F440183

General Info

Members Datasets Scaffolds Average Seq Length
422 210 844 294

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100296986|Ga0070690_1002969861
Length 338
Sequence VRFVVLCALRDLHPRTMFGSQDSLRITTDRKIVTFRGAAKIIYAIMPRLAAFPKAYMKSLCVDGTMRLSEWIDMACGLEIDGLEWYAGFLEMKDEKNWLLFRSEVEQRGKQIPMLCCSPDFTHPDKDFRDREISKQKKWIDMIHELGGSYCRVLSGQKRPGLSIDQGVELAARCIEACLPYASEKNITLILENHYKDDFWEYPEFAQKMDVFCQLVDRIHHPNFGVNYDPSNTYLAGEDPVELLKRVSDRVVTMHASDRYLKEGTIEDLRKEETGLGYAKRLSHGEIGKGLNDYDAIFAELKGVGFDGWISIEDGVDGFDQLARSVSFLRNKMKKYWD

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
184 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
185 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
189 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
190 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
194 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
195 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
210 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 0.95
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 14.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100296986 3300005330 Bacteria 1157
2 rootH2_10073119 3300003320 Bacteria 1797
3 rootL2_10106600 3300003322 Bacteria 1923
4 rootH1_10026978 3300003323 Bacteria 1395
5 JGI25160J50197_1000662 3300003354 Bacteria 19194
6 Ga0065714_10121083 3300005288 Bacteria 1347
7 Ga0065704_10139339 3300005289 Bacteria 1525
8 Ga0065712_10008476 3300005290 Bacteria 2353
9 Ga0065715_10105285 3300005293 Unclassified 2901
10 Ga0065715_10250872 3300005293 Bacteria 1167
11 Ga0070658_10000654 3300005327 Bacteria 29929
12 Ga0070658_10143360 3300005327 Bacteria 1996
13 Ga0070676_10045024 3300005328 Unclassified 2569
14 Ga0070676_10075862 3300005328 Bacteria 2028
15 Ga0070676_10143744 3300005328 Unclassified 1521
16 Ga0070683_100002178 3300005329 Bacteria 15494
17 Ga0070683_100011503 3300005329 Bacteria 7655
18 Ga0070683_100030627 3300005329 Bacteria 4887
19 Ga0070683_100199126 3300005329 Unclassified 1902
20 Ga0070683_100376429 3300005329 Unclassified 1353
21 Ga0070690_100200471 3300005330 Bacteria 1388
22 Ga0070670_100042193 3300005331 Bacteria 3921
23 Ga0070670_100208213 3300005331 Bacteria 1700
24 Ga0070677_10086269 3300005333 Bacteria 1355
25 Ga0068869_100009364 3300005334 Bacteria 6355
26 Ga0068869_100031122 3300005334 Bacteria 3753
27 Ga0068869_100053980 3300005334 Bacteria 2923
28 Ga0070666_10014461 3300005335 Bacteria 5025
29 Ga0070666_10042741 3300005335 Bacteria 3033
30 Ga0070666_10083338 3300005335 Bacteria 2187
31 Ga0070666_10189151 3300005335 Bacteria 1446
32 Ga0070666_10208311 3300005335 Unclassified 1376
33 Ga0070680_100007029 3300005336 Bacteria 8579
34 Ga0070680_100521622 3300005336 Bacteria 1017
35 Ga0070682_100002037 3300005337 Bacteria 11287
36 Ga0070682_100069932 3300005337 Unclassified 2242
37 Ga0068868_100041008 3300005338 Unclassified 3605
38 Ga0068868_100484060 3300005338 Unclassified 1081
39 Ga0070660_100000709 3300005339 Bacteria 22037
40 Ga0070660_100214909 3300005339 Bacteria 1562
41 Ga0070689_100074734 3300005340 Bacteria 2652
42 Ga0070689_100321114 3300005340 Unclassified 1293
43 Ga0070691_10014719 3300005341 Bacteria 3591
44 Ga0070661_100001463 3300005344 Bacteria 16401
45 Ga0070661_100003861 3300005344 Bacteria 10311
46 Ga0070661_100182955 3300005344 Bacteria 1595
47 Ga0070668_100030905 3300005347 Bacteria 4074
48 Ga0070668_100033492 3300005347 Unclassified 3913
49 Ga0070669_100019533 3300005353 Bacteria 4839
50 Ga0070675_100114387 3300005354 Unclassified 2286
51 Ga0070675_100379879 3300005354 Bacteria 1257
52 Ga0070675_100428090 3300005354 Bacteria 1184
53 Ga0070671_100076258 3300005355 Bacteria 2801
54 Ga0070674_100020820 3300005356 Bacteria 4200
55 Ga0070674_100050165 3300005356 Unclassified 2872
56 Ga0070673_100063853 3300005364 Unclassified 2932
57 Ga0070673_100069030 3300005364 Bacteria 2832
58 Ga0070673_100305926 3300005364 Bacteria 1401
59 Ga0070673_100462806 3300005364 Unclassified 1142
60 Ga0070673_100493920 3300005364 Bacteria 1106
61 Ga0070688_100020853 3300005365 Bacteria 3818
62 Ga0070659_100008743 3300005366 Bacteria 7412
63 Ga0070659_100219559 3300005366 Bacteria 1568
64 Ga0070667_100043984 3300005367 Bacteria 3749
65 Ga0070667_100161313 3300005367 Bacteria 1975
66 Ga0070663_100282117 3300005455 Unclassified 1324
67 Ga0070678_100105094 3300005456 Unclassified 2197
68 Ga0070662_100108878 3300005457 Bacteria 2108
69 Ga0070662_100156513 3300005457 Bacteria 1779
70 Ga0070662_100165947 3300005457 Unclassified 1730
71 Ga0070681_10241087 3300005458 Bacteria 1722
72 Ga0068867_100054306 3300005459 Bacteria 2960
73 Ga0068867_100510321 3300005459 Bacteria 1035
74 Ga0070679_100068617 3300005530 Bacteria 3536
75 Ga0070684_100008384 3300005535 Bacteria 8074
76 Ga0070684_100129926 3300005535 Bacteria 2272
77 Ga0070684_100320149 3300005535 Unclassified 1425
78 Ga0068853_100022324 3300005539 Bacteria 5285
79 Ga0068853_100217623 3300005539 Bacteria 1743
80 Ga0068853_100299642 3300005539 Unclassified 1486
81 Ga0068853_100300510 3300005539 Unclassified 1483
82 Ga0070672_100045223 3300005543 Unclassified 3404
83 Ga0070672_100085527 3300005543 Bacteria 2535
84 Ga0070686_100168744 3300005544 Bacteria 1546
85 Ga0070693_100056096 3300005547 Bacteria 2272
86 Ga0070665_100051542 3300005548 Unclassified 4127
87 Ga0070665_100169204 3300005548 Bacteria 2187
88 Ga0070665_100271009 3300005548 Bacteria 1699
89 Ga0068855_100065680 3300005563 Bacteria 4230
90 Ga0068855_100088264 3300005563 Bacteria 3582
91 Ga0068855_100242383 3300005563 Bacteria 2014
92 Ga0068855_100501141 3300005563 Bacteria 1319
93 Ga0070664_100016825 3300005564 Bacteria 6003
94 Ga0070664_100201285 3300005564 Bacteria 1777
95 Ga0070664_100250328 3300005564 Bacteria 1593
96 Ga0068857_100001588 3300005577 Bacteria 18219
97 Ga0068857_100003611 3300005577 Bacteria 12957
98 Ga0068857_100015293 3300005577 Bacteria 6698
99 Ga0068857_100166542 3300005577 Bacteria 2002
100 Ga0068854_100016548 3300005578 Bacteria 4919
101 Ga0068854_100469322 3300005578 Unclassified 1055
102 Ga0068856_100009543 3300005614 Bacteria 9429
103 Ga0068856_100010871 3300005614 Bacteria 8838
104 Ga0068856_100019107 3300005614 Bacteria 6652
105 Ga0068852_100000410 3300005616 Bacteria 28619
106 Ga0068852_100581601 3300005616 Bacteria 1123
107 Ga0068852_100584017 3300005616 Bacteria 1120
108 Ga0068859_100016717 3300005617 Bacteria 7365
109 Ga0068859_100024370 3300005617 Bacteria 6070
110 Ga0068859_100024651 3300005617 Bacteria 6037
111 Ga0068859_100161511 3300005617 Bacteria 2319
112 Ga0068859_100241969 3300005617 Bacteria 1894
113 Ga0068859_100290897 3300005617 Bacteria 1727
114 Ga0068859_100524093 3300005617 Bacteria 1280
115 Ga0068864_100344134 3300005618 Bacteria 1406
116 Ga0068866_10040466 3300005718 Unclassified 2308
117 Ga0068861_100007343 3300005719 Bacteria 7550
118 Ga0068851_10040136 3300005834 Bacteria 2352
119 Ga0068870_10041734 3300005840 Unclassified 2385
120 Ga0068858_100252931 3300005842 Bacteria 1674
121 Ga0068858_100585079 3300005842 Bacteria 1082
122 Ga0068860_100004009 3300005843 Bacteria 15116
123 Ga0068860_100035569 3300005843 Bacteria 4777
124 Ga0068860_100056169 3300005843 Unclassified 3744
125 Ga0068862_100009417 3300005844 Bacteria 8080
126 Ga0068871_100004069 3300006358 Bacteria 10115
127 Ga0068871_100081485 3300006358 Bacteria 2681
128 Ga0075428_100007909 3300006844 Bacteria 11789
129 Ga0075428_100176033 3300006844 Bacteria 2317
130 Ga0075431_100070997 3300006847 Unclassified 3592
131 Ga0075433_10065847 3300006852 Bacteria 3178
132 Ga0075434_100149057 3300006871 Bacteria 2359
133 Ga0075434_100280855 3300006871 Bacteria 1685
134 Ga0075429_100022346 3300006880 Bacteria 5486
135 Ga0068865_100203257 3300006881 Bacteria 1539
136 Ga0068865_100325317 3300006881 Bacteria 1238
137 Ga0097620_100016719 3300006931 Bacteria 7365
138 Ga0097620_100024370 3300006931 Bacteria 6070
139 Ga0097620_100024651 3300006931 Bacteria 6037
140 Ga0097620_100161510 3300006931 Bacteria 2319
141 Ga0097620_100241979 3300006931 Bacteria 1894
142 Ga0097620_100290876 3300006931 Bacteria 1727
143 Ga0097620_100524155 3300006931 Bacteria 1280
144 Ga0105240_10001264 3300009093 Bacteria 43767
145 Ga0105240_10004678 3300009093 Bacteria 20688
146 Ga0105240_10005683 3300009093 Bacteria 18511
147 Ga0105240_10144907 3300009093 Bacteria 2835
148 Ga0105240_10589577 3300009093 Unclassified 1225
149 Ga0111539_10001995 3300009094 Bacteria 27227
150 Ga0111539_10039960 3300009094 Bacteria 5649
151 Ga0111539_10133188 3300009094 Bacteria 2910
152 Ga0114129_10007759 3300009147 Bacteria 15265
153 Ga0114129_10071276 3300009147 Bacteria 4846
154 Ga0114129_10187900 3300009147 Bacteria 2807
155 Ga0114129_10197701 3300009147 Bacteria 2726
156 Ga0105243_10166022 3300009148 Bacteria 1908
157 Ga0105241_10001366 3300009174 Bacteria 18591
158 Ga0105241_10020047 3300009174 Bacteria 4938
159 Ga0105241_10047008 3300009174 Bacteria 3280
160 Ga0105241_10114802 3300009174 Unclassified 2161
161 Ga0105241_10116138 3300009174 Bacteria 2149
162 Ga0105241_10218584 3300009174 Unclassified 1600
163 Ga0105241_10469063 3300009174 Bacteria 1117
164 Ga0105242_10100351 3300009176 Bacteria 2451
165 Ga0105242_10238996 3300009176 Bacteria 1632
166 Ga0105248_10165088 3300009177 Bacteria 2497
167 Ga0105237_10014557 3300009545 Bacteria 8220
168 Ga0105237_10027864 3300009545 Bacteria 5757
169 Ga0105237_10244325 3300009545 Unclassified 1796
170 Ga0105238_10011379 3300009551 Bacteria 8957
171 Ga0105238_10035408 3300009551 Bacteria 5076
172 Ga0105239_10003307 3300010375 Bacteria 19849
173 Ga0105239_10032134 3300010375 Bacteria 5768
174 Ga0105239_10108166 3300010375 Bacteria 3081
175 Ga0105246_10084970 3300011119 Bacteria 2265
176 Ga0157373_10034656 3300013100 Bacteria 3626
177 Ga0157371_10002844 3300013102 Bacteria 16173
178 Ga0157371_10004950 3300013102 Bacteria 11442
179 Ga0157371_10012767 3300013102 Bacteria 6404
180 Ga0157371_10067692 3300013102 Bacteria 2527
181 Ga0157371_10071117 3300013102 Unclassified 2463
182 Ga0157371_10122379 3300013102 Bacteria 1850
183 Ga0157370_10008630 3300013104 Bacteria 10971
184 Ga0157370_10020571 3300013104 Bacteria 6589
185 Ga0157369_10022096 3300013105 Bacteria 7107
186 Ga0157369_10025905 3300013105 Bacteria 6507
187 Ga0157369_10085498 3300013105 Bacteria 3370
188 Ga0157369_10088117 3300013105 Bacteria 3313
189 Ga0157369_10148890 3300013105 Bacteria 2474
190 Ga0157369_10349795 3300013105 Unclassified 1535
191 Ga0157374_10001327 3300013296 Bacteria 21026
192 Ga0157374_10066516 3300013296 Bacteria 3387
193 Ga0157374_10082063 3300013296 Bacteria 3060
194 Ga0157374_10094217 3300013296 Bacteria 2861
195 Ga0157374_10206058 3300013296 Unclassified 1927
196 Ga0157374_10371142 3300013296 Bacteria 1424
197 Ga0157378_10092524 3300013297 Bacteria 2751
198 Ga0157378_10127975 3300013297 Bacteria 2348
199 Ga0157378_10180136 3300013297 Unclassified 1987
200 Ga0157378_10195602 3300013297 Bacteria 1910
201 Ga0157378_10593394 3300013297 Bacteria 1118
202 Ga0163162_10000391 3300013306 Bacteria 40141
203 Ga0163162_10035743 3300013306 Bacteria 4949
204 Ga0163162_10127133 3300013306 Bacteria 2656
205 Ga0163162_10323646 3300013306 Bacteria 1674
206 Ga0157372_10000230 3300013307 Bacteria 62343
207 Ga0157372_10042971 3300013307 Bacteria 5002
208 Ga0157372_10138298 3300013307 Bacteria 2806
209 Ga0157372_10278170 3300013307 Unclassified 1946
210 Ga0157372_10315480 3300013307 Bacteria 1820
211 Ga0157372_10464701 3300013307 Bacteria 1475
212 Ga0157375_10016049 3300013308 Bacteria 6719
213 Ga0157375_10053244 3300013308 Bacteria 3981
214 Ga0157375_10063570 3300013308 Bacteria 3672
215 Ga0157375_10395903 3300013308 Bacteria 1548
216 Ga0157375_10430179 3300013308 Bacteria 1486
217 Ga0163163_10059837 3300014325 Bacteria 3769
218 Ga0163163_10779986 3300014325 Bacteria 1019
219 Ga0157380_10007608 3300014326 Bacteria 7700
220 Ga0157380_10532180 3300014326 Bacteria 1149
221 Ga0157377_10013421 3300014745 Bacteria 4146
222 Ga0157377_10060017 3300014745 Bacteria 2170
223 Ga0157379_10059646 3300014968 Bacteria 3411
224 Ga0157379_10140999 3300014968 Unclassified 2173
225 Ga0157376_10038566 3300014969 Unclassified 3888
226 Ga0157376_10112340 3300014969 Unclassified 2400
227 Ga0157376_10259168 3300014969 Bacteria 1628
228 Ga0207426_1000026 3300025302 Bacteria 515228
229 Ga0207682_10009901 3300025893 Bacteria 3746
230 Ga0207642_10062019 3300025899 Unclassified 1741
231 Ga0207688_10056404 3300025901 Unclassified 2207
232 Ga0207680_10020902 3300025903 Bacteria 3534
233 Ga0207680_10032469 3300025903 Unclassified 2968
234 Ga0207680_10059977 3300025903 Bacteria 2314
235 Ga0207680_10096150 3300025903 Unclassified 1894
236 Ga0207647_10026919 3300025904 Bacteria 3755
237 Ga0207647_10089645 3300025904 Bacteria 1835
238 Ga0207647_10093359 3300025904 Bacteria 1793
239 Ga0207645_10008724 3300025907 Bacteria 7060
240 Ga0207645_10019000 3300025907 Bacteria 4512
241 Ga0207643_10049045 3300025908 Bacteria 2392
242 Ga0207654_10003604 3300025911 Bacteria 7821
243 Ga0207654_10008598 3300025911 Bacteria 5170
244 Ga0207654_10121406 3300025911 Bacteria 1641
245 Ga0207707_10002309 3300025912 Bacteria 17195
246 Ga0207695_10000586 3300025913 Bacteria 73584
247 Ga0207695_10008355 3300025913 Bacteria 12968
248 Ga0207695_10025284 3300025913 Bacteria 6651
249 Ga0207695_10060329 3300025913 Bacteria 3927
250 Ga0207671_10348476 3300025914 Unclassified 1174
251 Ga0207657_10002023 3300025919 Bacteria 21914
252 Ga0207657_10017953 3300025919 Bacteria 6770
253 Ga0207657_10036684 3300025919 Bacteria 4386
254 Ga0207649_10027584 3300025920 Unclassified 3334
255 Ga0207649_10149782 3300025920 Bacteria 1606
256 Ga0207649_10194048 3300025920 Bacteria 1430
257 Ga0207649_10288062 3300025920 Bacteria 1197
258 Ga0207652_10001518 3300025921 Bacteria 20482
259 Ga0207694_10006765 3300025924 Bacteria 8706
260 Ga0207694_10147610 3300025924 Bacteria 1894
261 Ga0207650_10036656 3300025925 Bacteria 3569
262 Ga0207650_10054765 3300025925 Bacteria 2960
263 Ga0207650_10302351 3300025925 Bacteria 1307
264 Ga0207659_10062571 3300025926 Bacteria 2687
265 Ga0207659_10359516 3300025926 Bacteria 1210
266 Ga0207700_10545816 3300025928 Bacteria 1028
267 Ga0207644_10340427 3300025931 Bacteria 1216
268 Ga0207706_10118704 3300025933 Bacteria 2326
269 Ga0207706_10126064 3300025933 Bacteria 2252
270 Ga0207706_10196054 3300025933 Unclassified 1772
271 Ga0207686_10129775 3300025934 Bacteria 1727
272 Ga0207686_10461919 3300025934 Bacteria 978
273 Ga0207709_10136371 3300025935 Bacteria 1681
274 Ga0207670_10010258 3300025936 Bacteria 5388
275 Ga0207670_10248746 3300025936 Bacteria 1373
276 Ga0207691_10021597 3300025940 Bacteria 6076
277 Ga0207691_10034018 3300025940 Bacteria 4743
278 Ga0207691_10057333 3300025940 Unclassified 3545
279 Ga0207689_10003113 3300025942 Bacteria 15226
280 Ga0207689_10025247 3300025942 Bacteria 4980
281 Ga0207689_10025491 3300025942 Bacteria 4955
282 Ga0207689_10029369 3300025942 Bacteria 4592
283 Ga0207689_10067755 3300025942 Bacteria 2933
284 Ga0207661_10023367 3300025944 Unclassified 4670
285 Ga0207661_10083486 3300025944 Bacteria 2644
286 Ga0207661_10495619 3300025944 Bacteria 1116
287 Ga0207679_10002262 3300025945 Bacteria 11874
288 Ga0207679_10006678 3300025945 Bacteria 7305
289 Ga0207679_10105616 3300025945 Bacteria 2212
290 Ga0207667_10000309 3300025949 Bacteria 67726
291 Ga0207667_10002687 3300025949 Bacteria 21992
292 Ga0207667_10047851 3300025949 Unclassified 4524
293 Ga0207667_10084744 3300025949 Bacteria 3281
294 Ga0207667_10344349 3300025949 Bacteria 1521
295 Ga0207668_10323370 3300025972 Unclassified 1281
296 Ga0207640_10080920 3300025981 Bacteria 2219
297 Ga0207640_10157426 3300025981 Unclassified 1676
298 Ga0207640_10158216 3300025981 Bacteria 1673
299 Ga0207640_10449129 3300025981 Unclassified 1062
300 Ga0207640_10587787 3300025981 Bacteria 941
301 Ga0207658_10105992 3300025986 Unclassified 2212
302 Ga0207677_10062988 3300026023 Bacteria 2575
303 Ga0207639_10011585 3300026041 Bacteria 6127
304 Ga0207639_10025530 3300026041 Bacteria 4284
305 Ga0207639_10091132 3300026041 Unclassified 2440
306 Ga0207639_10277406 3300026041 Bacteria 1473
307 Ga0207639_10320740 3300026041 Bacteria 1376
308 Ga0207678_10078940 3300026067 Bacteria 2819
309 Ga0207702_10029233 3300026078 Bacteria 4585
310 Ga0207702_10071162 3300026078 Bacteria 2994
311 Ga0207641_10513280 3300026088 Bacteria 1165
312 Ga0207648_10011745 3300026089 Bacteria 8235
313 Ga0207648_10179274 3300026089 Bacteria 1875
314 Ga0207674_10001219 3300026116 Bacteria 33514
315 Ga0207674_10001797 3300026116 Bacteria 27330
316 Ga0207674_10017867 3300026116 Bacteria 7731
317 Ga0207674_10037790 3300026116 Bacteria 5017
318 Ga0207674_10427560 3300026116 Bacteria 1280
319 Ga0207675_100009509 3300026118 Bacteria 9096
320 Ga0207675_100438878 3300026118 Bacteria 1292
321 Ga0207683_10001534 3300026121 Bacteria 20806
322 Ga0207683_10179443 3300026121 Bacteria 1920
323 Ga0207698_10000848 3300026142 Bacteria 17751
324 Ga0207698_10129423 3300026142 Bacteria 2154
325 Ga0207698_10459802 3300026142 Bacteria 1231
326 Ga0268266_10098707 3300028379 Unclassified 2570
327 Ga0268264_10002281 3300028381 Bacteria 16987
328 Ga0268264_10114767 3300028381 Bacteria 2365
329 Ga0268264_10144838 3300028381 Unclassified 2123
330 Ga0268264_10209535 3300028381 Bacteria 1788
331 Ga0307515_10000091 3300028794 Bacteria 214014
332 Ga0265327_10000101 3300031251 Bacteria 188671
333 Ga0265327_10003651 3300031251 Bacteria 14462
334 Ga0265327_10014860 3300031251 Bacteria 5068
335 Ga0265327_10027004 3300031251 Bacteria 3313
336 Ga0265327_10030950 3300031251 Bacteria 3015
337 Ga0307513_10394910 3300031456 Bacteria 1119
338 Ga0307509_10078499 3300031507 Unclassified 3420
339 Ga0307516_10313998 3300031730 Bacteria 1240
340 Ga0307410_10075051 3300031852 Unclassified 2357
341 Ga0307412_10037016 3300031911 Bacteria 3132
342 Ga0307409_100040863 3300031995 Bacteria 3458
343 Ga0307416_100037438 3300032002 Bacteria 3733
344 Ga0307416_100190452 3300032002 Bacteria 1934
345 Ga0307414_10187581 3300032004 Unclassified 1670
346 Ga0316574_0078291 3300035398 Bacteria 2096
347 Ga0373935_0134958 3300035692 Bacteria 1662
348 Ga0373933_0091680 3300035724 Bacteria 1876
349 Ga0373947_0345248 3300035725 Bacteria 998
350 Ga0373937_0019278 3300036401 Bacteria 6105
351 Ga0316584_0305179 3300036712 Bacteria 1152
352 Ga0395899_0002920 3300037312 Bacteria 13725
353 Ga0395900_0011692 3300037418 Bacteria 8979
354 Ga0395898_0004939 3300037466 Bacteria 14471
355 Ga0395901_0010792 3300038443 Bacteria 9259
356 Ga0451798_0138376 3300041458 Bacteria 954
357 Ga0451577_0003069 3300042876 Bacteria 18896
358 Ga0451577_0013409 3300042876 Bacteria 7671
359 Ga0453684_0000841 3300044712 Bacteria 103501
360 Ga0453684_0001009 3300044712 Bacteria 91051
361 Ga0495592_0019105 3300046454 Bacteria 5215
362 Ga0495653_0056548 3300046463 Bacteria 2990
363 Ga0495650_0043054 3300046471 Bacteria 1919
364 Ga0495618_0048685 3300046514 Bacteria 2676
365 Ga0495628_0029405 3300046516 Bacteria 4455
366 Ga0495630_0006627 3300046517 Bacteria 8251
367 Ga0495643_0000248 3300046522 Bacteria 79547
368 Ga0495667_0052224 3300046559 Bacteria 2694
369 Ga0495670_0039529 3300046691 Bacteria 2353
370 Ga0495672_0117459 3300047320 Bacteria 1419
371 Ga0496102_0698045 3300048905 Bacteria 938
372 Ga0496104_0688138 3300048907 Bacteria 931
373 Ga0496105_0452209 3300048908 Bacteria 1014
374 Ga0501032_0066188 3300049569 Bacteria 2415
375 Ga0501033_0033223 3300049570 Bacteria 3874
376 Ga0501034_0006521 3300049571 Bacteria 12547
377 Ga0501034_0046766 3300049571 Bacteria 4372
378 Ga0501034_0242049 3300049571 Bacteria 1750
379 Ga0501036_0304011 3300049572 Bacteria 1334
380 Ga0501037_0006592 3300049573 Bacteria 8490
381 Ga0501037_0273164 3300049573 Bacteria 1179
382 Ga0501039_0201725 3300049575 Bacteria 1564
383 Ga0501040_0000014 3300049576 Archaea 76174
384 Ga0501043_0003923 3300049579 Bacteria 12202
385 Ga0501043_0008195 3300049579 Bacteria 8239
386 Ga0501043_0203193 3300049579 Bacteria 1537
387 Ga0501046_0011148 3300049580 Bacteria 7700
388 Ga0501046_0209685 3300049580 Bacteria 1447
389 Ga0501047_0036390 3300049581 Bacteria 4757
390 Ga0501198_003444 3300049649 Bacteria 2163
391 Ga0501201_000452 3300049651 Bacteria 3790
392 Ga0501216_007019 3300049660 Bacteria 1743
393 Ga0501217_000040 3300049661 Bacteria 14443
394 Ga0501223_001738 3300049663 Bacteria 4956
395 Ga0501224_001731 3300049664 Bacteria 2927
396 Ga0501240_005245 3300049673 Unclassified 1545
397 Ga0501242_000489 3300049674 Bacteria 3488
398 Ga0501243_012390 3300049675 Bacteria 1345
399 Ga0501257_007115 3300049686 Bacteria 2496
400 Ga0501257_036327 3300049686 Bacteria 1200
401 Ga0501259_001926 3300049688 Bacteria 3440
402 Ga0501221_000060 3300049704 Bacteria 11755
403 Ga0501234_006463 3300049707 Bacteria 1833
404 Ga0501080_0047836 3300049742 Bacteria 3982
405 Ga0501080_0379416 3300049742 Bacteria 1274
406 Ga0501035_0012853 3300049822 Bacteria 7731
407 Ga0501035_0026463 3300049822 Bacteria 5307
408 Ga0501044_0016580 3300049823 Bacteria 7907
409 Ga0501044_0075395 3300049823 Bacteria 3425
410 nmdc:mga09592_33894_c1 3300050508 Unclassified 4266
411 nmdc:mga06r32_135919_c1 3300050510 Unclassified 2433
412 nmdc:mga08y16_150654_c1 3300050511 Bacteria 2418
413 nmdc:mga08y16_52117_c1 3300050511 Bacteria 4281
414 nmdc:mga0n895_16744_c1 3300050512 Bacteria 6736
415 nmdc:mga0a205_77567_c1 3300050515 Bacteria 3210
416 Ga0495619_0178357 3300053085 Bacteria 1470
417 Ga0500568_0010919 3300053139 Bacteria 4234
418 Ga0500616_0036197 3300053153 Bacteria 2680
419 Ga0500622_0001810 3300053156 Bacteria 16284
420 Ga0501084_0235700 3300054114 Bacteria 1545
421 2896089517 2896085136 Bacteria 6129793
422 2910247867 2910245624 Bacteria 6935613
423 Ga0070690_100296986
424 rootH2_10073119
425 rootL2_10106600
426 rootH1_10026978
427 JGI25160J50197_1000662
428 Ga0065714_10121083
429 Ga0065704_10139339
430 Ga0065712_10008476
431 Ga0065715_10105285
432 Ga0065715_10250872
433 Ga0070658_10000654
434 Ga0070658_10143360
435 Ga0070676_10045024
436 Ga0070676_10075862
437 Ga0070676_10143744
438 Ga0070683_100002178
439 Ga0070683_100011503
440 Ga0070683_100030627
441 Ga0070683_100199126
442 Ga0070683_100376429
443 Ga0070690_100200471
444 Ga0070670_100042193
445 Ga0070670_100208213
446 Ga0070677_10086269
447 Ga0068869_100009364
448 Ga0068869_100031122
449 Ga0068869_100053980
450 Ga0070666_10014461
451 Ga0070666_10042741
452 Ga0070666_10083338
453 Ga0070666_10189151
454 Ga0070666_10208311
455 Ga0070680_100007029
456 Ga0070680_100521622
457 Ga0070682_100002037
458 Ga0070682_100069932
459 Ga0068868_100041008
460 Ga0068868_100484060
461 Ga0070660_100000709
462 Ga0070660_100214909
463 Ga0070689_100074734
464 Ga0070689_100321114
465 Ga0070691_10014719
466 Ga0070661_100001463
467 Ga0070661_100003861
468 Ga0070661_100182955
469 Ga0070668_100030905
470 Ga0070668_100033492
471 Ga0070669_100019533
472 Ga0070675_100114387
473 Ga0070675_100379879
474 Ga0070675_100428090
475 Ga0070671_100076258
476 Ga0070674_100020820
477 Ga0070674_100050165
478 Ga0070673_100063853
479 Ga0070673_100069030
480 Ga0070673_100305926
481 Ga0070673_100462806
482 Ga0070673_100493920
483 Ga0070688_100020853
484 Ga0070659_100008743
485 Ga0070659_100219559
486 Ga0070667_100043984
487 Ga0070667_100161313
488 Ga0070663_100282117
489 Ga0070678_100105094
490 Ga0070662_100108878
491 Ga0070662_100156513
492 Ga0070662_100165947
493 Ga0070681_10241087
494 Ga0068867_100054306
495 Ga0068867_100510321
496 Ga0070679_100068617
497 Ga0070684_100008384
498 Ga0070684_100129926
499 Ga0070684_100320149
500 Ga0068853_100022324
501 Ga0068853_100217623
502 Ga0068853_100299642
503 Ga0068853_100300510
504 Ga0070672_100045223
505 Ga0070672_100085527
506 Ga0070686_100168744
507 Ga0070693_100056096
508 Ga0070665_100051542
509 Ga0070665_100169204
510 Ga0070665_100271009
511 Ga0068855_100065680
512 Ga0068855_100088264
513 Ga0068855_100242383
514 Ga0068855_100501141
515 Ga0070664_100016825
516 Ga0070664_100201285
517 Ga0070664_100250328
518 Ga0068857_100001588
519 Ga0068857_100003611
520 Ga0068857_100015293
521 Ga0068857_100166542
522 Ga0068854_100016548
523 Ga0068854_100469322
524 Ga0068856_100009543
525 Ga0068856_100010871
526 Ga0068856_100019107
527 Ga0068852_100000410
528 Ga0068852_100581601
529 Ga0068852_100584017
530 Ga0068859_100016717
531 Ga0068859_100024370
532 Ga0068859_100024651
533 Ga0068859_100161511
534 Ga0068859_100241969
535 Ga0068859_100290897
536 Ga0068859_100524093
537 Ga0068864_100344134
538 Ga0068866_10040466
539 Ga0068861_100007343
540 Ga0068851_10040136
541 Ga0068870_10041734
542 Ga0068858_100252931
543 Ga0068858_100585079
544 Ga0068860_100004009
545 Ga0068860_100035569
546 Ga0068860_100056169
547 Ga0068862_100009417
548 Ga0068871_100004069
549 Ga0068871_100081485
550 Ga0075428_100007909
551 Ga0075428_100176033
552 Ga0075431_100070997
553 Ga0075433_10065847
554 Ga0075434_100149057
555 Ga0075434_100280855
556 Ga0075429_100022346
557 Ga0068865_100203257
558 Ga0068865_100325317
559 Ga0097620_100016719
560 Ga0097620_100024370
561 Ga0097620_100024651
562 Ga0097620_100161510
563 Ga0097620_100241979
564 Ga0097620_100290876
565 Ga0097620_100524155
566 Ga0105240_10001264
567 Ga0105240_10004678
568 Ga0105240_10005683
569 Ga0105240_10144907
570 Ga0105240_10589577
571 Ga0111539_10001995
572 Ga0111539_10039960
573 Ga0111539_10133188
574 Ga0114129_10007759
575 Ga0114129_10071276
576 Ga0114129_10187900
577 Ga0114129_10197701
578 Ga0105243_10166022
579 Ga0105241_10001366
580 Ga0105241_10020047
581 Ga0105241_10047008
582 Ga0105241_10114802
583 Ga0105241_10116138
584 Ga0105241_10218584
585 Ga0105241_10469063
586 Ga0105242_10100351
587 Ga0105242_10238996
588 Ga0105248_10165088
589 Ga0105237_10014557
590 Ga0105237_10027864
591 Ga0105237_10244325
592 Ga0105238_10011379
593 Ga0105238_10035408
594 Ga0105239_10003307
595 Ga0105239_10032134
596 Ga0105239_10108166
597 Ga0105246_10084970
598 Ga0157373_10034656
599 Ga0157371_10002844
600 Ga0157371_10004950
601 Ga0157371_10012767
602 Ga0157371_10067692
603 Ga0157371_10071117
604 Ga0157371_10122379
605 Ga0157370_10008630
606 Ga0157370_10020571
607 Ga0157369_10022096
608 Ga0157369_10025905
609 Ga0157369_10085498
610 Ga0157369_10088117
611 Ga0157369_10148890
612 Ga0157369_10349795
613 Ga0157374_10001327
614 Ga0157374_10066516
615 Ga0157374_10082063
616 Ga0157374_10094217
617 Ga0157374_10206058
618 Ga0157374_10371142
619 Ga0157378_10092524
620 Ga0157378_10127975
621 Ga0157378_10180136
622 Ga0157378_10195602
623 Ga0157378_10593394
624 Ga0163162_10000391
625 Ga0163162_10035743
626 Ga0163162_10127133
627 Ga0163162_10323646
628 Ga0157372_10000230
629 Ga0157372_10042971
630 Ga0157372_10138298
631 Ga0157372_10278170
632 Ga0157372_10315480
633 Ga0157372_10464701
634 Ga0157375_10016049
635 Ga0157375_10053244
636 Ga0157375_10063570
637 Ga0157375_10395903
638 Ga0157375_10430179
639 Ga0163163_10059837
640 Ga0163163_10779986
641 Ga0157380_10007608
642 Ga0157380_10532180
643 Ga0157377_10013421
644 Ga0157377_10060017
645 Ga0157379_10059646
646 Ga0157379_10140999
647 Ga0157376_10038566
648 Ga0157376_10112340
649 Ga0157376_10259168
650 Ga0207426_1000026
651 Ga0207682_10009901
652 Ga0207642_10062019
653 Ga0207688_10056404
654 Ga0207680_10020902
655 Ga0207680_10032469
656 Ga0207680_10059977
657 Ga0207680_10096150
658 Ga0207647_10026919
659 Ga0207647_10089645
660 Ga0207647_10093359
661 Ga0207645_10008724
662 Ga0207645_10019000
663 Ga0207643_10049045
664 Ga0207654_10003604
665 Ga0207654_10008598
666 Ga0207654_10121406
667 Ga0207707_10002309
668 Ga0207695_10000586
669 Ga0207695_10008355
670 Ga0207695_10025284
671 Ga0207695_10060329
672 Ga0207671_10348476
673 Ga0207657_10002023
674 Ga0207657_10017953
675 Ga0207657_10036684
676 Ga0207649_10027584
677 Ga0207649_10149782
678 Ga0207649_10194048
679 Ga0207649_10288062
680 Ga0207652_10001518
681 Ga0207694_10006765
682 Ga0207694_10147610
683 Ga0207650_10036656
684 Ga0207650_10054765
685 Ga0207650_10302351
686 Ga0207659_10062571
687 Ga0207659_10359516
688 Ga0207700_10545816
689 Ga0207644_10340427
690 Ga0207706_10118704
691 Ga0207706_10126064
692 Ga0207706_10196054
693 Ga0207686_10129775
694 Ga0207686_10461919
695 Ga0207709_10136371
696 Ga0207670_10010258
697 Ga0207670_10248746
698 Ga0207691_10021597
699 Ga0207691_10034018
700 Ga0207691_10057333
701 Ga0207689_10003113
702 Ga0207689_10025247
703 Ga0207689_10025491
704 Ga0207689_10029369
705 Ga0207689_10067755
706 Ga0207661_10023367
707 Ga0207661_10083486
708 Ga0207661_10495619
709 Ga0207679_10002262
710 Ga0207679_10006678
711 Ga0207679_10105616
712 Ga0207667_10000309
713 Ga0207667_10002687
714 Ga0207667_10047851
715 Ga0207667_10084744
716 Ga0207667_10344349
717 Ga0207668_10323370
718 Ga0207640_10080920
719 Ga0207640_10157426
720 Ga0207640_10158216
721 Ga0207640_10449129
722 Ga0207640_10587787
723 Ga0207658_10105992
724 Ga0207677_10062988
725 Ga0207639_10011585
726 Ga0207639_10025530
727 Ga0207639_10091132
728 Ga0207639_10277406
729 Ga0207639_10320740
730 Ga0207678_10078940
731 Ga0207702_10029233
732 Ga0207702_10071162
733 Ga0207641_10513280
734 Ga0207648_10011745
735 Ga0207648_10179274
736 Ga0207674_10001219
737 Ga0207674_10001797
738 Ga0207674_10017867
739 Ga0207674_10037790
740 Ga0207674_10427560
741 Ga0207675_100009509
742 Ga0207675_100438878
743 Ga0207683_10001534
744 Ga0207683_10179443
745 Ga0207698_10000848
746 Ga0207698_10129423
747 Ga0207698_10459802
748 Ga0268266_10098707
749 Ga0268264_10002281
750 Ga0268264_10114767
751 Ga0268264_10144838
752 Ga0268264_10209535
753 Ga0307515_10000091
754 Ga0265327_10000101
755 Ga0265327_10003651
756 Ga0265327_10014860
757 Ga0265327_10027004
758 Ga0265327_10030950
759 Ga0307513_10394910
760 Ga0307509_10078499
761 Ga0307516_10313998
762 Ga0307410_10075051
763 Ga0307412_10037016
764 Ga0307409_100040863
765 Ga0307416_100037438
766 Ga0307416_100190452
767 Ga0307414_10187581
768 Ga0316574_0078291
769 Ga0373935_0134958
770 Ga0373933_0091680
771 Ga0373947_0345248
772 Ga0373937_0019278
773 Ga0316584_0305179
774 Ga0395899_0002920
775 Ga0395900_0011692
776 Ga0395898_0004939
777 Ga0395901_0010792
778 Ga0451798_0138376
779 Ga0451577_0003069
780 Ga0451577_0013409
781 Ga0453684_0000841
782 Ga0453684_0001009
783 Ga0495592_0019105
784 Ga0495653_0056548
785 Ga0495650_0043054
786 Ga0495618_0048685
787 Ga0495628_0029405
788 Ga0495630_0006627
789 Ga0495643_0000248
790 Ga0495667_0052224
791 Ga0495670_0039529
792 Ga0495672_0117459
793 Ga0496102_0698045
794 Ga0496104_0688138
795 Ga0496105_0452209
796 Ga0501032_0066188
797 Ga0501033_0033223
798 Ga0501034_0006521
799 Ga0501034_0046766
800 Ga0501034_0242049
801 Ga0501036_0304011
802 Ga0501037_0006592
803 Ga0501037_0273164
804 Ga0501039_0201725
805 Ga0501040_0000014
806 Ga0501043_0003923
807 Ga0501043_0008195
808 Ga0501043_0203193
809 Ga0501046_0011148
810 Ga0501046_0209685
811 Ga0501047_0036390
812 Ga0501198_003444
813 Ga0501201_000452
814 Ga0501216_007019
815 Ga0501217_000040
816 Ga0501223_001738
817 Ga0501224_001731
818 Ga0501240_005245
819 Ga0501242_000489
820 Ga0501243_012390
821 Ga0501257_007115
822 Ga0501257_036327
823 Ga0501259_001926
824 Ga0501221_000060
825 Ga0501234_006463
826 Ga0501080_0047836
827 Ga0501080_0379416
828 Ga0501035_0012853
829 Ga0501035_0026463
830 Ga0501044_0016580
831 Ga0501044_0075395
832 nmdc:mga09592_33894_c1
833 nmdc:mga06r32_135919_c1
834 nmdc:mga08y16_150654_c1
835 nmdc:mga08y16_52117_c1
836 nmdc:mga0n895_16744_c1
837 nmdc:mga0a205_77567_c1
838 Ga0495619_0178357
839 Ga0500568_0010919
840 Ga0500616_0036197
841 Ga0500622_0001810
842 Ga0501084_0235700
843 2896089517
844 2910247867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

74

332

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wqo-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase-like protein 0.8521 3 292
3wqo-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase-like protein 0.8313 3 292
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8291 1 289
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8203 1 289
4ovx-assembly1.cif.gz_A crystal structure of xylose isomerase domain protein from planctomyces limnophilus dsm 3776 0.8086 2 293
ID Description Score Start End Superfamily
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8646 1 292 3.20.20.150
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8469 1 292 3.20.20.150
af_Q59009_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8182 3 287 3.20.20.150
4ovxA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8065 2 291 3.20.20.150
af_Q59009_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8035 3 287 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A249K8L9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9826 1 296 GO:0016853
AF-A0A249K8L9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9761 1 296 GO:0016853
AF-A0A831SYZ9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9709 12 296 GO:0016853
AF-A0A831SYZ9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9674 12 296 GO:0016853
AF-A0A7K0UVN3-F1-model_v4 TIM barrel protein 0.9636 1 153

Map