F440206

General Info

Members Datasets Scaffolds Average Seq Length
422 156 844 263

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100047513|Ga0070707_1000475132
Length 281
Sequence VPPFRTSPLGIARAKPALEGSPVMPEPMGFFTDTTVCIGCKACEVACKEWNQLPATNGGVNVLSGDSYDNTRQLDGTHWRHVRFVEQFTPERTDGRWLLMSDVCKHCVNAGCMEVCPTGAIIRTEFDTVVIQSDTCNGCRDCIGACPFGVIGINPVSNTAQKCTLCYDRLQNGLEPACSKACPTDSINFGPIADLKALAAKRVGTLHERGEKRAYLYGADDKMLGGLNSFYLLVDRPEVYGLPPDPKMPSRNLVKGSVFATVGAFLVGLLGLFSFRNRGGD

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
86 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
89 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100047513 3300005468 Bacteria 4109
2 JGI25405J52794_10001763 3300003911 Bacteria 3614
3 Ga0065712_10002000 3300005290 Bacteria 5380
4 Ga0065712_10082797 3300005290 Bacteria 2882
5 Ga0065715_10098202 3300005293 Bacteria 3581
6 Ga0065715_10109794 3300005293 Bacteria 2652
7 Ga0065707_10007690 3300005295 Bacteria 3541
8 Ga0065707_10189176 3300005295 Bacteria 1366
9 Ga0070680_100382780 3300005336 Bacteria 1198
10 Ga0070659_100143578 3300005366 Bacteria 1944
11 Ga0070694_100035215 3300005444 Bacteria 3308
12 Ga0070708_100006984 3300005445 Bacteria 9009
13 Ga0070708_100009054 3300005445 Bacteria 8030
14 Ga0070708_100072558 3300005445 Bacteria 3102
15 Ga0070708_100188377 3300005445 Bacteria 1930
16 Ga0070708_100399187 3300005445 Bacteria 1296
17 Ga0070708_100750553 3300005445 Bacteria 918
18 Ga0070662_100234584 3300005457 Bacteria 1469
19 Ga0070662_100460954 3300005457 Bacteria 1056
20 Ga0068867_100314606 3300005459 Bacteria 1295
21 Ga0070706_100018343 3300005467 Bacteria 6456
22 Ga0070706_100356408 3300005467 Bacteria 1363
23 Ga0070707_100000923 3300005468 Bacteria 29141
24 Ga0070707_100004517 3300005468 Bacteria 13028
25 Ga0070707_100047342 3300005468 Bacteria 4116
26 Ga0070707_100579332 3300005468 Bacteria 1085
27 Ga0070698_100012434 3300005471 Bacteria 9009
28 Ga0070698_100012746 3300005471 Bacteria 8904
29 Ga0070698_100067377 3300005471 Bacteria 3600
30 Ga0070698_100192715 3300005471 Bacteria 1975
31 Ga0070699_100009226 3300005518 Bacteria 8552
32 Ga0070699_100023501 3300005518 Bacteria 5310
33 Ga0070699_100028848 3300005518 Bacteria 4784
34 Ga0070699_100558375 3300005518 Bacteria 1042
35 Ga0070679_100466107 3300005530 Bacteria 1208
36 Ga0070697_100005642 3300005536 Bacteria 9643
37 Ga0070697_100008448 3300005536 Bacteria 8035
38 Ga0070697_100030646 3300005536 Bacteria 4321
39 Ga0070697_100092249 3300005536 Bacteria 2505
40 Ga0070697_100524199 3300005536 Bacteria 1037
41 Ga0070672_100097723 3300005543 Bacteria 2377
42 Ga0070686_100066769 3300005544 Bacteria 2341
43 Ga0070695_100372059 3300005545 Bacteria 1076
44 Ga0070695_100372453 3300005545 Bacteria 1075
45 Ga0070696_100073915 3300005546 Bacteria 2403
46 Ga0070696_100297704 3300005546 Bacteria 1235
47 Ga0070704_100003789 3300005549 Bacteria 8704
48 Ga0070704_100138623 3300005549 Bacteria 1896
49 Ga0068855_100231493 3300005563 Bacteria 2069
50 Ga0070664_100147631 3300005564 Bacteria 2075
51 Ga0068859_100889406 3300005617 Bacteria 976
52 Ga0068861_100416522 3300005719 Bacteria 1196
53 Ga0068863_100332502 3300005841 Bacteria 1477
54 Ga0081455_10003567 3300005937 Bacteria 17856
55 Ga0081455_10040743 3300005937 Bacteria 4093
56 Ga0081455_10313365 3300005937 Bacteria 1120
57 Ga0081538_10011950 3300005981 Bacteria 7000
58 Ga0081538_10022378 3300005981 Bacteria 4580
59 Ga0081538_10069676 3300005981 Bacteria 1946
60 Ga0075428_100009753 3300006844 Bacteria 10671
61 Ga0075428_100025301 3300006844 Bacteria 6569
62 Ga0075428_100026155 3300006844 Bacteria 6463
63 Ga0075428_100036190 3300006844 Bacteria 5439
64 Ga0075428_100042369 3300006844 Bacteria 5005
65 Ga0075428_100079428 3300006844 Bacteria 3580
66 Ga0075428_100599949 3300006844 Bacteria 1176
67 Ga0075430_100000040 3300006846 Bacteria 68222
68 Ga0075430_100027078 3300006846 Bacteria 4873
69 Ga0075430_100055237 3300006846 Bacteria 3339
70 Ga0075430_100069221 3300006846 Bacteria 2961
71 Ga0075430_100082936 3300006846 Bacteria 2686
72 Ga0075430_100187786 3300006846 Bacteria 1718
73 Ga0075431_100000192 3300006847 Bacteria 44545
74 Ga0075431_100009690 3300006847 Bacteria 9674
75 Ga0075431_100010657 3300006847 Bacteria 9240
76 Ga0075431_100027763 3300006847 Bacteria 5809
77 Ga0075431_100049777 3300006847 Bacteria 4320
78 Ga0075431_100058348 3300006847 Bacteria 3983
79 Ga0075431_100100305 3300006847 Bacteria 2987
80 Ga0075431_100151719 3300006847 Bacteria 2385
81 Ga0075431_100160132 3300006847 Bacteria 2315
82 Ga0075431_100271561 3300006847 Bacteria 1718
83 Ga0075431_100539250 3300006847 Bacteria 1155
84 Ga0075433_10028252 3300006852 Bacteria 4767
85 Ga0075433_10031640 3300006852 Bacteria 4524
86 Ga0075433_10032498 3300006852 Bacteria 4470
87 Ga0075433_10090488 3300006852 Bacteria 2705
88 Ga0075433_10183294 3300006852 Bacteria 1863
89 Ga0075433_10233586 3300006852 Unclassified 1633
90 Ga0075433_10274141 3300006852 Bacteria 1495
91 Ga0075433_10362199 3300006852 Bacteria 1281
92 Ga0075433_10438496 3300006852 Bacteria 1151
93 Ga0075433_10707956 3300006852 Bacteria 882
94 Ga0075434_100010986 3300006871 Bacteria 8515
95 Ga0075434_100015800 3300006871 Bacteria 7247
96 Ga0075434_100073859 3300006871 Bacteria 3403
97 Ga0075434_100077272 3300006871 Bacteria 3324
98 Ga0075434_100161345 3300006871 Bacteria 2262
99 Ga0075434_100224564 3300006871 Bacteria 1898
100 Ga0075429_100001755 3300006880 Bacteria 17959
101 Ga0075429_100009335 3300006880 Bacteria 8517
102 Ga0075429_100011966 3300006880 Bacteria 7522
103 Ga0075429_100046330 3300006880 Bacteria 3783
104 Ga0075429_100359596 3300006880 Bacteria 1275
105 Ga0075429_100463162 3300006880 Bacteria 1111
106 Ga0075436_100011043 3300006914 Bacteria 6197
107 Ga0075436_100021071 3300006914 Bacteria 4471
108 Ga0075436_100023713 3300006914 Bacteria 4215
109 Ga0075436_100031756 3300006914 Bacteria 3638
110 Ga0075436_100052068 3300006914 Bacteria 2825
111 Ga0075436_100057366 3300006914 Bacteria 2689
112 Ga0097620_100889396 3300006931 Bacteria 976
113 Ga0075435_100013566 3300007076 Bacteria 6067
114 Ga0075435_100113642 3300007076 Bacteria 2254
115 Ga0075435_100176503 3300007076 Bacteria 1804
116 Ga0099794_10040636 3300007265 Bacteria 2212
117 Ga0099794_10096110 3300007265 Bacteria 1475
118 Ga0111539_10001175 3300009094 Bacteria 34728
119 Ga0111539_10052039 3300009094 Bacteria 4876
120 Ga0111539_10086121 3300009094 Bacteria 3692
121 Ga0111539_10097265 3300009094 Unclassified 3458
122 Ga0111539_10128875 3300009094 Bacteria 2963
123 Ga0114129_10000032 3300009147 Bacteria 111487
124 Ga0114129_10005272 3300009147 Bacteria 18231
125 Ga0114129_10005910 3300009147 Bacteria 17313
126 Ga0114129_10014053 3300009147 Bacteria 11405
127 Ga0114129_10021143 3300009147 Bacteria 9240
128 Ga0114129_10025763 3300009147 Bacteria 8331
129 Ga0114129_10043365 3300009147 Bacteria 6328
130 Ga0114129_10052934 3300009147 Bacteria 5695
131 Ga0114129_10066054 3300009147 Bacteria 5045
132 Ga0114129_10074529 3300009147 Bacteria 4728
133 Ga0114129_10248644 3300009147 Bacteria 2388
134 Ga0114129_10252432 3300009147 Bacteria 2367
135 Ga0114129_10329204 3300009147 Bacteria 2029
136 Ga0114129_10603480 3300009147 Bacteria 1422
137 Ga0114129_11049164 3300009147 Bacteria 1023
138 Ga0114129_11367363 3300009147 Bacteria 875
139 Ga0105242_10434650 3300009176 Bacteria 1233
140 Ga0105248_10019428 3300009177 Bacteria 7519
141 Ga0157374_10037484 3300013296 Bacteria 4450
142 Ga0157378_10088863 3300013297 Bacteria 2805
143 Ga0157378_10119831 3300013297 Bacteria 2424
144 Ga0163162_10161350 3300013306 Bacteria 2363
145 Ga0163163_10344499 3300014325 Bacteria 1546
146 Ga0157376_10105789 3300014969 Bacteria 2468
147 Ga0207697_10008931 3300025315 Bacteria 4353
148 Ga0207645_10043522 3300025907 Bacteria 2874
149 Ga0207684_10001313 3300025910 Bacteria 27290
150 Ga0207684_10002886 3300025910 Bacteria 17035
151 Ga0207684_10029073 3300025910 Bacteria 4708
152 Ga0207684_10047693 3300025910 Bacteria 3633
153 Ga0207684_10141201 3300025910 Bacteria 2070
154 Ga0207684_10379157 3300025910 Bacteria 1216
155 Ga0207684_10409608 3300025910 Bacteria 1165
156 Ga0207649_10369543 3300025920 Bacteria 1066
157 Ga0207652_10254529 3300025921 Bacteria 1584
158 Ga0207646_10001490 3300025922 Bacteria 28831
159 Ga0207646_10008460 3300025922 Bacteria 10309
160 Ga0207646_10022513 3300025922 Bacteria 5805
161 Ga0207646_10022718 3300025922 Bacteria 5772
162 Ga0207646_10046608 3300025922 Bacteria 3888
163 Ga0207646_10140094 3300025922 Bacteria 2178
164 Ga0207646_10784519 3300025922 Bacteria 849
165 Ga0207690_10291193 3300025932 Bacteria 1274
166 Ga0207706_10090760 3300025933 Bacteria 2686
167 Ga0207706_10093278 3300025933 Bacteria 2648
168 Ga0207706_10558000 3300025933 Bacteria 986
169 Ga0207670_10078852 3300025936 Bacteria 2298
170 Ga0207665_10311496 3300025939 Bacteria 1179
171 Ga0207711_10099468 3300025941 Bacteria 2571
172 Ga0207689_10100634 3300025942 Bacteria 2374
173 Ga0207667_10087044 3300025949 Bacteria 3232
174 Ga0207678_10363953 3300026067 Bacteria 1248
175 Ga0207648_10044431 3300026089 Bacteria 3898
176 Ga0207675_100836707 3300026118 Bacteria 935
177 Ga0207683_10009609 3300026121 Bacteria 8243
178 Ga0210000_1011095 3300027462 Bacteria 1333
179 Ga0209982_1003381 3300027552 Bacteria 2268
180 Ga0210002_1003763 3300027617 Bacteria 2247
181 Ga0209983_1012932 3300027665 Bacteria 1715
182 Ga0209588_1009406 3300027671 Bacteria 2922
183 Ga0209588_1027298 3300027671 Bacteria 1816
184 Ga0209971_1019174 3300027682 Bacteria 1624
185 Ga0209971_1057237 3300027682 Bacteria 943
186 Ga0209966_1019859 3300027695 Bacteria 1298
187 Ga0209974_10006542 3300027876 Bacteria 4064
188 Ga0207428_10000628 3300027907 Bacteria 41501
189 Ga0207428_10146098 3300027907 Bacteria 1802
190 Ga0207428_10270845 3300027907 Bacteria 1262
191 Ga0307408_100032267 3300031548 Bacteria 3651
192 Ga0307408_100072590 3300031548 Bacteria 2548
193 Ga0307408_100128053 3300031548 Bacteria 1977
194 Ga0307408_100325509 3300031548 Bacteria 1296
195 Ga0307408_100364512 3300031548 Bacteria 1230
196 Ga0307405_10021611 3300031731 Bacteria 3620
197 Ga0307405_10043134 3300031731 Bacteria 2750
198 Ga0307405_10075873 3300031731 Bacteria 2179
199 Ga0307405_10203457 3300031731 Bacteria 1440
200 Ga0307405_10310460 3300031731 Bacteria 1200
201 Ga0307413_10003070 3300031824 Bacteria 6947
202 Ga0307413_10037958 3300031824 Bacteria 2787
203 Ga0307413_10195062 3300031824 Bacteria 1457
204 Ga0307413_10507176 3300031824 Bacteria 970
205 Ga0307410_10055822 3300031852 Bacteria 2683
206 Ga0307410_10192792 3300031852 Bacteria 1550
207 Ga0307410_10259229 3300031852 Bacteria 1355
208 Ga0307406_10097842 3300031901 Bacteria 1991
209 Ga0307412_10026269 3300031911 Bacteria 3617
210 Ga0307412_10307038 3300031911 Bacteria 1256
211 Ga0307412_10351099 3300031911 Bacteria 1184
212 Ga0307409_100010833 3300031995 Bacteria 5703
213 Ga0307409_100019596 3300031995 Bacteria 4586
214 Ga0307409_100028328 3300031995 Bacteria 3988
215 Ga0307409_100147299 3300031995 Bacteria 2038
216 Ga0307409_100413936 3300031995 Bacteria 1291
217 Ga0307409_100472327 3300031995 Bacteria 1215
218 Ga0307416_100001267 3300032002 Bacteria 13607
219 Ga0307416_100002859 3300032002 Bacteria 10049
220 Ga0307416_100030466 3300032002 Unclassified 4048
221 Ga0307416_100065756 3300032002 Bacteria 2982
222 Ga0307416_100114444 3300032002 Bacteria 2386
223 Ga0307416_100214889 3300032002 Bacteria 1838
224 Ga0307416_100298659 3300032002 Bacteria 1599
225 Ga0307416_101000697 3300032002 Bacteria 939
226 Ga0307414_10002319 3300032004 Bacteria 9950
227 Ga0307414_10002418 3300032004 Bacteria 9777
228 Ga0307414_10105831 3300032004 Bacteria 2128
229 Ga0307414_10261186 3300032004 Bacteria 1445
230 Ga0307411_10009541 3300032005 Bacteria 5112
231 Ga0307411_10049320 3300032005 Bacteria 2735
232 Ga0307411_10054418 3300032005 Bacteria 2627
233 Ga0307411_10130464 3300032005 Bacteria 1836
234 Ga0307411_10244072 3300032005 Bacteria 1408
235 Ga0307415_100002119 3300032126 Bacteria 9820
236 Ga0307415_100005568 3300032126 Bacteria 6702
237 Ga0373930_0027442 3300034816 Bacteria 1154
238 Ga0373930_0033914 3300034816 Bacteria 1062
239 Ga0373932_0009923 3300035112 Bacteria 2296
240 Ga0373941_0004455 3300035115 Bacteria 3238
241 Ga0373960_0047485 3300035121 Bacteria 1263
242 Ga0373942_0003252 3300035207 Bacteria 3837
243 Ga0373931_0002419 3300035691 Bacteria 8257
244 Ga0373931_0003331 3300035691 Bacteria 7195
245 Ga0373935_0005315 3300035692 Bacteria 7583
246 Ga0373925_0099692 3300037068 Bacteria 2231
247 Ga0439431_0004036 3300041997 Bacteria 3228
248 Ga0439441_042788 3300042001 Bacteria 912
249 Ga0439446_0022017 3300042156 Bacteria 1804
250 Ga0439446_0106276 3300042156 Bacteria 892
251 Ga0439434_0025946 3300042435 Unclassified 1770
252 Ga0451577_0035922 3300042876 Bacteria 4463
253 Ga0451577_0132231 3300042876 Bacteria 2239
254 Ga0451577_0280663 3300042876 Unclassified 1509
255 Ga0453684_0097752 3300044712 Bacteria 3602
256 Ga0453684_0233742 3300044712 Bacteria 2120
257 Ga0451576_0102905 3300045051 Bacteria 2971
258 Ga0451576_0209764 3300045051 Bacteria 2034
259 Ga0451576_0429997 3300045051 Bacteria 1385
260 Ga0495580_0009393 3300046472 Bacteria 7694
261 Ga0495580_0060330 3300046472 Bacteria 2665
262 Ga0496102_0130492 3300048905 Bacteria 2351
263 Ga0496102_0141181 3300048905 Bacteria 2259
264 Ga0496108_0544876 3300048911 Unclassified 1012
265 Ga0496109_0058638 3300048912 Bacteria 3517
266 Ga0496110_0060448 3300048913 Bacteria 3342
267 Ga0496112_0143734 3300048915 Bacteria 2354
268 Ga0501296_008519 3300049519 Bacteria 1190
269 Ga0501031_0132075 3300049568 Bacteria 1631
270 Ga0501032_0055169 3300049569 Bacteria 2673
271 Ga0501033_0016421 3300049570 Bacteria 5608
272 Ga0501036_0026054 3300049572 Bacteria 4935
273 Ga0501036_0029000 3300049572 Bacteria 4677
274 Ga0501036_0234503 3300049572 Bacteria 1539
275 Ga0501037_0049298 3300049573 Bacteria 3084
276 Ga0501038_0002448 3300049574 Bacteria 17287
277 Ga0501038_0025447 3300049574 Bacteria 5275
278 Ga0501039_0029058 3300049575 Bacteria 4257
279 Ga0501039_0124889 3300049575 Bacteria 2018
280 Ga0501040_0001437 3300049576 Bacteria 15077
281 Ga0501040_0002709 3300049576 Bacteria 11418
282 Ga0501040_0067564 3300049576 Bacteria 2464
283 Ga0501040_0096332 3300049576 Bacteria 2060
284 Ga0501040_0184527 3300049576 Bacteria 1479
285 Ga0501041_0003190 3300049577 Bacteria 9428
286 Ga0501041_0092365 3300049577 Bacteria 1869
287 Ga0501042_0000034 3300049578 Bacteria 43770
288 Ga0501046_0022322 3300049580 Bacteria 5214
289 Ga0501046_0119581 3300049580 Bacteria 2005
290 Ga0501048_0007735 3300049582 Bacteria 8149
291 Ga0501048_0026702 3300049582 Bacteria 4203
292 Ga0501048_0191613 3300049582 Bacteria 1449
293 Ga0501067_0064537 3300049583 Bacteria 2027
294 Ga0501068_0003003 3300049584 Bacteria 8990
295 Ga0501068_0026671 3300049584 Bacteria 3406
296 Ga0501070_0046655 3300049586 Bacteria 3603
297 Ga0501071_0005752 3300049587 Bacteria 8000
298 Ga0501071_0366410 3300049587 Bacteria 1098
299 Ga0501072_0000420 3300049588 Bacteria 30352
300 Ga0501072_0036948 3300049588 Bacteria 3830
301 Ga0501072_0129298 3300049588 Bacteria 2013
302 Ga0501072_0139584 3300049588 Bacteria 1932
303 Ga0501072_0299522 3300049588 Bacteria 1278
304 Ga0501072_0374752 3300049588 Bacteria 1129
305 Ga0501073_0033499 3300049589 Bacteria 3658
306 Ga0501074_0082966 3300049590 Bacteria 2298
307 Ga0501074_0154542 3300049590 Bacteria 1639
308 Ga0501075_0005764 3300049591 Bacteria 8472
309 Ga0501075_0064340 3300049591 Bacteria 2767
310 Ga0501075_0386322 3300049591 Bacteria 1067
311 Ga0501075_0399662 3300049591 Bacteria 1047
312 Ga0501076_0000893 3300049592 Bacteria 19399
313 Ga0501076_0013014 3300049592 Bacteria 6229
314 Ga0501076_0254391 3300049592 Bacteria 1438
315 Ga0501077_0000051 3300049593 Bacteria 61179
316 Ga0501077_0006481 3300049593 Bacteria 7185
317 Ga0501077_0021549 3300049593 Bacteria 4079
318 Ga0501235_030585 3300049669 Bacteria 1214
319 Ga0501249_042514 3300049679 Bacteria 1033
320 Ga0501261_019152 3300049690 Bacteria 970
321 Ga0501225_0064651 3300049705 Bacteria 1033
322 Ga0501234_015127 3300049707 Bacteria 1214
323 Ga0501079_0000789 3300049741 Bacteria 21567
324 Ga0501079_0002538 3300049741 Bacteria 13245
325 Ga0501079_0239196 3300049741 Bacteria 1418
326 Ga0501080_0022872 3300049742 Bacteria 5795
327 Ga0501080_0080869 3300049742 Bacteria 3019
328 Ga0501081_0001354 3300049743 Bacteria 14955
329 Ga0501081_0007119 3300049743 Bacteria 7269
330 Ga0501081_0107534 3300049743 Bacteria 1978
331 Ga0501083_0200058 3300049744 Bacteria 1303
332 Ga0501083_0312822 3300049744 Bacteria 1021
333 Ga0501035_0005209 3300049822 Bacteria 12305
334 Ga0501035_0638172 3300049822 Bacteria 864
335 Ga0501044_0271877 3300049823 Bacteria 1630
336 Ga0501045_0001265 3300049824 Bacteria 16773
337 Ga0501045_0001879 3300049824 Bacteria 14228
338 Ga0501045_0041196 3300049824 Bacteria 3361
339 Ga0501045_0073638 3300049824 Bacteria 2516
340 nmdc:mga05p37_119444_c1 3300050507 Bacteria 3239
341 nmdc:mga05p37_134553_c1 3300050507 Bacteria 3033
342 nmdc:mga05p37_1621_c1 3300050507 Bacteria 26061
343 nmdc:mga05p37_175959_c1 3300050507 Bacteria 2607
344 nmdc:mga05p37_18597_c1 3300050507 Bacteria 8398
345 nmdc:mga05p37_29372_c1 3300050507 Bacteria 6710
346 nmdc:mga05p37_34876_c1 3300050507 Bacteria 6165
347 nmdc:mga05p37_3630_c1 3300050507 Bacteria 18040
348 nmdc:mga05p37_4041_c1 3300050507 Bacteria 17147
349 nmdc:mga05p37_415565_c1 3300050507 Bacteria 1567
350 nmdc:mga05p37_4419_c1 3300050507 Bacteria 16190
351 nmdc:mga05p37_47388_c1 3300050507 Bacteria 5286
352 nmdc:mga05p37_541755_c1 3300050507 Bacteria 1327
353 nmdc:mga05p37_83612_c1 3300050507 Bacteria 3932
354 nmdc:mga09592_125760_c1 3300050508 Bacteria 2204
355 nmdc:mga09592_268822_c1 3300050508 Bacteria 1479
356 nmdc:mga09592_3270_c1 3300050508 Bacteria 13120
357 nmdc:mga09592_429938_c1 3300050508 Bacteria 1140
358 nmdc:mga09592_466165_c1 3300050508 Bacteria 1089
359 nmdc:mga09592_47163_c1 3300050508 Bacteria 3630
360 nmdc:mga09592_5596_c1 3300050508 Bacteria 10239
361 nmdc:mga0qj67_28211_c1 3300050509 Bacteria 4356
362 nmdc:mga0qj67_28422_c1 3300050509 Bacteria 4340
363 nmdc:mga0qj67_362293_c1 3300050509 Bacteria 1171
364 nmdc:mga0qj67_681_c1 3300050509 Bacteria 23126
365 nmdc:mga0qj67_89313_c1 3300050509 Bacteria 2475
366 nmdc:mga06r32_200278_c1 3300050510 Bacteria 1984
367 nmdc:mga06r32_2218_c1 3300050510 Bacteria 17390
368 nmdc:mga06r32_36716_c1 3300050510 Bacteria 4633
369 nmdc:mga06r32_433574_c1 3300050510 Bacteria 1295
370 nmdc:mga06r32_55275_c1 3300050510 Bacteria 3807
371 nmdc:mga06r32_700_c1 3300050510 Bacteria 29256
372 nmdc:mga06r32_75886_c1 3300050510 Bacteria 3264
373 nmdc:mga06r32_950_c1 3300050510 Bacteria 25815
374 nmdc:mga08y16_147349_c1 3300050511 Bacteria 2447
375 nmdc:mga08y16_371777_c1 3300050511 Bacteria 1466
376 nmdc:mga08y16_40651_c1 3300050511 Bacteria 4872
377 nmdc:mga08y16_653530_c1 3300050511 Unclassified 1055
378 nmdc:mga08y16_832_c1 3300050511 Bacteria 29640
379 nmdc:mga0n895_1229_c1 3300050512 Bacteria 18898
380 nmdc:mga0n895_142598_c1 3300050512 Bacteria 2425
381 nmdc:mga0n895_149305_c1 3300050512 Bacteria 2367
382 nmdc:mga0n895_157395_c1 3300050512 Bacteria 2303
383 nmdc:mga0n895_460218_c1 3300050512 Bacteria 1284
384 nmdc:mga0n895_48100_c1 3300050512 Unclassified 4173
385 nmdc:mga0n895_49971_c1 3300050512 Bacteria 4099
386 nmdc:mga0n895_576913_c1 3300050512 Bacteria 1129
387 nmdc:mga0rr50_108092_c1 3300050513 Bacteria 2197
388 nmdc:mga0rr50_110898_c1 3300050513 Bacteria 2171
389 nmdc:mga0rr50_209902_c1 3300050513 Bacteria 1604
390 nmdc:mga0rr50_252167_c1 3300050513 Bacteria 1466
391 nmdc:mga0rr50_54912_c1 3300050513 Bacteria 2970
392 nmdc:mga0rr50_563877_c1 3300050513 Bacteria 970
393 nmdc:mga08x19_27934_c1 3300050514 Bacteria 3531
394 nmdc:mga08x19_36150_c1 3300050514 Bacteria 3127
395 nmdc:mga08x19_69201_c1 3300050514 Bacteria 2299
396 nmdc:mga08x19_83272_c1 3300050514 Bacteria 2103
397 nmdc:mga0a205_10136_c1 3300050515 Bacteria 8652
398 nmdc:mga0a205_105039_c1 3300050515 Bacteria 2723
399 nmdc:mga0a205_10541_c1 3300050515 Bacteria 8492
400 nmdc:mga0a205_107605_c1 3300050515 Bacteria 2687
401 nmdc:mga0a205_118907_c1 3300050515 Bacteria 2541
402 nmdc:mga0a205_11914_c1 3300050515 Bacteria 8027
403 nmdc:mga0a205_19267_c1 3300050515 Bacteria 6429
404 nmdc:mga0a205_207790_c1 3300050515 Bacteria 1847
405 nmdc:mga0a205_212299_c1 3300050515 Bacteria 1823
406 nmdc:mga0a205_368563_c1 3300050515 Bacteria 1302
407 nmdc:mga0a205_385195_c1 3300050515 Bacteria 1267
408 nmdc:mga0a205_70936_c1 3300050515 Bacteria 3364
409 Ga0501084_0007634 3300054114 Bacteria 8920
410 Ga0501084_0176887 3300054114 Bacteria 1801
411 Ga0590071_000888 3300059421 Bacteria 8305
412 Ga0590071_013033 3300059421 Bacteria 1948
413 Ga0590075_000091 3300059424 Bacteria 23480
414 Ga0590077_001181 3300059426 Bacteria 6350
415 Ga0590077_007550 3300059426 Bacteria 2223
416 Ga0501082_0005141 3300060353 Bacteria 11389
417 Ga0501082_0031237 3300060353 Bacteria 4591
418 Ga0530510_0000802 3300061734 Bacteria 20451
419 Ga0530510_0044786 3300061734 Bacteria 3198
420 Ga0530510_0142123 3300061734 Bacteria 1769
421 Ga0530510_0267432 3300061734 Bacteria 1276
422 2881103861 2881101125 Bacteria 4590519
423 Ga0070707_100047513
424 JGI25405J52794_10001763
425 Ga0065712_10002000
426 Ga0065712_10082797
427 Ga0065715_10098202
428 Ga0065715_10109794
429 Ga0065707_10007690
430 Ga0065707_10189176
431 Ga0070680_100382780
432 Ga0070659_100143578
433 Ga0070694_100035215
434 Ga0070708_100006984
435 Ga0070708_100009054
436 Ga0070708_100072558
437 Ga0070708_100188377
438 Ga0070708_100399187
439 Ga0070708_100750553
440 Ga0070662_100234584
441 Ga0070662_100460954
442 Ga0068867_100314606
443 Ga0070706_100018343
444 Ga0070706_100356408
445 Ga0070707_100000923
446 Ga0070707_100004517
447 Ga0070707_100047342
448 Ga0070707_100579332
449 Ga0070698_100012434
450 Ga0070698_100012746
451 Ga0070698_100067377
452 Ga0070698_100192715
453 Ga0070699_100009226
454 Ga0070699_100023501
455 Ga0070699_100028848
456 Ga0070699_100558375
457 Ga0070679_100466107
458 Ga0070697_100005642
459 Ga0070697_100008448
460 Ga0070697_100030646
461 Ga0070697_100092249
462 Ga0070697_100524199
463 Ga0070672_100097723
464 Ga0070686_100066769
465 Ga0070695_100372059
466 Ga0070695_100372453
467 Ga0070696_100073915
468 Ga0070696_100297704
469 Ga0070704_100003789
470 Ga0070704_100138623
471 Ga0068855_100231493
472 Ga0070664_100147631
473 Ga0068859_100889406
474 Ga0068861_100416522
475 Ga0068863_100332502
476 Ga0081455_10003567
477 Ga0081455_10040743
478 Ga0081455_10313365
479 Ga0081538_10011950
480 Ga0081538_10022378
481 Ga0081538_10069676
482 Ga0075428_100009753
483 Ga0075428_100025301
484 Ga0075428_100026155
485 Ga0075428_100036190
486 Ga0075428_100042369
487 Ga0075428_100079428
488 Ga0075428_100599949
489 Ga0075430_100000040
490 Ga0075430_100027078
491 Ga0075430_100055237
492 Ga0075430_100069221
493 Ga0075430_100082936
494 Ga0075430_100187786
495 Ga0075431_100000192
496 Ga0075431_100009690
497 Ga0075431_100010657
498 Ga0075431_100027763
499 Ga0075431_100049777
500 Ga0075431_100058348
501 Ga0075431_100100305
502 Ga0075431_100151719
503 Ga0075431_100160132
504 Ga0075431_100271561
505 Ga0075431_100539250
506 Ga0075433_10028252
507 Ga0075433_10031640
508 Ga0075433_10032498
509 Ga0075433_10090488
510 Ga0075433_10183294
511 Ga0075433_10233586
512 Ga0075433_10274141
513 Ga0075433_10362199
514 Ga0075433_10438496
515 Ga0075433_10707956
516 Ga0075434_100010986
517 Ga0075434_100015800
518 Ga0075434_100073859
519 Ga0075434_100077272
520 Ga0075434_100161345
521 Ga0075434_100224564
522 Ga0075429_100001755
523 Ga0075429_100009335
524 Ga0075429_100011966
525 Ga0075429_100046330
526 Ga0075429_100359596
527 Ga0075429_100463162
528 Ga0075436_100011043
529 Ga0075436_100021071
530 Ga0075436_100023713
531 Ga0075436_100031756
532 Ga0075436_100052068
533 Ga0075436_100057366
534 Ga0097620_100889396
535 Ga0075435_100013566
536 Ga0075435_100113642
537 Ga0075435_100176503
538 Ga0099794_10040636
539 Ga0099794_10096110
540 Ga0111539_10001175
541 Ga0111539_10052039
542 Ga0111539_10086121
543 Ga0111539_10097265
544 Ga0111539_10128875
545 Ga0114129_10000032
546 Ga0114129_10005272
547 Ga0114129_10005910
548 Ga0114129_10014053
549 Ga0114129_10021143
550 Ga0114129_10025763
551 Ga0114129_10043365
552 Ga0114129_10052934
553 Ga0114129_10066054
554 Ga0114129_10074529
555 Ga0114129_10248644
556 Ga0114129_10252432
557 Ga0114129_10329204
558 Ga0114129_10603480
559 Ga0114129_11049164
560 Ga0114129_11367363
561 Ga0105242_10434650
562 Ga0105248_10019428
563 Ga0157374_10037484
564 Ga0157378_10088863
565 Ga0157378_10119831
566 Ga0163162_10161350
567 Ga0163163_10344499
568 Ga0157376_10105789
569 Ga0207697_10008931
570 Ga0207645_10043522
571 Ga0207684_10001313
572 Ga0207684_10002886
573 Ga0207684_10029073
574 Ga0207684_10047693
575 Ga0207684_10141201
576 Ga0207684_10379157
577 Ga0207684_10409608
578 Ga0207649_10369543
579 Ga0207652_10254529
580 Ga0207646_10001490
581 Ga0207646_10008460
582 Ga0207646_10022513
583 Ga0207646_10022718
584 Ga0207646_10046608
585 Ga0207646_10140094
586 Ga0207646_10784519
587 Ga0207690_10291193
588 Ga0207706_10090760
589 Ga0207706_10093278
590 Ga0207706_10558000
591 Ga0207670_10078852
592 Ga0207665_10311496
593 Ga0207711_10099468
594 Ga0207689_10100634
595 Ga0207667_10087044
596 Ga0207678_10363953
597 Ga0207648_10044431
598 Ga0207675_100836707
599 Ga0207683_10009609
600 Ga0210000_1011095
601 Ga0209982_1003381
602 Ga0210002_1003763
603 Ga0209983_1012932
604 Ga0209588_1009406
605 Ga0209588_1027298
606 Ga0209971_1019174
607 Ga0209971_1057237
608 Ga0209966_1019859
609 Ga0209974_10006542
610 Ga0207428_10000628
611 Ga0207428_10146098
612 Ga0207428_10270845
613 Ga0307408_100032267
614 Ga0307408_100072590
615 Ga0307408_100128053
616 Ga0307408_100325509
617 Ga0307408_100364512
618 Ga0307405_10021611
619 Ga0307405_10043134
620 Ga0307405_10075873
621 Ga0307405_10203457
622 Ga0307405_10310460
623 Ga0307413_10003070
624 Ga0307413_10037958
625 Ga0307413_10195062
626 Ga0307413_10507176
627 Ga0307410_10055822
628 Ga0307410_10192792
629 Ga0307410_10259229
630 Ga0307406_10097842
631 Ga0307412_10026269
632 Ga0307412_10307038
633 Ga0307412_10351099
634 Ga0307409_100010833
635 Ga0307409_100019596
636 Ga0307409_100028328
637 Ga0307409_100147299
638 Ga0307409_100413936
639 Ga0307409_100472327
640 Ga0307416_100001267
641 Ga0307416_100002859
642 Ga0307416_100030466
643 Ga0307416_100065756
644 Ga0307416_100114444
645 Ga0307416_100214889
646 Ga0307416_100298659
647 Ga0307416_101000697
648 Ga0307414_10002319
649 Ga0307414_10002418
650 Ga0307414_10105831
651 Ga0307414_10261186
652 Ga0307411_10009541
653 Ga0307411_10049320
654 Ga0307411_10054418
655 Ga0307411_10130464
656 Ga0307411_10244072
657 Ga0307415_100002119
658 Ga0307415_100005568
659 Ga0373930_0027442
660 Ga0373930_0033914
661 Ga0373932_0009923
662 Ga0373941_0004455
663 Ga0373960_0047485
664 Ga0373942_0003252
665 Ga0373931_0002419
666 Ga0373931_0003331
667 Ga0373935_0005315
668 Ga0373925_0099692
669 Ga0439431_0004036
670 Ga0439441_042788
671 Ga0439446_0022017
672 Ga0439446_0106276
673 Ga0439434_0025946
674 Ga0451577_0035922
675 Ga0451577_0132231
676 Ga0451577_0280663
677 Ga0453684_0097752
678 Ga0453684_0233742
679 Ga0451576_0102905
680 Ga0451576_0209764
681 Ga0451576_0429997
682 Ga0495580_0009393
683 Ga0495580_0060330
684 Ga0496102_0130492
685 Ga0496102_0141181
686 Ga0496108_0544876
687 Ga0496109_0058638
688 Ga0496110_0060448
689 Ga0496112_0143734
690 Ga0501296_008519
691 Ga0501031_0132075
692 Ga0501032_0055169
693 Ga0501033_0016421
694 Ga0501036_0026054
695 Ga0501036_0029000
696 Ga0501036_0234503
697 Ga0501037_0049298
698 Ga0501038_0002448
699 Ga0501038_0025447
700 Ga0501039_0029058
701 Ga0501039_0124889
702 Ga0501040_0001437
703 Ga0501040_0002709
704 Ga0501040_0067564
705 Ga0501040_0096332
706 Ga0501040_0184527
707 Ga0501041_0003190
708 Ga0501041_0092365
709 Ga0501042_0000034
710 Ga0501046_0022322
711 Ga0501046_0119581
712 Ga0501048_0007735
713 Ga0501048_0026702
714 Ga0501048_0191613
715 Ga0501067_0064537
716 Ga0501068_0003003
717 Ga0501068_0026671
718 Ga0501070_0046655
719 Ga0501071_0005752
720 Ga0501071_0366410
721 Ga0501072_0000420
722 Ga0501072_0036948
723 Ga0501072_0129298
724 Ga0501072_0139584
725 Ga0501072_0299522
726 Ga0501072_0374752
727 Ga0501073_0033499
728 Ga0501074_0082966
729 Ga0501074_0154542
730 Ga0501075_0005764
731 Ga0501075_0064340
732 Ga0501075_0386322
733 Ga0501075_0399662
734 Ga0501076_0000893
735 Ga0501076_0013014
736 Ga0501076_0254391
737 Ga0501077_0000051
738 Ga0501077_0006481
739 Ga0501077_0021549
740 Ga0501235_030585
741 Ga0501249_042514
742 Ga0501261_019152
743 Ga0501225_0064651
744 Ga0501234_015127
745 Ga0501079_0000789
746 Ga0501079_0002538
747 Ga0501079_0239196
748 Ga0501080_0022872
749 Ga0501080_0080869
750 Ga0501081_0001354
751 Ga0501081_0007119
752 Ga0501081_0107534
753 Ga0501083_0200058
754 Ga0501083_0312822
755 Ga0501035_0005209
756 Ga0501035_0638172
757 Ga0501044_0271877
758 Ga0501045_0001265
759 Ga0501045_0001879
760 Ga0501045_0041196
761 Ga0501045_0073638
762 nmdc:mga05p37_119444_c1
763 nmdc:mga05p37_134553_c1
764 nmdc:mga05p37_1621_c1
765 nmdc:mga05p37_175959_c1
766 nmdc:mga05p37_18597_c1
767 nmdc:mga05p37_29372_c1
768 nmdc:mga05p37_34876_c1
769 nmdc:mga05p37_3630_c1
770 nmdc:mga05p37_4041_c1
771 nmdc:mga05p37_415565_c1
772 nmdc:mga05p37_4419_c1
773 nmdc:mga05p37_47388_c1
774 nmdc:mga05p37_541755_c1
775 nmdc:mga05p37_83612_c1
776 nmdc:mga09592_125760_c1
777 nmdc:mga09592_268822_c1
778 nmdc:mga09592_3270_c1
779 nmdc:mga09592_429938_c1
780 nmdc:mga09592_466165_c1
781 nmdc:mga09592_47163_c1
782 nmdc:mga09592_5596_c1
783 nmdc:mga0qj67_28211_c1
784 nmdc:mga0qj67_28422_c1
785 nmdc:mga0qj67_362293_c1
786 nmdc:mga0qj67_681_c1
787 nmdc:mga0qj67_89313_c1
788 nmdc:mga06r32_200278_c1
789 nmdc:mga06r32_2218_c1
790 nmdc:mga06r32_36716_c1
791 nmdc:mga06r32_433574_c1
792 nmdc:mga06r32_55275_c1
793 nmdc:mga06r32_700_c1
794 nmdc:mga06r32_75886_c1
795 nmdc:mga06r32_950_c1
796 nmdc:mga08y16_147349_c1
797 nmdc:mga08y16_371777_c1
798 nmdc:mga08y16_40651_c1
799 nmdc:mga08y16_653530_c1
800 nmdc:mga08y16_832_c1
801 nmdc:mga0n895_1229_c1
802 nmdc:mga0n895_142598_c1
803 nmdc:mga0n895_149305_c1
804 nmdc:mga0n895_157395_c1
805 nmdc:mga0n895_460218_c1
806 nmdc:mga0n895_48100_c1
807 nmdc:mga0n895_49971_c1
808 nmdc:mga0n895_576913_c1
809 nmdc:mga0rr50_108092_c1
810 nmdc:mga0rr50_110898_c1
811 nmdc:mga0rr50_209902_c1
812 nmdc:mga0rr50_252167_c1
813 nmdc:mga0rr50_54912_c1
814 nmdc:mga0rr50_563877_c1
815 nmdc:mga08x19_27934_c1
816 nmdc:mga08x19_36150_c1
817 nmdc:mga08x19_69201_c1
818 nmdc:mga08x19_83272_c1
819 nmdc:mga0a205_10136_c1
820 nmdc:mga0a205_105039_c1
821 nmdc:mga0a205_10541_c1
822 nmdc:mga0a205_107605_c1
823 nmdc:mga0a205_118907_c1
824 nmdc:mga0a205_11914_c1
825 nmdc:mga0a205_19267_c1
826 nmdc:mga0a205_207790_c1
827 nmdc:mga0a205_212299_c1
828 nmdc:mga0a205_368563_c1
829 nmdc:mga0a205_385195_c1
830 nmdc:mga0a205_70936_c1
831 Ga0501084_0007634
832 Ga0501084_0176887
833 Ga0590071_000888
834 Ga0590071_013033
835 Ga0590075_000091
836 Ga0590077_001181
837 Ga0590077_007550
838 Ga0501082_0005141
839 Ga0501082_0031237
840 Ga0530510_0000802
841 Ga0530510_0044786
842 Ga0530510_0142123
843 Ga0530510_0267432
844 2881103861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12837

Fer4_6

4Fe-4S binding domain

128

151

0.95

PF13247

Fer4_11

4Fe-4S dicluster domain

95

192

0.95

PF12838

Fer4_7

4Fe-4S dicluster domain

36

120

0.78

Map