 136
215 3300031911 Ga0307412_10397357 Ga0307412_103973572 136
216 3300031995 Ga0307409_100009926 Ga0307409_1000099268 136
217 3300031995 Ga0307409_100632998 Ga0307409_1006329982 136
218 3300031995 Ga0307409_101609992 Ga0307409_1016099922 136
219 3300031995 Ga0307409_101741278 Ga0307409_1017412781 136
220 3300032002 Ga0307416_100111611 Ga0307416_1001116112 136
221 3300032002 Ga0307416_100307378 Ga0307416_1003073782 136
222 3300032002 Ga0307416_100396394 Ga0307416_1003963942 136
223 3300032004 Ga0307414_10043188 Ga0307414_100431882 136
224 3300032004 Ga0307414_10046104 Ga0307414_100461042 136
225 3300032004 Ga0307414_10512816 Ga0307414_105128162 136
226 3300032004 Ga0307414_11054679 Ga0307414_110546792 136
227 3300032005 Ga0307411_10001850 Ga0307411_100018506 136
228 3300032005 Ga0307411_10014110 Ga0307411_100141103 136
229 3300032005 Ga0307411_10200650 Ga0307411_102006502 136
230 3300032126 Ga0307415_100006164 Ga0307415_1000061645 136
231 3300032126 Ga0307415_100028330 Ga0307415_1000283303 136
232 3300032126 Ga0307415_100387004 Ga0307415_1003870042 136
233 3300035691 Ga0373931_0201526 Ga0373931_0201526_385_795 136
234 3300042007 Ga0439449_0016276 Ga0439449_0016276_1737_2153 136
235 3300042876 Ga0451577_0454094 Ga0451577_0454094_378_794 136
236 3300046684 Ga0495669_0002940 Ga0495669_0002940_5891_6307 136
237 3300048905 Ga0496102_0221274 Ga0496102_0221274_249_665 136
238 3300048911 Ga0496108_0532274 Ga0496108_0532274_563_979 136
239 3300048912 Ga0496109_0168390 Ga0496109_0168390_1214_1630 136
240 3300048913 Ga0496110_0148557 Ga0496110_0148557_336_752 136
241 3300048920 Ga0496117_0170373 Ga0496117_0170373_464_883 136
242 3300048921 Ga0496118_0014286 Ga0496118_0014286_3975_4394 136
243 3300048921 Ga0496118_0108997 Ga0496118_0108997_565_984 136
244 3300048922 Ga0496119_0021258 Ga0496119_0021258_782_1201 136
245 3300048923 Ga0496120_0188712 Ga0496120_0188712_299_718 136
246 3300048924 Ga0496121_0034647 Ga0496121_0034647_1558_1977 136
247 3300048924 Ga0496121_0835333 Ga0496121_0835333_73_492 136
248 3300048925 Ga0496122_0020308 Ga0496122_0020308_3249_3668 136
249 3300048926 Ga0496123_0011998 Ga0496123_0011998_3968_4387 136
250 3300048928 Ga0496125_0074479 Ga0496125_0074479_81_500 136
251 3300048928 Ga0496125_0117667 Ga0496125_0117667_1011_1433 136
252 3300053142 Ga0500577_0056447 Ga0500577_0056447_250_672 136
253 3300005366 Ga0070659_101551939 Ga0070659_1015519391 137
254 3300005563 Ga0068855_100509389 Ga0068855_1005093892 137
255 3300005614 Ga0068856_100177323 Ga0068856_1001773232 137
256 3300005616 Ga0068852_100065803 Ga0068852_1000658034 137
257 3300009177 Ga0105248_10900509 Ga0105248_109005091 137
258 3300013100 Ga0157373_10069981 Ga0157373_100699815 137
259 3300013100 Ga0157373_10420567 Ga0157373_104205672 137
260 3300013102 Ga0157371_10192669 Ga0157371_101926692 137
261 3300013104 Ga0157370_11388877 Ga0157370_113888771 137
262 3300013105 Ga0157369_10112726 Ga0157369_101127262 137
263 3300013105 Ga0157369_10615207 Ga0157369_106152072 137
264 3300026116 Ga0207674_10253942 Ga0207674_102539423 137
265 3300026142 Ga0207698_10096358 Ga0207698_100963581 137
266 3300032002 Ga0307416_100960569 Ga0307416_1009605692 137
267 3300037471 Ga0395905_1460781 Ga0395905_1460781_13_435 137
268 3300041455 Ga0451801_08754 Ga0451801_08754_32_454 137
269 3300041458 Ga0451798_0509006 Ga0451798_0509006_55_477 137
270 3300041459 Ga0451800_0865922 Ga0451800_0865922_1896_2318 137
271 3300041460 Ga0451802_1436532 Ga0451802_1436532_38_460 137
272 3300041461 Ga0451805_038156 Ga0451805_038156_1164_1586 137
273 3300041462 Ga0451806_833252 Ga0451806_833252_201_623 137
274 3300046506 Ga0495583_0000038 Ga0495583_0000038_171766_172188 137
275 3300046507 Ga0495606_0015264 Ga0495606_0015264_1172_1597 137
276 3300046507 Ga0495606_0027801 Ga0495606_0027801_1901_2326 137
277 3300046507 Ga0495606_0342005 Ga0495606_0342005_333_758 137
278 3300046524 Ga0495648_0306787 Ga0495648_0306787_17_442 137
279 3300047472 Ga0495686_0001180 Ga0495686_0001180_8499_8912 137
280 3300047472 Ga0495686_0026515 Ga0495686_0026515_1481_1906 137
281 3300048914 Ga0496111_0146911 Ga0496111_0146911_729_1154 137
282 3300048921 Ga0496118_0324667 Ga0496118_0324667_389_802 137
283 3300048924 Ga0496121_0013505 Ga0496121_0013505_980_1393 137
284 3300048925 Ga0496122_0002498 Ga0496122_0002498_716_1141 137
285 3300048926 Ga0496123_0005014 Ga0496123_0005014_8571_8996 137
286 3300048926 Ga0496123_0090761 Ga0496123_0090761_393_818 137
287 3300048927 Ga0496124_0012349 Ga0496124_0012349_5917_6342 137
288 3300048927 Ga0496124_0384695 Ga0496124_0384695_479_901 137
289 3300048927 Ga0496124_0743469 Ga0496124_0743469_149_574 137
290 3300048927 Ga0496124_0815600 Ga0496124_0815600_104_526 137
291 3300048928 Ga0496125_0048028 Ga0496125_0048028_2869_3294 137
292 3300048928 Ga0496125_0629238 Ga0496125_0629238_43_468 137
293 3300049460 Ga0495682_0173415 Ga0495682_0173415_237_659 137
294 3300049513 Ga0501290_005933 Ga0501290_005933_472_897 137
295 3300049523 Ga0501300_002856 Ga0501300_002856_869_1294 137
296 3300049686 Ga0501257_000127 Ga0501257_000127_16946_17371 137
297 3300049776 Ga0501280_006279 Ga0501280_006279_1095_1520 137
298 3300053087 Ga0500643_206581 Ga0500643_206581_85_510 137
299 3300053103 Ga0500555_008517 Ga0500555_008517_31_453 137
300 3300053138 Ga0500564_145270 Ga0500564_145270_144_569 137
301 3300053153 Ga0500616_0099575 Ga0500616_0099575_978_1403 137
302 3300053153 Ga0500616_0110614 Ga0500616_0110614_784_1209 137
303 3300001904 JGI24736J21556_1009367 JGI24736J21556_10093673 138
304 3300001904 JGI24736J21556_1011161 JGI24736J21556_10111612 138
305 3300001904 JGI24736J21556_1056618 JGI24736J21556_10566181 138
306 3300001989 JGI24739J22299_10000499 JGI24739J22299_100004999 138
307 3300001990 JGI24737J22298_10000425 JGI24737J22298_1000042510 138
308 3300001990 JGI24737J22298_10084113 JGI24737J22298_100841132 138
309 3300001990 JGI24737J22298_10173614 JGI24737J22298_101736142 138
310 3300002067 JGI24735J21928_10008328 JGI24735J21928_100083282 138
311 3300002067 JGI24735J21928_10013019 JGI24735J21928_100130193 138
312 3300002067 JGI24735J21928_10014717 JGI24735J21928_100147173 138
313 3300002067 JGI24735J21928_10046550 JGI24735J21928_100465502 138
314 3300002067 JGI24735J21928_10118887 JGI24735J21928_101188871 138
315 3300002075 JGI24738J21930_10000040 JGI24738J21930_1000004016 138
316 3300002741 JGI25157J39369_1027831 JGI25157J39369_10278311 138
317 3300003316 rootH1_10023776 rootH1_100237762 138
318 3300003322 rootL2_10067612 rootL2_100676121 138
319 3300003322 rootL2_10111258 rootL2_101112582 138
320 3300005295 Ga0065707_10548540 Ga0065707_105485402 138
321 3300005331 Ga0070670_100402937 Ga0070670_1004029372 138
322 3300005355 Ga0070671_100026971 Ga0070671_1000269714 138
323 3300005356 Ga0070674_100100296 Ga0070674_1001002961 138
324 3300005455 Ga0070663_102024314 Ga0070663_1020243141 138
325 3300005457 Ga0070662_100003287 Ga0070662_10000328712 138
326 3300005539 Ga0068853_100112950 Ga0068853_1001129503 138
327 3300005539 Ga0068853_100373534 Ga0068853_1003735343 138
328 3300005548 Ga0070665_100865204 Ga0070665_1008652042 138
329 3300005564 Ga0070664_100159508 Ga0070664_1001595083 138
330 3300005616 Ga0068852_100685589 Ga0068852_1006855892 138
331 3300005841 Ga0068863_100003363 Ga0068863_10000336311 138
332 3300011119 Ga0105246_10169600 Ga0105246_101696003 138
333 3300012513 Ga0157326_1000156 Ga0157326_100015612 138
334 3300013100 Ga0157373_10128281 Ga0157373_101282812 138
335 3300013102 Ga0157371_10068304 Ga0157371_100683043 138
336 3300013104 Ga0157370_10000112 Ga0157370_1000011220 138
337 3300013296 Ga0157374_12174880 Ga0157374_121748801 138
338 3300013307 Ga0157372_10060831 Ga0157372_100608314 138
339 3300013307 Ga0157372_10659122 Ga0157372_106591222 138
340 3300013307 Ga0157372_11187732 Ga0157372_111877322 138
341 3300017792 Ga0163161_11055953 Ga0163161_110559531 138
342 3300025903 Ga0207680_10012735 Ga0207680_100127353 138
343 3300025904 Ga0207647_10026436 Ga0207647_100264364 138
344 3300025904 Ga0207647_10243382 Ga0207647_102433822 138
345 3300025925 Ga0207650_10487178 Ga0207650_104871782 138
346 3300025931 Ga0207644_10083792 Ga0207644_100837922 138
347 3300025932 Ga0207690_11430362 Ga0207690_114303621 138
348 3300025933 Ga0207706_10003421 Ga0207706_1000342111 138
349 3300025940 Ga0207691_10672399 Ga0207691_106723992 138
350 3300026041 Ga0207639_10260661 Ga0207639_102606612 138
351 3300026041 Ga0207639_10260661 Ga0207639_102606613 138
352 3300026067 Ga0207678_10127930 Ga0207678_101279303 138
353 3300026088 Ga0207641_10103806 Ga0207641_101038062 138
354 3300026142 Ga0207698_10427291 Ga0207698_104272912 138
355 3300026142 Ga0207698_10427291 Ga0207698_104272913 138
356 3300028379 Ga0268266_11607873 Ga0268266_116078731 138
357 3300028380 Ga0268265_11634818 Ga0268265_116348182 138
358 3300037418 Ga0395900_0017530 Ga0395900_0017530_5892_6317 138
359 3300042005 Ga0439448_0011460 Ga0439448_0011460_1470_1895 138
360 3300042012 Ga0439455_0006341 Ga0439455_0006341_439_864 138
361 3300044693 Ga0466961_0498378 Ga0466961_0498378_66_491 138
362 3300047472 Ga0495686_0013900 Ga0495686_0013900_4535_4966 138
363 3300001979 JGI24740J21852_10005435 JGI24740J21852_100054354 139
364 3300005339 Ga0070660_100000280 Ga0070660_10000028019 139
365 3300005577 Ga0068857_100359816 Ga0068857_1003598163 139
366 3300005616 Ga0068852_101234667 Ga0068852_1012346672 139
367 3300009545 Ga0105237_10032435 Ga0105237_100324357 139
368 3300010375 Ga0105239_10349003 Ga0105239_103490032 139
369 3300013102 Ga0157371_11317769 Ga0157371_113177692 139
370 3300013105 Ga0157369_10183560 Ga0157369_101835604 139
371 3300013307 Ga0157372_10442129 Ga0157372_104421292 139
372 3300025254 Ga0209148_1000127 Ga0209148_1000127167 139
373 3300025914 Ga0207671_10133601 Ga0207671_101336011 139
374 3300025919 Ga0207657_10000983 Ga0207657_1000098316 139
375 3300025949 Ga0207667_10490765 Ga0207667_104907651 139
376 3300026142 Ga0207698_11444009 Ga0207698_114440091 139
377 3300044842 Ga0466957_0544323 Ga0466957_0544323_71_496 139
378 3300048921 Ga0496118_0108997 Ga0496118_0108997_1127_1546 139
379 3300048921 Ga0496118_0293506 Ga0496118_0293506_367_789 139
380 3300048927 Ga0496124_0317582 Ga0496124_0317582_296_715 139
381 3300048929 Ga0496126_0948736 Ga0496126_0948736_129_548 139
382 3300061719 Ga0466962_0039928 Ga0466962_0039928_1584_2003 139
383 3300001904 JGI24736J21556_1004956 JGI24736J21556_10049563 140
384 3300001989 JGI24739J22299_10002846 JGI24739J22299_100028466 140
385 3300001989 JGI24739J22299_10007494 JGI24739J22299_100074944 140
386 3300001990 JGI24737J22298_10016120 JGI24737J22298_100161202 140
387 3300002067 JGI24735J21928_10017843 JGI24735J21928_100178431 140
388 3300002067 JGI24735J21928_10110931 JGI24735J21928_101109311 140
389 3300002239 JGI24034J26672_10056361 JGI24034J26672_100563611 140
390 3300005335 Ga0070666_10118705 Ga0070666_101187053 140
391 3300005347 Ga0070668_100104725 Ga0070668_1001047253 140
392 3300005354 Ga0070675_100836555 Ga0070675_1008365551 140
393 3300005355 Ga0070671_100009712 Ga0070671_1000097127 140
394 3300005356 Ga0070674_100030763 Ga0070674_1000307636 140
395 3300005455 Ga0070663_100731927 Ga0070663_1007319271 140
396 3300005547 Ga0070693_100037937 Ga0070693_1000379373 140
397 3300009093 Ga0105240_10131648 Ga0105240_101316481 140
398 3300009545 Ga0105237_10692829 Ga0105237_106928292 140
399 3300013100 Ga0157373_10249373 Ga0157373_102493731 140
400 3300013100 Ga0157373_10881285 Ga0157373_108812851 140
401 3300013104 Ga0157370_10000112 Ga0157370_1000011219 140
402 3300013105 Ga0157369_10878774 Ga0157369_108787741 140
403 3300013307 Ga0157372_10869228 Ga0157372_108692282 140
404 3300025903 Ga0207680_10061914 Ga0207680_100619143 140
405 3300025904 Ga0207647_10002638 Ga0207647_100026389 140
406 3300025904 Ga0207647_10114276 Ga0207647_101142762 140
407 3300025913 Ga0207695_10053176 Ga0207695_100531763 140
408 3300025914 Ga0207671_10460294 Ga0207671_104602942 140
409 3300025932 Ga0207690_10293626 Ga0207690_102936261 140
410 3300025933 Ga0207706_10045597 Ga0207706_100455974 140
411 3300025933 Ga0207706_10103166 Ga0207706_101031663 140
412 3300025937 Ga0207669_10148371 Ga0207669_101483712 140
413 3300025972 Ga0207668_10308355 Ga0207668_103083552 140
414 3300026067 Ga0207678_11900625 Ga0207678_119006251 140
415 3300042012 Ga0439455_0016446 Ga0439455_0016446_350_772 140
416 3300042157 Ga0439458_0001585 Ga0439458_0001585_2385_2807 140
417 3300044683 Ga0466965_0009881 Ga0466965_0009881_988_1410 140
418 3300044684 Ga0466966_0128710 Ga0466966_0128710_994_1416 140
419 3300044693 Ga0466961_0021721 Ga0466961_0021721_3208_3630 140
420 3300044765 Ga0466970_0018629 Ga0466970_0018629_1463_1885 140
421 3300045049 Ga0466959_0002221 Ga0466959_0002221_11377_11799 140
422 3300047323 Ga0495683_0137165 Ga0495683_0137165_494_916 140
423 3300047443 Ga0495687_108284 Ga0495687_108284_287_709 140
424 3300049679 Ga0501249_002715 Ga0501249_002715_3032_3460 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

33

156

0.94

Feature Viewer

pLDDT pTM Quality
74.25 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map