F440441

General Info

Members Datasets Scaffolds Average Seq Length
423 245 846 330

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10005645|Ga0055531_100056456
Length 381
Sequence MARSVDSTHTLAAGRLVPGAPIPILRRLSRPQHVVLDCWEAECVSRMARIGLMPDKHFDVCGIGNAIVDVFSHCEEEFLSKMSLTKGAMMLVDPKRSGELYDAMGPAVEVSGGAAANTIAGLASLGGKGAYIGKVGNDQLGGIFRHDIRAAGVHFETPSVTSATPTARSMIFVTPDAERTMNTYLGACVELTPDDVDPAVIQHSKVTYLEGYLWDPPLAKQAFLKAADLAHQAGRQIALTLSDSFCVIRYLKEFQDLVRDHVDILFANEGEIKALWETDNYEEAVQITRGACDLAALTRSEKGSLIVTPETVVEVPAWPVPKIVDLTGAGDLFAAGFLYGYTQGRNHADCGRIGSLAAGEVISHYGARPETPLSELLLQAV

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
237 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
242 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
243 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
244 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
245 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 0.71
Rhizosphere 89.13
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10005645 3300003794 Bacteria 7275
2 JGI24750J21931_1014346 3300002070 Bacteria 1065
3 Ga0065714_10138376 3300005288 Bacteria 1191
4 Ga0065712_10098243 3300005290 Bacteria 2125
5 Ga0065715_10010002 3300005293 Bacteria 2507
6 Ga0065715_10096764 3300005293 Bacteria 3802
7 Ga0065707_10114859 3300005295 Bacteria 2285
8 Ga0070676_10008338 3300005328 Bacteria 5585
9 Ga0070676_10025709 3300005328 Bacteria 3329
10 Ga0070676_10228152 3300005328 Bacteria 1233
11 Ga0070670_100003422 3300005331 Bacteria 13168
12 Ga0068869_100023834 3300005334 Bacteria 4234
13 Ga0068869_100290421 3300005334 Bacteria 1317
14 Ga0068869_100467795 3300005334 Bacteria 1048
15 Ga0070666_10007597 3300005335 Bacteria 6688
16 Ga0070666_10092944 3300005335 Bacteria 2074
17 Ga0070680_100181320 3300005336 Bacteria 1773
18 Ga0068868_100003663 3300005338 Bacteria 10732
19 Ga0068868_100252332 3300005338 Bacteria 1485
20 Ga0070689_100064030 3300005340 Bacteria 2861
21 Ga0070689_100152733 3300005340 Bacteria 1863
22 Ga0070687_100019698 3300005343 Bacteria 3143
23 Ga0070668_100007572 3300005347 Bacteria 8060
24 Ga0070668_100182786 3300005347 Bacteria 1714
25 Ga0070669_100011821 3300005353 Bacteria 6192
26 Ga0070669_100017594 3300005353 Bacteria 5099
27 Ga0070669_100133036 3300005353 Bacteria 1910
28 Ga0070669_100160226 3300005353 Bacteria 1748
29 Ga0070675_100011275 3300005354 Bacteria 6997
30 Ga0070675_100076093 3300005354 Bacteria 2791
31 Ga0070675_100091546 3300005354 Bacteria 2548
32 Ga0070675_100114883 3300005354 Bacteria 2281
33 Ga0070675_100441489 3300005354 Bacteria 1166
34 Ga0070674_100005377 3300005356 Bacteria 7388
35 Ga0070674_100007641 3300005356 Bacteria 6385
36 Ga0070674_100146424 3300005356 Bacteria 1778
37 Ga0070674_100266908 3300005356 Bacteria 1351
38 Ga0070673_100002277 3300005364 Bacteria 11638
39 Ga0070673_100012859 3300005364 Bacteria 5763
40 Ga0070673_100024436 3300005364 Bacteria 4431
41 Ga0070673_100104591 3300005364 Bacteria 2338
42 Ga0070688_100004046 3300005365 Bacteria 7610
43 Ga0070659_100142441 3300005366 Bacteria 1952
44 Ga0070667_100005177 3300005367 Bacteria 10902
45 Ga0070667_100106339 3300005367 Bacteria 2429
46 Ga0070709_10171579 3300005434 Bacteria 1516
47 Ga0070700_100028653 3300005441 Bacteria 3315
48 Ga0070700_100186714 3300005441 Bacteria 1447
49 Ga0070694_100003668 3300005444 Bacteria 9157
50 Ga0070694_100173017 3300005444 Bacteria 1592
51 Ga0070708_100041567 3300005445 Bacteria 4031
52 Ga0070708_100216060 3300005445 Bacteria 1797
53 Ga0070708_100247068 3300005445 Bacteria 1676
54 Ga0070678_100045484 3300005456 Bacteria 3141
55 Ga0070662_100001711 3300005457 Bacteria 13500
56 Ga0070662_100275170 3300005457 Bacteria 1361
57 Ga0070681_10203864 3300005458 Bacteria 1895
58 Ga0070706_100139887 3300005467 Bacteria 2260
59 Ga0070707_100016251 3300005468 Bacteria 6986
60 Ga0070707_100202571 3300005468 Bacteria 1934
61 Ga0070698_100102131 3300005471 Bacteria 2839
62 Ga0070698_100126594 3300005471 Bacteria 2511
63 Ga0070699_100036490 3300005518 Bacteria 4253
64 Ga0070697_100085452 3300005536 Bacteria 2603
65 Ga0068853_100159574 3300005539 Bacteria 2034
66 Ga0070672_100038618 3300005543 Bacteria 3650
67 Ga0070672_100068197 3300005543 Bacteria 2821
68 Ga0070686_100024278 3300005544 Bacteria 3632
69 Ga0070695_100350430 3300005545 Bacteria 1106
70 Ga0070665_100024457 3300005548 Bacteria 6083
71 Ga0070665_100386934 3300005548 Bacteria 1406
72 Ga0068855_100459241 3300005563 Bacteria 1389
73 Ga0070664_100017138 3300005564 Bacteria 5947
74 Ga0068856_100620261 3300005614 Bacteria 1102
75 Ga0070702_100158623 3300005615 Bacteria 1460
76 Ga0068859_100012225 3300005617 Bacteria 8632
77 Ga0068859_100044756 3300005617 Bacteria 4447
78 Ga0068864_100307819 3300005618 Bacteria 1485
79 Ga0068866_10082011 3300005718 Bacteria 1734
80 Ga0068870_10009598 3300005840 Bacteria 4409
81 Ga0068870_10118355 3300005840 Bacteria 1522
82 Ga0068863_100006009 3300005841 Bacteria 11903
83 Ga0068863_100319873 3300005841 Bacteria 1507
84 Ga0068858_100308128 3300005842 Bacteria 1512
85 Ga0068860_100025877 3300005843 Bacteria 5660
86 Ga0068862_100020776 3300005844 Bacteria 5484
87 Ga0068862_100023434 3300005844 Bacteria 5172
88 Ga0068862_100068815 3300005844 Bacteria 3055
89 Ga0081455_10040280 3300005937 Bacteria 4121
90 Ga0081538_10000547 3300005981 Bacteria 41476
91 Ga0081539_10000122 3300005985 Bacteria 183393
92 Ga0081539_10002930 3300005985 Bacteria 22480
93 Ga0075362_10046199 3300006177 Bacteria 1936
94 Ga0068871_100096130 3300006358 Bacteria 2474
95 Ga0068871_100254922 3300006358 Bacteria 1529
96 Ga0075428_100009981 3300006844 Bacteria 10551
97 Ga0075428_100150318 3300006844 Bacteria 2530
98 Ga0075430_100000981 3300006846 Bacteria 22489
99 Ga0075430_100052089 3300006846 Bacteria 3447
100 Ga0075430_100262592 3300006846 Bacteria 1430
101 Ga0075431_100003481 3300006847 Bacteria 15260
102 Ga0075431_100343163 3300006847 Bacteria 1502
103 Ga0075433_10000088 3300006852 Bacteria 42389
104 Ga0075433_10001425 3300006852 Bacteria 17627
105 Ga0075433_10096727 3300006852 Bacteria 2613
106 Ga0075433_10300744 3300006852 Bacteria 1421
107 Ga0075434_100004236 3300006871 Bacteria 12862
108 Ga0075434_100012586 3300006871 Bacteria 8023
109 Ga0075434_100068604 3300006871 Bacteria 3533
110 Ga0075434_100078965 3300006871 Bacteria 3287
111 Ga0075429_100001454 3300006880 Bacteria 19443
112 Ga0075429_100043288 3300006880 Bacteria 3918
113 Ga0075429_100109563 3300006880 Bacteria 2414
114 Ga0068865_100020147 3300006881 Bacteria 4325
115 Ga0075436_100204197 3300006914 Bacteria 1400
116 Ga0075436_100267945 3300006914 Unclassified 1219
117 Ga0097620_100012227 3300006931 Bacteria 8632
118 Ga0097620_100044754 3300006931 Bacteria 4447
119 Ga0097620_100717477 3300006931 Bacteria 1090
120 Ga0075435_100151603 3300007076 Bacteria 1949
121 Ga0075435_100193580 3300007076 Bacteria 1722
122 Ga0105240_10103875 3300009093 Bacteria 3451
123 Ga0111539_10000325 3300009094 Bacteria 58382
124 Ga0111539_10001033 3300009094 Bacteria 36485
125 Ga0111539_10003536 3300009094 Bacteria 20604
126 Ga0111539_10004520 3300009094 Bacteria 18191
127 Ga0111539_10371581 3300009094 Bacteria 1664
128 Ga0111539_10812714 3300009094 Bacteria 1088
129 Ga0114129_10039845 3300009147 Bacteria 6627
130 Ga0114129_10041657 3300009147 Bacteria 6469
131 Ga0114129_10047476 3300009147 Bacteria 6032
132 Ga0114129_10050374 3300009147 Bacteria 5850
133 Ga0114129_10225643 3300009147 Bacteria 2525
134 Ga0105243_10614450 3300009148 Bacteria 1048
135 Ga0105237_10136613 3300009545 Bacteria 2446
136 Ga0105238_10011358 3300009551 Bacteria 8963
137 Ga0105249_10004378 3300009553 Bacteria 12211
138 Ga0099796_10035291 3300010159 Bacteria 1658
139 Ga0105239_10470238 3300010375 Bacteria 1427
140 Ga0157369_10110028 3300013105 Bacteria 2929
141 Ga0157372_10140302 3300013307 Bacteria 2784
142 Ga0157375_10058045 3300013308 Bacteria 3828
143 Ga0157375_10405363 3300013308 Bacteria 1530
144 Ga0163163_10174570 3300014325 Bacteria 2195
145 Ga0163163_10318956 3300014325 Bacteria 1608
146 Ga0157380_10003630 3300014326 Bacteria 10610
147 Ga0157380_10024332 3300014326 Bacteria 4582
148 Ga0157377_10003447 3300014745 Bacteria 7163
149 Ga0157377_10037020 3300014745 Bacteria 2687
150 Ga0157379_10026036 3300014968 Bacteria 5203
151 Ga0157376_10045683 3300014969 Bacteria 3607
152 Ga0213872_10031507 3300021361 Bacteria 2430
153 Ga0213876_10022229 3300021384 Bacteria 3354
154 Ga0213875_10006512 3300021388 Bacteria 6118
155 Ga0209148_1000698 3300025254 Bacteria 27200
156 Ga0209455_1000286 3300025272 Bacteria 54036
157 Ga0209675_1004324 3300025291 Bacteria 6366
158 Ga0209676_1005832 3300025292 Bacteria 6292
159 Ga0209758_1000095 3300025297 Bacteria 237870
160 Ga0209050_1002437 3300025298 Bacteria 15969
161 Ga0209257_1000339 3300025304 Bacteria 97703
162 Ga0207697_10000651 3300025315 Bacteria 19784
163 Ga0207682_10002970 3300025893 Bacteria 7443
164 Ga0207682_10009792 3300025893 Bacteria 3773
165 Ga0207642_10037512 3300025899 Bacteria 2089
166 Ga0207688_10002639 3300025901 Bacteria 9703
167 Ga0207688_10006702 3300025901 Bacteria 6265
168 Ga0207645_10008259 3300025907 Bacteria 7278
169 Ga0207645_10212258 3300025907 Bacteria 1275
170 Ga0207643_10006923 3300025908 Bacteria 6080
171 Ga0207643_10009396 3300025908 Bacteria 5253
172 Ga0207707_10079664 3300025912 Bacteria 2860
173 Ga0207695_10009371 3300025913 Bacteria 12106
174 Ga0207695_10022653 3300025913 Bacteria 7121
175 Ga0207660_10171636 3300025917 Bacteria 1679
176 Ga0207662_10045065 3300025918 Bacteria 2606
177 Ga0207646_10112595 3300025922 Bacteria 2443
178 Ga0207650_10007614 3300025925 Bacteria 7379
179 Ga0207650_10025348 3300025925 Bacteria 4224
180 Ga0207659_10003008 3300025926 Bacteria 10050
181 Ga0207659_10030185 3300025926 Bacteria 3701
182 Ga0207659_10075765 3300025926 Bacteria 2470
183 Ga0207659_10277387 3300025926 Bacteria 1369
184 Ga0207659_10290714 3300025926 Bacteria 1339
185 Ga0207690_10110864 3300025932 Bacteria 1976
186 Ga0207706_10002317 3300025933 Bacteria 18582
187 Ga0207706_10104763 3300025933 Bacteria 2489
188 Ga0207669_10003634 3300025937 Bacteria 6693
189 Ga0207669_10024304 3300025937 Bacteria 3254
190 Ga0207669_10037290 3300025937 Bacteria 2788
191 Ga0207704_10003441 3300025938 Bacteria 7194
192 Ga0207691_10015670 3300025940 Bacteria 7205
193 Ga0207691_10022652 3300025940 Bacteria 5924
194 Ga0207691_10037121 3300025940 Bacteria 4513
195 Ga0207691_10045864 3300025940 Bacteria 4018
196 Ga0207689_10008071 3300025942 Bacteria 9181
197 Ga0207689_10051706 3300025942 Bacteria 3387
198 Ga0207679_10040477 3300025945 Bacteria 3336
199 Ga0207667_10148866 3300025949 Bacteria 2410
200 Ga0207651_10005919 3300025960 Bacteria 6332
201 Ga0207651_10019612 3300025960 Bacteria 4058
202 Ga0207651_10093770 3300025960 Bacteria 2205
203 Ga0207651_10284380 3300025960 Bacteria 1368
204 Ga0207668_10131966 3300025972 Bacteria 1909
205 Ga0207668_10160236 3300025972 Bacteria 1752
206 Ga0207658_10106393 3300025986 Bacteria 2208
207 Ga0207658_10223660 3300025986 Bacteria 1585
208 Ga0207677_10014887 3300026023 Bacteria 4556
209 Ga0207677_10184019 3300026023 Bacteria 1646
210 Ga0207678_10139081 3300026067 Bacteria 2072
211 Ga0207708_10003781 3300026075 Bacteria 11155
212 Ga0207641_10019151 3300026088 Bacteria 5614
213 Ga0207641_10307291 3300026088 Bacteria 1500
214 Ga0207648_10060419 3300026089 Bacteria 3305
215 Ga0207676_10374004 3300026095 Bacteria 1324
216 Ga0207674_10117926 3300026116 Bacteria 2625
217 Ga0207675_100017723 3300026118 Bacteria 6644
218 Ga0207675_100040312 3300026118 Bacteria 4361
219 Ga0207683_10325085 3300026121 Bacteria 1409
220 Ga0209983_1024458 3300027665 Bacteria 1271
221 Ga0207428_10000207 3300027907 Bacteria 81801
222 Ga0207428_10000440 3300027907 Bacteria 50907
223 Ga0207428_10003027 3300027907 Bacteria 16548
224 Ga0207428_10011232 3300027907 Bacteria 7941
225 Ga0207428_10045478 3300027907 Bacteria 3535
226 Ga0268266_10260080 3300028379 Bacteria 1608
227 Ga0268265_10033582 3300028380 Bacteria 3731
228 Ga0268265_10176750 3300028380 Bacteria 1830
229 Ga0268264_10076175 3300028381 Bacteria 2853
230 Ga0307515_10215383 3300028794 Bacteria 1753
231 Ga0265325_10121572 3300031241 Bacteria 1258
232 Ga0265340_10040001 3300031247 Bacteria 2310
233 Ga0265316_10066721 3300031344 Bacteria 2784
234 Ga0307513_10113644 3300031456 Bacteria 2695
235 Ga0307513_10122590 3300031456 Bacteria 2563
236 Ga0307513_10273445 3300031456 Bacteria 1471
237 Ga0265313_10007187 3300031595 Bacteria 7667
238 Ga0265314_10013818 3300031711 Bacteria 6502
239 Ga0265314_10141934 3300031711 Bacteria 1484
240 Ga0265342_10016142 3300031712 Bacteria 4886
241 Ga0307413_10014917 3300031824 Bacteria 3966
242 Ga0307413_10150565 3300031824 Bacteria 1620
243 Ga0307410_10269573 3300031852 Bacteria 1331
244 Ga0307406_10042951 3300031901 Bacteria 2825
245 Ga0307407_10004417 3300031903 Bacteria 5969
246 Ga0307407_10082519 3300031903 Bacteria 1948
247 Ga0307412_10004007 3300031911 Bacteria 8210
248 Ga0307412_10146029 3300031911 Bacteria 1739
249 Ga0307412_10161634 3300031911 Bacteria 1665
250 Ga0307409_100078300 3300031995 Bacteria 2659
251 Ga0307409_100082864 3300031995 Bacteria 2598
252 Ga0307416_100027843 3300032002 Bacteria 4193
253 Ga0307411_10004009 3300032005 Bacteria 6962
254 Ga0307411_10008063 3300032005 Bacteria 5427
255 Ga0307415_100004562 3300032126 Bacteria 7215
256 Ga0307415_100062869 3300032126 Bacteria 2577
257 Ga0373945_0042909 3300035116 Bacteria 1640
258 Ga0373943_0001511 3300035170 Bacteria 10526
259 Ga0373943_0152012 3300035170 Bacteria 1255
260 Ga0373946_0063905 3300035171 Bacteria 1573
261 Ga0373931_0084485 3300035691 Bacteria 1758
262 Ga0373931_0117132 3300035691 Bacteria 1518
263 Ga0373935_0009225 3300035692 Bacteria 5904
264 Ga0373933_0186434 3300035724 Bacteria 1324
265 Ga0373947_0017497 3300035725 Bacteria 4123
266 Ga0373925_0038045 3300037068 Bacteria 3554
267 Ga0373925_0136814 3300037068 Bacteria 1915
268 Ga0395900_0065914 3300037418 Bacteria 3721
269 Ga0436364_0055162 3300037853 Bacteria 8035
270 Ga0400483_045496 3300039062 Bacteria 3592
271 Ga0400483_078030 3300039062 Bacteria 2555
272 Ga0400483_131612 3300039062 Bacteria 36565
273 Ga0400483_169904 3300039062 Bacteria 2179
274 Ga0400483_233426 3300039062 Bacteria 5369
275 Ga0400483_266067 3300039062 Bacteria 3389
276 Ga0436365_0765752 3300039437 Bacteria 19266
277 Ga0436360_1200141 3300039438 Bacteria 2317
278 Ga0436361_1087044 3300039447 Bacteria 4042
279 Ga0436363_1353358 3300039450 Bacteria 3742
280 Ga0439433_0030453 3300041999 Bacteria 1234
281 Ga0439460_0015360 3300042461 Bacteria 2026
282 Ga0453683_0134017 3300044673 Bacteria 1562
283 Ga0451576_0135935 3300045051 Bacteria 2563
284 Ga0451576_0328888 3300045051 Bacteria 1600
285 Ga0495629_0056680 3300046459 Bacteria 2740
286 Ga0495580_0011122 3300046472 Bacteria 6975
287 Ga0495582_0012931 3300046473 Bacteria 4599
288 Ga0495628_0217449 3300046516 Bacteria 1436
289 Ga0495656_0091643 3300046615 Bacteria 1391
290 Ga0495656_0154490 3300046615 Bacteria 1111
291 Ga0495625_0042082 3300046660 Bacteria 3322
292 Ga0495658_0008485 3300046683 Bacteria 5092
293 Ga0495613_0258662 3300046689 Bacteria 1213
294 Ga0495636_0034544 3300047318 Bacteria 2082
295 Ga0495684_0040216 3300047471 Bacteria 3585
296 Ga0495686_0111346 3300047472 Bacteria 1641
297 Ga0496102_0188317 3300048905 Bacteria 1945
298 Ga0496106_0010422 3300048909 Bacteria 6864
299 Ga0496113_0093002 3300048916 Bacteria 2327
300 Ga0501031_0037114 3300049568 Bacteria 3179
301 Ga0501033_0131424 3300049570 Bacteria 1813
302 Ga0501033_0134925 3300049570 Bacteria 1786
303 Ga0501034_0060673 3300049571 Bacteria 3799
304 Ga0501034_0071140 3300049571 Bacteria 3489
305 Ga0501034_0174023 3300049571 Bacteria 2119
306 Ga0501036_0016672 3300049572 Bacteria 6135
307 Ga0501037_0055909 3300049573 Bacteria 2884
308 Ga0501038_0007770 3300049574 Bacteria 9880
309 Ga0501038_0108312 3300049574 Bacteria 2304
310 Ga0501039_0135875 3300049575 Bacteria 1930
311 Ga0501040_0011798 3300049576 Bacteria 5717
312 Ga0501041_0253883 3300049577 Bacteria 1105
313 Ga0501042_0001847 3300049578 Bacteria 12712
314 Ga0501043_0054543 3300049579 Bacteria 3139
315 Ga0501043_0103663 3300049579 Bacteria 2235
316 Ga0501043_0155945 3300049579 Bacteria 1786
317 Ga0501046_0004946 3300049580 Bacteria 11968
318 Ga0501046_0155524 3300049580 Bacteria 1723
319 Ga0501047_0008750 3300049581 Bacteria 9554
320 Ga0501047_0128985 3300049581 Bacteria 2409
321 Ga0501047_0144256 3300049581 Bacteria 2258
322 Ga0501047_0266707 3300049581 Bacteria 1559
323 Ga0501048_0016062 3300049582 Bacteria 5521
324 Ga0501067_0022761 3300049583 Bacteria 3468
325 Ga0501067_0035390 3300049583 Bacteria 2773
326 Ga0501068_0074043 3300049584 Bacteria 2081
327 Ga0501069_0021442 3300049585 Bacteria 3506
328 Ga0501070_0023754 3300049586 Bacteria 5137
329 Ga0501070_0194699 3300049586 Bacteria 1665
330 Ga0501070_0270841 3300049586 Bacteria 1387
331 Ga0501071_0114846 3300049587 Bacteria 1992
332 Ga0501071_0152673 3300049587 Bacteria 1723
333 Ga0501072_0184628 3300049588 Bacteria 1664
334 Ga0501073_0014398 3300049589 Bacteria 5747
335 Ga0501073_0085555 3300049589 Bacteria 2193
336 Ga0501073_0263353 3300049589 Bacteria 1190
337 Ga0501074_0010347 3300049590 Bacteria 6769
338 Ga0501074_0125878 3300049590 Bacteria 1833
339 Ga0501075_0020460 3300049591 Bacteria 4816
340 Ga0501075_0064912 3300049591 Bacteria 2754
341 Ga0501075_0241312 3300049591 Bacteria 1378
342 Ga0501076_0005979 3300049592 Bacteria 8786
343 Ga0501076_0013211 3300049592 Bacteria 6188
344 Ga0501076_0048450 3300049592 Bacteria 3359
345 Ga0501076_0352904 3300049592 Bacteria 1208
346 Ga0501077_0017660 3300049593 Bacteria 4506
347 Ga0501077_0114218 3300049593 Bacteria 1712
348 Ga0501079_0038144 3300049741 Bacteria 3706
349 Ga0501079_0080298 3300049741 Bacteria 2522
350 Ga0501080_0004555 3300049742 Bacteria 12354
351 Ga0501080_0004796 3300049742 Bacteria 12062
352 Ga0501080_0037617 3300049742 Bacteria 4520
353 Ga0501080_0069243 3300049742 Bacteria 3281
354 Ga0501080_0075250 3300049742 Bacteria 3141
355 Ga0501080_0126831 3300049742 Bacteria 2364
356 Ga0501080_0224697 3300049742 Bacteria 1717
357 Ga0501081_0018613 3300049743 Bacteria 4615
358 Ga0501081_0059293 3300049743 Bacteria 2649
359 Ga0501083_0003182 3300049744 Bacteria 11431
360 Ga0501083_0010464 3300049744 Bacteria 6531
361 Ga0501083_0069450 3300049744 Bacteria 2344
362 Ga0501083_0094874 3300049744 Bacteria 1969
363 Ga0501083_0118072 3300049744 Bacteria 1740
364 Ga0501035_0159924 3300049822 Bacteria 1950
365 Ga0501044_0015360 3300049823 Bacteria 8246
366 Ga0501044_0147087 3300049823 Bacteria 2341
367 Ga0501044_0154194 3300049823 Bacteria 2277
368 Ga0501044_0226779 3300049823 Bacteria 1817
369 Ga0501045_0032158 3300049824 Bacteria 3801
370 nmdc:mga05p37_13352_c1 3300050507 Bacteria 9838
371 nmdc:mga05p37_23134_c1 3300050507 Bacteria 7539
372 nmdc:mga09592_11552_c1 3300050508 Bacteria 7183
373 nmdc:mga09592_77497_c1 3300050508 Bacteria 2828
374 nmdc:mga0qj67_26431_c1 3300050509 Bacteria 4493
375 nmdc:mga0qj67_31663_c1 3300050509 Bacteria 4122
376 nmdc:mga0qj67_71419_c1 3300050509 Bacteria 2771
377 nmdc:mga06r32_441_c1 3300050510 Bacteria 35197
378 nmdc:mga06r32_507539_c1 3300050510 Bacteria 1182
379 nmdc:mga06r32_61743_c1 3300050510 Bacteria 3608
380 nmdc:mga08y16_111_c1 3300050511 Bacteria 69340
381 nmdc:mga08y16_245071_c1 3300050511 Bacteria 1852
382 nmdc:mga08y16_445_c1 3300050511 Bacteria 38283
383 nmdc:mga08y16_52366_c1 3300050511 Bacteria 4271
384 nmdc:mga08y16_6185_c1 3300050511 Bacteria 12562
385 nmdc:mga08y16_61_c1 3300050511 Bacteria 92275
386 nmdc:mga0n895_244588_c1 3300050512 Bacteria 1821
387 nmdc:mga0n895_3161_c1 3300050512 Bacteria 13158
388 nmdc:mga0n895_65062_c1 3300050512 Bacteria 3608
389 nmdc:mga0n895_96707_c1 3300050512 Bacteria 2958
390 nmdc:mga0rr50_107015_c1 3300050513 Bacteria 2207
391 nmdc:mga08x19_236870_c1 3300050514 Unclassified 1257
392 nmdc:mga0a205_2706_c1 3300050515 Bacteria 15670
393 nmdc:mga0a205_318718_c1 3300050515 Bacteria 1426
394 Ga0500644_0010214 3300053088 Bacteria 2535
395 Ga0500583_0030097 3300053092 Bacteria 2375
396 Ga0500651_0001954 3300053093 Bacteria 10672
397 Ga0500566_0044469 3300053094 Bacteria 2558
398 Ga0500641_0010119 3300053096 Bacteria 3401
399 Ga0500555_000589 3300053103 Bacteria 14260
400 Ga0500595_000339 3300053119 Bacteria 30722
401 Ga0500642_0002413 3300053130 Bacteria 5481
402 Ga0500658_0036266 3300053134 Bacteria 1955
403 Ga0500568_0001119 3300053139 Bacteria 18004
404 Ga0500568_0020783 3300053139 Bacteria 2834
405 Ga0500604_0003863 3300053151 Bacteria 4006
406 Ga0500616_0000671 3300053153 Bacteria 40295
407 Ga0500645_014615 3300053730 Bacteria 2498
408 Ga0500609_000372 3300053731 Bacteria 6661
409 Ga0500609_002335 3300053731 Bacteria 2708
410 Ga0500599_000932 3300053736 Bacteria 3250
411 Ga0501084_0011011 3300054114 Bacteria 7492
412 Ga0501084_0012187 3300054114 Bacteria 7116
413 Ga0501084_0054196 3300054114 Bacteria 3354
414 Ga0501084_0069649 3300054114 Bacteria 2945
415 Ga0501082_0036374 3300060353 Bacteria 4241
416 Ga0501082_0043507 3300060353 Bacteria 3872
417 Ga0501082_0050003 3300060353 Bacteria 3605
418 Ga0530510_0314919 3300061734 Bacteria 1172
419 2523103457 2522572158 Bacteria 6514390
420 2861692672 2861691609 Bacteria 5628931
421 2883297044 2883291878 Bacteria 5894118
422 2883359820 2883354860 Bacteria 5865246
423 2894818209 2894817345 Bacteria 4892941
424 Ga0055531_10005645
425 JGI24750J21931_1014346
426 Ga0065714_10138376
427 Ga0065712_10098243
428 Ga0065715_10010002
429 Ga0065715_10096764
430 Ga0065707_10114859
431 Ga0070676_10008338
432 Ga0070676_10025709
433 Ga0070676_10228152
434 Ga0070670_100003422
435 Ga0068869_100023834
436 Ga0068869_100290421
437 Ga0068869_100467795
438 Ga0070666_10007597
439 Ga0070666_10092944
440 Ga0070680_100181320
441 Ga0068868_100003663
442 Ga0068868_100252332
443 Ga0070689_100064030
444 Ga0070689_100152733
445 Ga0070687_100019698
446 Ga0070668_100007572
447 Ga0070668_100182786
448 Ga0070669_100011821
449 Ga0070669_100017594
450 Ga0070669_100133036
451 Ga0070669_100160226
452 Ga0070675_100011275
453 Ga0070675_100076093
454 Ga0070675_100091546
455 Ga0070675_100114883
456 Ga0070675_100441489
457 Ga0070674_100005377
458 Ga0070674_100007641
459 Ga0070674_100146424
460 Ga0070674_100266908
461 Ga0070673_100002277
462 Ga0070673_100012859
463 Ga0070673_100024436
464 Ga0070673_100104591
465 Ga0070688_100004046
466 Ga0070659_100142441
467 Ga0070667_100005177
468 Ga0070667_100106339
469 Ga0070709_10171579
470 Ga0070700_100028653
471 Ga0070700_100186714
472 Ga0070694_100003668
473 Ga0070694_100173017
474 Ga0070708_100041567
475 Ga0070708_100216060
476 Ga0070708_100247068
477 Ga0070678_100045484
478 Ga0070662_100001711
479 Ga0070662_100275170
480 Ga0070681_10203864
481 Ga0070706_100139887
482 Ga0070707_100016251
483 Ga0070707_100202571
484 Ga0070698_100102131
485 Ga0070698_100126594
486 Ga0070699_100036490
487 Ga0070697_100085452
488 Ga0068853_100159574
489 Ga0070672_100038618
490 Ga0070672_100068197
491 Ga0070686_100024278
492 Ga0070695_100350430
493 Ga0070665_100024457
494 Ga0070665_100386934
495 Ga0068855_100459241
496 Ga0070664_100017138
497 Ga0068856_100620261
498 Ga0070702_100158623
499 Ga0068859_100012225
500 Ga0068859_100044756
501 Ga0068864_100307819
502 Ga0068866_10082011
503 Ga0068870_10009598
504 Ga0068870_10118355
505 Ga0068863_100006009
506 Ga0068863_100319873
507 Ga0068858_100308128
508 Ga0068860_100025877
509 Ga0068862_100020776
510 Ga0068862_100023434
511 Ga0068862_100068815
512 Ga0081455_10040280
513 Ga0081538_10000547
514 Ga0081539_10000122
515 Ga0081539_10002930
516 Ga0075362_10046199
517 Ga0068871_100096130
518 Ga0068871_100254922
519 Ga0075428_100009981
520 Ga0075428_100150318
521 Ga0075430_100000981
522 Ga0075430_100052089
523 Ga0075430_100262592
524 Ga0075431_100003481
525 Ga0075431_100343163
526 Ga0075433_10000088
527 Ga0075433_10001425
528 Ga0075433_10096727
529 Ga0075433_10300744
530 Ga0075434_100004236
531 Ga0075434_100012586
532 Ga0075434_100068604
533 Ga0075434_100078965
534 Ga0075429_100001454
535 Ga0075429_100043288
536 Ga0075429_100109563
537 Ga0068865_100020147
538 Ga0075436_100204197
539 Ga0075436_100267945
540 Ga0097620_100012227
541 Ga0097620_100044754
542 Ga0097620_100717477
543 Ga0075435_100151603
544 Ga0075435_100193580
545 Ga0105240_10103875
546 Ga0111539_10000325
547 Ga0111539_10001033
548 Ga0111539_10003536
549 Ga0111539_10004520
550 Ga0111539_10371581
551 Ga0111539_10812714
552 Ga0114129_10039845
553 Ga0114129_10041657
554 Ga0114129_10047476
555 Ga0114129_10050374
556 Ga0114129_10225643
557 Ga0105243_10614450
558 Ga0105237_10136613
559 Ga0105238_10011358
560 Ga0105249_10004378
561 Ga0099796_10035291
562 Ga0105239_10470238
563 Ga0157369_10110028
564 Ga0157372_10140302
565 Ga0157375_10058045
566 Ga0157375_10405363
567 Ga0163163_10174570
568 Ga0163163_10318956
569 Ga0157380_10003630
570 Ga0157380_10024332
571 Ga0157377_10003447
572 Ga0157377_10037020
573 Ga0157379_10026036
574 Ga0157376_10045683
575 Ga0213872_10031507
576 Ga0213876_10022229
577 Ga0213875_10006512
578 Ga0209148_1000698
579 Ga0209455_1000286
580 Ga0209675_1004324
581 Ga0209676_1005832
582 Ga0209758_1000095
583 Ga0209050_1002437
584 Ga0209257_1000339
585 Ga0207697_10000651
586 Ga0207682_10002970
587 Ga0207682_10009792
588 Ga0207642_10037512
589 Ga0207688_10002639
590 Ga0207688_10006702
591 Ga0207645_10008259
592 Ga0207645_10212258
593 Ga0207643_10006923
594 Ga0207643_10009396
595 Ga0207707_10079664
596 Ga0207695_10009371
597 Ga0207695_10022653
598 Ga0207660_10171636
599 Ga0207662_10045065
600 Ga0207646_10112595
601 Ga0207650_10007614
602 Ga0207650_10025348
603 Ga0207659_10003008
604 Ga0207659_10030185
605 Ga0207659_10075765
606 Ga0207659_10277387
607 Ga0207659_10290714
608 Ga0207690_10110864
609 Ga0207706_10002317
610 Ga0207706_10104763
611 Ga0207669_10003634
612 Ga0207669_10024304
613 Ga0207669_10037290
614 Ga0207704_10003441
615 Ga0207691_10015670
616 Ga0207691_10022652
617 Ga0207691_10037121
618 Ga0207691_10045864
619 Ga0207689_10008071
620 Ga0207689_10051706
621 Ga0207679_10040477
622 Ga0207667_10148866
623 Ga0207651_10005919
624 Ga0207651_10019612
625 Ga0207651_10093770
626 Ga0207651_10284380
627 Ga0207668_10131966
628 Ga0207668_10160236
629 Ga0207658_10106393
630 Ga0207658_10223660
631 Ga0207677_10014887
632 Ga0207677_10184019
633 Ga0207678_10139081
634 Ga0207708_10003781
635 Ga0207641_10019151
636 Ga0207641_10307291
637 Ga0207648_10060419
638 Ga0207676_10374004
639 Ga0207674_10117926
640 Ga0207675_100017723
641 Ga0207675_100040312
642 Ga0207683_10325085
643 Ga0209983_1024458
644 Ga0207428_10000207
645 Ga0207428_10000440
646 Ga0207428_10003027
647 Ga0207428_10011232
648 Ga0207428_10045478
649 Ga0268266_10260080
650 Ga0268265_10033582
651 Ga0268265_10176750
652 Ga0268264_10076175
653 Ga0307515_10215383
654 Ga0265325_10121572
655 Ga0265340_10040001
656 Ga0265316_10066721
657 Ga0307513_10113644
658 Ga0307513_10122590
659 Ga0307513_10273445
660 Ga0265313_10007187
661 Ga0265314_10013818
662 Ga0265314_10141934
663 Ga0265342_10016142
664 Ga0307413_10014917
665 Ga0307413_10150565
666 Ga0307410_10269573
667 Ga0307406_10042951
668 Ga0307407_10004417
669 Ga0307407_10082519
670 Ga0307412_10004007
671 Ga0307412_10146029
672 Ga0307412_10161634
673 Ga0307409_100078300
674 Ga0307409_100082864
675 Ga0307416_100027843
676 Ga0307411_10004009
677 Ga0307411_10008063
678 Ga0307415_100004562
679 Ga0307415_100062869
680 Ga0373945_0042909
681 Ga0373943_0001511
682 Ga0373943_0152012
683 Ga0373946_0063905
684 Ga0373931_0084485
685 Ga0373931_0117132
686 Ga0373935_0009225
687 Ga0373933_0186434
688 Ga0373947_0017497
689 Ga0373925_0038045
690 Ga0373925_0136814
691 Ga0395900_0065914
692 Ga0436364_0055162
693 Ga0400483_045496
694 Ga0400483_078030
695 Ga0400483_131612
696 Ga0400483_169904
697 Ga0400483_233426
698 Ga0400483_266067
699 Ga0436365_0765752
700 Ga0436360_1200141
701 Ga0436361_1087044
702 Ga0436363_1353358
703 Ga0439433_0030453
704 Ga0439460_0015360
705 Ga0453683_0134017
706 Ga0451576_0135935
707 Ga0451576_0328888
708 Ga0495629_0056680
709 Ga0495580_0011122
710 Ga0495582_0012931
711 Ga0495628_0217449
712 Ga0495656_0091643
713 Ga0495656_0154490
714 Ga0495625_0042082
715 Ga0495658_0008485
716 Ga0495613_0258662
717 Ga0495636_0034544
718 Ga0495684_0040216
719 Ga0495686_0111346
720 Ga0496102_0188317
721 Ga0496106_0010422
722 Ga0496113_0093002
723 Ga0501031_0037114
724 Ga0501033_0131424
725 Ga0501033_0134925
726 Ga0501034_0060673
727 Ga0501034_0071140
728 Ga0501034_0174023
729 Ga0501036_0016672
730 Ga0501037_0055909
731 Ga0501038_0007770
732 Ga0501038_0108312
733 Ga0501039_0135875
734 Ga0501040_0011798
735 Ga0501041_0253883
736 Ga0501042_0001847
737 Ga0501043_0054543
738 Ga0501043_0103663
739 Ga0501043_0155945
740 Ga0501046_0004946
741 Ga0501046_0155524
742 Ga0501047_0008750
743 Ga0501047_0128985
744 Ga0501047_0144256
745 Ga0501047_0266707
746 Ga0501048_0016062
747 Ga0501067_0022761
748 Ga0501067_0035390
749 Ga0501068_0074043
750 Ga0501069_0021442
751 Ga0501070_0023754
752 Ga0501070_0194699
753 Ga0501070_0270841
754 Ga0501071_0114846
755 Ga0501071_0152673
756 Ga0501072_0184628
757 Ga0501073_0014398
758 Ga0501073_0085555
759 Ga0501073_0263353
760 Ga0501074_0010347
761 Ga0501074_0125878
762 Ga0501075_0020460
763 Ga0501075_0064912
764 Ga0501075_0241312
765 Ga0501076_0005979
766 Ga0501076_0013211
767 Ga0501076_0048450
768 Ga0501076_0352904
769 Ga0501077_0017660
770 Ga0501077_0114218
771 Ga0501079_0038144
772 Ga0501079_0080298
773 Ga0501080_0004555
774 Ga0501080_0004796
775 Ga0501080_0037617
776 Ga0501080_0069243
777 Ga0501080_0075250
778 Ga0501080_0126831
779 Ga0501080_0224697
780 Ga0501081_0018613
781 Ga0501081_0059293
782 Ga0501083_0003182
783 Ga0501083_0010464
784 Ga0501083_0069450
785 Ga0501083_0094874
786 Ga0501083_0118072
787 Ga0501035_0159924
788 Ga0501044_0015360
789 Ga0501044_0147087
790 Ga0501044_0154194
791 Ga0501044_0226779
792 Ga0501045_0032158
793 nmdc:mga05p37_13352_c1
794 nmdc:mga05p37_23134_c1
795 nmdc:mga09592_11552_c1
796 nmdc:mga09592_77497_c1
797 nmdc:mga0qj67_26431_c1
798 nmdc:mga0qj67_31663_c1
799 nmdc:mga0qj67_71419_c1
800 nmdc:mga06r32_441_c1
801 nmdc:mga06r32_507539_c1
802 nmdc:mga06r32_61743_c1
803 nmdc:mga08y16_111_c1
804 nmdc:mga08y16_245071_c1
805 nmdc:mga08y16_445_c1
806 nmdc:mga08y16_52366_c1
807 nmdc:mga08y16_6185_c1
808 nmdc:mga08y16_61_c1
809 nmdc:mga0n895_244588_c1
810 nmdc:mga0n895_3161_c1
811 nmdc:mga0n895_65062_c1
812 nmdc:mga0n895_96707_c1
813 nmdc:mga0rr50_107015_c1
814 nmdc:mga08x19_236870_c1
815 nmdc:mga0a205_2706_c1
816 nmdc:mga0a205_318718_c1
817 Ga0500644_0010214
818 Ga0500583_0030097
819 Ga0500651_0001954
820 Ga0500566_0044469
821 Ga0500641_0010119
822 Ga0500555_000589
823 Ga0500595_000339
824 Ga0500642_0002413
825 Ga0500658_0036266
826 Ga0500568_0001119
827 Ga0500568_0020783
828 Ga0500604_0003863
829 Ga0500616_0000671
830 Ga0500645_014615
831 Ga0500609_000372
832 Ga0500609_002335
833 Ga0500599_000932
834 Ga0501084_0011011
835 Ga0501084_0012187
836 Ga0501084_0054196
837 Ga0501084_0069649
838 Ga0501082_0036374
839 Ga0501082_0043507
840 Ga0501082_0050003
841 Ga0530510_0314919
842 2523103457
843 2861692672
844 2883297044
845 2883359820
846 2894818209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

86

373

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ubo-assembly1.cif.gz_B the crystal structure of adenosine kinase from sinorhizobium meliloti 0.9595 4 327
4e3a-assembly1.cif.gz_A crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 0.9519 4 329
3ubo-assembly1.cif.gz_B the crystal structure of adenosine kinase from sinorhizobium meliloti 0.9481 4 327
4e3a-assembly1.cif.gz_A crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 0.9407 4 329
1bx4-assembly1.cif.gz_A structure of human adenosine kinase at 1.50 angstroms 0.8924 8 318
ID Description Score Start End Superfamily
3uboB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9551 4 327 3.40.1190.20
af_Q7XBZ0_99_432_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9526 5 322 3.40.1190.20
3uboB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9494 4 327 3.40.1190.20
af_Q4E0S4_48_344_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9276 60 318 3.40.1190.20
af_Q7XBZ0_99_432_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9189 5 322 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A439ILM4-F1-model_v4 deleted 0.9824 156 286
AF-A0A4Q1KJQ1-F1-model_v4 Adenosine kinase 0.9772 37 327 GO:0016301
AF-A0A285QAZ1-F1-model_v4 Sugar or nucleoside kinase, ribokinase family 0.9732 2 327 GO:0016301
AF-A0A7U3HA41-F1-model_v4 deleted 0.973 3 329
AF-A0A357LYC4-F1-model_v4 Adenosine kinase 0.9719 211 326 GO:0016301

Map