F440180

General Info

Members Datasets Scaffolds Average Seq Length
422 215 844 319

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10072576|Ga0070676_100725761
Length 336
Sequence MQAAIPLQHKSVLLDEAVDALVTRTDGVYVDGTFGRGGHARRLLERLSAEARLIAFDRDPEAIASASAGAEAIADPRFSIHHVTFGQMKATLAALGIERVDGVLLDLGVSSPQIDAAERGFSFRFDGPLDMRMDPTRGESAADFLERADERHIAEVIRDYGEERFAVQVAKALVARRQSGNPVRTTRQLSDVVAGAVKTREPGQDPATRTFQALRIFVNAELEELEQGLIAALEMLAPGGRLVVISFHSLEDRIVKTFIVRESRSTIDRRAPFAAAAPTRLRAIARVRAGETELRANPRARSAVMRVAERTDAPLGDVVPVPAATPRGRAARKGRG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
203 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
204 2738541297 Duganella sp. GV083 Isolate Unclassified
205 2738541357 Duganella sp. GV053 Isolate Unclassified
206 2738543003 Duganella sp. GV066 Isolate Unclassified
207 2738543026 Duganella sp. GV089 Isolate Unclassified
208 2738543029 Duganella sp. GV039 Isolate Unclassified
209 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
210 2821131069 Duganella sp. 1224 Isolate Unclassified
211 2857564685 Duganella sp. R-74599 Isolate Unclassified
212 2904424332 Duganella sp. 1411 Isolate Rhizosphere
213 2919476304 Duganella sp. 3397 Isolate Unclassified
214 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
215 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 0
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 0.95
Rhizoplane 2.37
Rhizosphere 84.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10072576 3300005328 Bacteria 2069
2 JGI24737J22298_10019895 3300001990 Bacteria 2146
3 JGI25154J39366_1001845 3300002738 Bacteria 6470
4 JGI25150J39212_1002592 3300002774 Bacteria 4446
5 JGI25159J45721_1005468 3300002987 Bacteria 3986
6 Ga0055526_1012868 3300003771 Bacteria 3599
7 Ga0055537_1000103 3300003773 Bacteria 63399
8 Ga0055524_1007297 3300003775 Bacteria 4718
9 Ga0055534_1000254 3300003784 Bacteria 37129
10 Ga0055528_1000031 3300003790 Bacteria 120960
11 Ga0055543_1017036 3300004625 Bacteria 1372
12 Ga0065165_1002165 3300005262 Bacteria 17754
13 Ga0070670_100016785 3300005331 Bacteria 6283
14 Ga0070682_100030015 3300005337 Bacteria 3278
15 Ga0070661_100185168 3300005344 Bacteria 1586
16 Ga0070668_100077415 3300005347 Bacteria 2600
17 Ga0070669_100019940 3300005353 Bacteria 4789
18 Ga0070673_100016007 3300005364 Bacteria 5287
19 Ga0070678_100009793 3300005456 Bacteria 5825
20 Ga0070662_100158668 3300005457 Bacteria 1768
21 Ga0068867_100130629 3300005459 Bacteria 1951
22 Ga0070672_100050542 3300005543 Bacteria 3238
23 Ga0068855_100150683 3300005563 Bacteria 2645
24 Ga0068864_100011258 3300005618 Bacteria 7391
25 Ga0068863_100156252 3300005841 Bacteria 2184
26 Ga0097621_100089197 3300006237 Bacteria 2578
27 Ga0075370_10058601 3300006353 Bacteria 2191
28 Ga0075370_10206387 3300006353 Bacteria 1160
29 Ga0068871_100019062 3300006358 Bacteria 5231
30 Ga0075430_100067062 3300006846 Bacteria 3013
31 Ga0075429_100003304 3300006880 Bacteria 13735
32 Ga0068865_100025669 3300006881 Bacteria 3878
33 Ga0079104_1005436 3300006946 Bacteria 5090
34 Ga0099826_10000006 3300006948 Bacteria 432260
35 Ga0157371_10000010 3300013102 Bacteria 384921
36 Ga0157374_10098827 3300013296 Bacteria 2795
37 Ga0157378_10152972 3300013297 Bacteria 2150
38 Ga0163162_10128918 3300013306 Bacteria 2637
39 Ga0182008_10030315 3300014497 Bacteria 2727
40 Ga0209436_111656 3300025208 Bacteria 1533
41 Ga0207425_1000370 3300025245 Bacteria 31022
42 Ga0209565_1000035 3300025263 Bacteria 298125
43 Ga0209565_1003933 3300025263 Bacteria 4654
44 Ga0209673_1000006 3300025273 Bacteria 650600
45 Ga0209130_1002565 3300025284 Bacteria 8862
46 Ga0209675_1000005 3300025291 Bacteria 849192
47 Ga0209025_1002336 3300025294 Bacteria 20474
48 Ga0209564_1000028 3300025295 Bacteria 510986
49 Ga0209564_1000032 3300025295 Bacteria 464041
50 Ga0209564_1000083 3300025295 Bacteria 259272
51 Ga0209758_1000343 3300025297 Bacteria 85198
52 Ga0209256_1000035 3300025299 Bacteria 386754
53 Ga0209256_1000141 3300025299 Bacteria 152280
54 Ga0207655_1024625 3300025728 Bacteria 2944
55 Ga0207682_10000367 3300025893 Bacteria 20767
56 Ga0207680_10255750 3300025903 Bacteria 1211
57 Ga0207643_10028426 3300025908 Bacteria 3105
58 Ga0207681_10012252 3300025923 Bacteria 5287
59 Ga0207650_10001551 3300025925 Bacteria 16459
60 Ga0207659_10007033 3300025926 Bacteria 6909
61 Ga0207690_10183417 3300025932 Bacteria 1578
62 Ga0207706_10254490 3300025933 Bacteria 1533
63 Ga0207704_10015222 3300025938 Bacteria 3913
64 Ga0207691_10002901 3300025940 Bacteria 16713
65 Ga0207651_10111338 3300025960 Bacteria 2056
66 Ga0207668_10126408 3300025972 Bacteria 1945
67 Ga0207658_10029945 3300025986 Bacteria 3850
68 Ga0207648_10010177 3300026089 Bacteria 8943
69 Ga0207676_10039256 3300026095 Bacteria 3620
70 Ga0207683_10008651 3300026121 Bacteria 8704
71 Ga0209282_1000003 3300027666 Bacteria 856377
72 Ga0307515_10006352 3300028794 Bacteria 23656
73 Ga0307515_10109171 3300028794 Bacteria 3252
74 Ga0307513_10005580 3300031456 Bacteria 16591
75 Ga0307408_100000932 3300031548 Bacteria 22811
76 Ga0307516_10001568 3300031730 Bacteria 31474
77 Ga0307413_10009589 3300031824 Bacteria 4643
78 Ga0307518_10002251 3300031838 Bacteria 14124
79 Ga0307410_10186760 3300031852 Bacteria 1573
80 Ga0307406_10085268 3300031901 Bacteria 2112
81 Ga0307412_10113021 3300031911 Bacteria 1942
82 Ga0307409_100016902 3300031995 Bacteria 4845
83 Ga0307416_100005698 3300032002 Bacteria 7700
84 Ga0395899_0000123 3300037312 Bacteria 123390
85 Ga0395899_0001071 3300037312 Bacteria 24692
86 Ga0395899_0012569 3300037312 Bacteria 6489
87 Ga0395900_0017331 3300037418 Bacteria 7353
88 Ga0395900_0122605 3300037418 Bacteria 2666
89 Ga0395900_0127404 3300037418 Bacteria 2610
90 Ga0395898_0012493 3300037466 Bacteria 8780
91 Ga0395898_0013532 3300037466 Bacteria 8400
92 Ga0395898_0059797 3300037466 Bacteria 3705
93 Ga0395905_0000088 3300037471 Bacteria 152506
94 Ga0395905_0000474 3300037471 Bacteria 55503
95 Ga0395905_0004424 3300037471 Bacteria 14604
96 Ga0395905_0009932 3300037471 Bacteria 9272
97 Ga0395905_0017952 3300037471 Bacteria 6718
98 Ga0395905_0026406 3300037471 Bacteria 5475
99 Ga0395905_0056634 3300037471 Bacteria 3666
100 Ga0395905_0174179 3300037471 Bacteria 2020
101 Ga0395901_0001676 3300038443 Bacteria 22857
102 Ga0395901_0004265 3300038443 Bacteria 14421
103 Ga0395901_0112345 3300038443 Bacteria 2861
104 Ga0395901_0162222 3300038443 Bacteria 2347
105 Ga0436361_1202762 3300039447 Bacteria 1069
106 Ga0436361_1216631 3300039447 Bacteria 3316
107 Ga0439439_0021014 3300041406 Bacteria 1624
108 Ga0439449_0003903 3300042007 Bacteria 5779
109 Ga0450911_000443 3300042115 Bacteria 13445
110 Ga0451577_0002356 3300042876 Bacteria 22717
111 Ga0466969_0004420 3300044656 Bacteria 7477
112 Ga0466969_0013796 3300044656 Bacteria 4254
113 Ga0466969_0112251 3300044656 Bacteria 1275
114 Ga0466972_0008068 3300044658 Bacteria 5277
115 Ga0466966_0005700 3300044684 Bacteria 8194
116 Ga0466961_0006843 3300044693 Bacteria 7254
117 Ga0466961_0052628 3300044693 Bacteria 2598
118 Ga0466961_0087510 3300044693 Bacteria 1968
119 Ga0453684_0601249 3300044712 Bacteria 1205
120 Ga0466968_0012482 3300044735 Bacteria 3327
121 Ga0466968_0042435 3300044735 Bacteria 1923
122 Ga0466970_0038704 3300044765 Bacteria 2530
123 Ga0466957_0055552 3300044842 Bacteria 2420
124 Ga0466957_0169325 3300044842 Bacteria 1422
125 Ga0466959_0000431 3300045049 Bacteria 24419
126 Ga0466958_0136257 3300045836 Bacteria 1544
127 Ga0495617_000011 3300046452 Bacteria 301936
128 Ga0495617_000014 3300046452 Bacteria 286979
129 Ga0495617_000515 3300046452 Bacteria 20231
130 Ga0495627_000763 3300046453 Bacteria 23901
131 Ga0495627_013383 3300046453 Bacteria 2886
132 Ga0495627_028534 3300046453 Bacteria 1782
133 Ga0495603_0045952 3300046455 Bacteria 2602
134 Ga0495590_0000106 3300046457 Bacteria 50464
135 Ga0495590_0002915 3300046457 Bacteria 7042
136 Ga0495591_001143 3300046458 Bacteria 17450
137 Ga0495591_013180 3300046458 Bacteria 3040
138 Ga0495638_0007268 3300046460 Bacteria 7962
139 Ga0495638_0068897 3300046460 Bacteria 2168
140 Ga0495653_0000014 3300046463 Bacteria 215253
141 Ga0495653_0014838 3300046463 Bacteria 6355
142 Ga0495650_0000133 3300046471 Bacteria 173878
143 Ga0495650_0000460 3300046471 Bacteria 63424
144 Ga0495650_0001265 3300046471 Bacteria 26082
145 Ga0495650_0002431 3300046471 Bacteria 15100
146 Ga0495580_0067352 3300046472 Bacteria 2505
147 Ga0495582_0049564 3300046473 Bacteria 2312
148 Ga0495605_0000010 3300046474 Bacteria 319487
149 Ga0495605_0000538 3300046474 Bacteria 31464
150 Ga0495605_0004090 3300046474 Bacteria 8605
151 Ga0495605_0042307 3300046474 Bacteria 2265
152 Ga0495605_0093333 3300046474 Bacteria 1392
153 Ga0495584_0000013 3300046491 Bacteria 185735
154 Ga0495584_0000883 3300046491 Bacteria 19287
155 Ga0495584_0001234 3300046491 Bacteria 15595
156 Ga0495584_0005207 3300046491 Bacteria 6901
157 Ga0495584_0005593 3300046491 Bacteria 6645
158 Ga0495584_0021106 3300046491 Bacteria 3307
159 Ga0495584_0022491 3300046491 Bacteria 3198
160 Ga0495584_0030869 3300046491 Bacteria 2713
161 Ga0495585_0000022 3300046492 Bacteria 153475
162 Ga0495585_0000113 3300046492 Bacteria 86842
163 Ga0495585_0001317 3300046492 Bacteria 19761
164 Ga0495585_0001386 3300046492 Bacteria 19160
165 Ga0495585_0005288 3300046492 Bacteria 8155
166 Ga0495585_0005593 3300046492 Bacteria 7897
167 Ga0495585_0015342 3300046492 Bacteria 4451
168 Ga0495585_0020731 3300046492 Bacteria 3778
169 Ga0495585_0024543 3300046492 Bacteria 3455
170 Ga0495585_0025677 3300046492 Bacteria 3370
171 Ga0495585_0086668 3300046492 Bacteria 1691
172 Ga0495585_0185679 3300046492 Bacteria 1066
173 Ga0495594_0007202 3300046499 Bacteria 5721
174 Ga0495594_0007344 3300046499 Bacteria 5669
175 Ga0495594_0016798 3300046499 Bacteria 3860
176 Ga0495596_0002530 3300046500 Bacteria 9789
177 Ga0495596_0004466 3300046500 Bacteria 6801
178 Ga0495596_0017174 3300046500 Bacteria 3000
179 Ga0495596_0046985 3300046500 Bacteria 1694
180 Ga0495607_0005885 3300046501 Bacteria 8708
181 Ga0495607_0027111 3300046501 Bacteria 3547
182 Ga0495607_0048542 3300046501 Bacteria 2481
183 Ga0495583_0000116 3300046506 Bacteria 135355
184 Ga0495583_0002025 3300046506 Bacteria 18447
185 Ga0495583_0005154 3300046506 Bacteria 8999
186 Ga0495583_0013886 3300046506 Bacteria 4465
187 Ga0495583_0015189 3300046506 Bacteria 4199
188 Ga0495583_0050082 3300046506 Bacteria 1910
189 Ga0495606_0000004 3300046507 Bacteria 406209
190 Ga0495606_0003214 3300046507 Bacteria 17599
191 Ga0495606_0005950 3300046507 Bacteria 11447
192 Ga0495606_0030375 3300046507 Bacteria 3776
193 Ga0495606_0042623 3300046507 Bacteria 3033
194 Ga0495606_0079171 3300046507 Bacteria 2047
195 Ga0495606_0146240 3300046507 Bacteria 1391
196 Ga0495610_0000007 3300046512 Bacteria 820919
197 Ga0495610_0001668 3300046512 Bacteria 19525
198 Ga0495610_0002052 3300046512 Bacteria 17212
199 Ga0495616_0000886 3300046513 Bacteria 21668
200 Ga0495616_0025694 3300046513 Bacteria 3143
201 Ga0495616_0040976 3300046513 Bacteria 2364
202 Ga0495616_0081754 3300046513 Bacteria 1544
203 Ga0495616_0102924 3300046513 Bacteria 1337
204 Ga0495630_0022294 3300046517 Bacteria 4678
205 Ga0495631_0003968 3300046518 Bacteria 7987
206 Ga0495631_0007913 3300046518 Bacteria 5381
207 Ga0495631_0008133 3300046518 Bacteria 5294
208 Ga0495631_0019802 3300046518 Bacteria 3151
209 Ga0495631_0020881 3300046518 Bacteria 3054
210 Ga0495631_0025490 3300046518 Bacteria 2722
211 Ga0495631_0038596 3300046518 Bacteria 2122
212 Ga0495631_0038710 3300046518 Bacteria 2118
213 Ga0495632_0001028 3300046519 Bacteria 24124
214 Ga0495632_0001647 3300046519 Bacteria 18288
215 Ga0495632_0004405 3300046519 Bacteria 9568
216 Ga0495632_0005126 3300046519 Bacteria 8750
217 Ga0495632_0016258 3300046519 Bacteria 4146
218 Ga0495637_0000028 3300046520 Bacteria 144203
219 Ga0495637_0000954 3300046520 Bacteria 18480
220 Ga0495643_0009906 3300046522 Bacteria 5892
221 Ga0495643_0011676 3300046522 Bacteria 5335
222 Ga0495643_0015141 3300046522 Bacteria 4568
223 Ga0495643_0142867 3300046522 Bacteria 1192
224 Ga0495644_0009409 3300046523 Bacteria 3768
225 Ga0495644_0011440 3300046523 Bacteria 3416
226 Ga0495644_0056768 3300046523 Bacteria 1471
227 Ga0495648_0000959 3300046524 Bacteria 29756
228 Ga0495648_0004787 3300046524 Bacteria 11444
229 Ga0495648_0036401 3300046524 Bacteria 3176
230 Ga0495648_0044106 3300046524 Bacteria 2786
231 Ga0495663_0005333 3300046525 Bacteria 3570
232 Ga0495663_0014289 3300046525 Bacteria 2225
233 Ga0495666_0002080 3300046526 Bacteria 9916
234 Ga0495642_0000192 3300046528 Bacteria 36285
235 Ga0495642_0003955 3300046528 Bacteria 5798
236 Ga0495642_0018663 3300046528 Bacteria 2715
237 Ga0495642_0028406 3300046528 Bacteria 2229
238 Ga0495642_0032129 3300046528 Bacteria 2105
239 Ga0495652_0074461 3300046529 Bacteria 2823
240 Ga0495654_0000034 3300046530 Bacteria 196519
241 Ga0495654_0003169 3300046530 Bacteria 10211
242 Ga0495654_0012335 3300046530 Bacteria 4592
243 Ga0495665_0005989 3300046531 Bacteria 6555
244 Ga0495665_0009022 3300046531 Bacteria 5410
245 Ga0495586_0010311 3300046535 Bacteria 4970
246 Ga0495586_0127039 3300046535 Bacteria 1426
247 Ga0495587_0019266 3300046536 Bacteria 4225
248 Ga0495609_0000637 3300046538 Bacteria 27304
249 Ga0495609_0002279 3300046538 Bacteria 11960
250 Ga0495609_0002824 3300046538 Bacteria 10402
251 Ga0495609_0006650 3300046538 Bacteria 5866
252 Ga0495609_0014267 3300046538 Bacteria 3740
253 Ga0495609_0039959 3300046538 Bacteria 2111
254 Ga0495597_0001005 3300046542 Bacteria 21608
255 Ga0495597_0001773 3300046542 Bacteria 14819
256 Ga0495597_0002013 3300046542 Bacteria 13612
257 Ga0495597_0006816 3300046542 Bacteria 5870
258 Ga0495622_0010066 3300046557 Bacteria 4374
259 Ga0495633_0004326 3300046558 Bacteria 9066
260 Ga0495633_0017113 3300046558 Bacteria 3716
261 Ga0495633_0028732 3300046558 Bacteria 2707
262 Ga0495633_0106368 3300046558 Bacteria 1301
263 Ga0495656_0014938 3300046615 Bacteria 2921
264 Ga0495668_0000136 3300046616 Bacteria 111262
265 Ga0495668_0000714 3300046616 Bacteria 40056
266 Ga0495668_0005984 3300046616 Bacteria 8080
267 Ga0495668_0007517 3300046616 Bacteria 6955
268 Ga0495668_0007992 3300046616 Bacteria 6666
269 Ga0495668_0014920 3300046616 Bacteria 4545
270 Ga0495668_0059635 3300046616 Bacteria 2106
271 Ga0495668_0064206 3300046616 Bacteria 2021
272 Ga0495611_0001165 3300046648 Bacteria 13719
273 Ga0495611_0013920 3300046648 Bacteria 3431
274 Ga0495611_0023729 3300046648 Bacteria 2664
275 Ga0495611_0036521 3300046648 Bacteria 2180
276 Ga0495611_0059696 3300046648 Bacteria 1731
277 Ga0495611_0105959 3300046648 Bacteria 1307
278 Ga0495625_0002385 3300046660 Bacteria 20412
279 Ga0495625_0007669 3300046660 Bacteria 9355
280 Ga0495625_0037177 3300046660 Bacteria 3574
281 Ga0495625_0052226 3300046660 Bacteria 2927
282 Ga0495625_0189511 3300046660 Bacteria 1363
283 Ga0495635_0010494 3300046663 Bacteria 6482
284 Ga0495659_0002583 3300046664 Bacteria 5838
285 Ga0495659_0016856 3300046664 Bacteria 2414
286 Ga0495661_0001306 3300046665 Bacteria 21236
287 Ga0495661_0002692 3300046665 Bacteria 13556
288 Ga0495661_0010535 3300046665 Bacteria 6304
289 Ga0495661_0019171 3300046665 Bacteria 4488
290 Ga0495588_0004738 3300046674 Bacteria 6015
291 Ga0495588_0039776 3300046674 Bacteria 2396
292 Ga0495588_0068708 3300046674 Bacteria 1840
293 Ga0495623_0019487 3300046679 Bacteria 4383
294 Ga0495623_0061685 3300046679 Bacteria 2351
295 Ga0495669_0000095 3300046684 Bacteria 57161
296 Ga0495669_0000478 3300046684 Bacteria 18569
297 Ga0495669_0000703 3300046684 Bacteria 14609
298 Ga0495669_0004123 3300046684 Bacteria 5977
299 Ga0495669_0008385 3300046684 Bacteria 4344
300 Ga0495670_0001130 3300046691 Bacteria 12953
301 Ga0495670_0001683 3300046691 Bacteria 10861
302 Ga0495670_0036491 3300046691 Bacteria 2449
303 Ga0495670_0037398 3300046691 Bacteria 2419
304 Ga0495671_0000033 3300046692 Bacteria 197509
305 Ga0495671_0000718 3300046692 Bacteria 23936
306 Ga0495671_0033317 3300046692 Bacteria 2625
307 Ga0495649_0000648 3300046694 Bacteria 28291
308 Ga0495649_0002264 3300046694 Bacteria 13677
309 Ga0495649_0009079 3300046694 Bacteria 5933
310 Ga0495649_0015540 3300046694 Bacteria 4330
311 Ga0495649_0101155 3300046694 Bacteria 1532
312 Ga0495589_0000266 3300046794 Bacteria 42658
313 Ga0495589_0005551 3300046794 Bacteria 6654
314 Ga0495589_0024185 3300046794 Bacteria 3088
315 Ga0495589_0045854 3300046794 Bacteria 2170
316 Ga0495589_0049353 3300046794 Bacteria 2082
317 Ga0495600_0024879 3300046809 Bacteria 3854
318 Ga0495600_0052979 3300046809 Bacteria 2650
319 Ga0495660_0015485 3300046810 Bacteria 4405
320 Ga0495581_0035442 3300047315 Bacteria 2887
321 Ga0495604_0052338 3300047317 Bacteria 3162
322 Ga0495604_0110456 3300047317 Bacteria 2005
323 Ga0495636_0004099 3300047318 Bacteria 5701
324 Ga0495636_0012298 3300047318 Bacteria 3388
325 Ga0495674_0049928 3300047319 Bacteria 3693
326 Ga0495672_0000227 3300047320 Bacteria 80295
327 Ga0495672_0001291 3300047320 Bacteria 24984
328 Ga0495672_0056716 3300047320 Bacteria 2277
329 Ga0495672_0086051 3300047320 Bacteria 1739
330 Ga0495676_0000135 3300047321 Bacteria 55966
331 Ga0495680_0002926 3300047322 Bacteria 17151
332 Ga0495680_0033905 3300047322 Bacteria 4130
333 Ga0495683_0000330 3300047323 Bacteria 39863
334 Ga0495683_0014558 3300047323 Bacteria 4098
335 Ga0495683_0093540 3300047323 Bacteria 1453
336 Ga0495687_000442 3300047443 Bacteria 51118
337 Ga0495687_001103 3300047443 Bacteria 26281
338 Ga0495687_006880 3300047443 Bacteria 6850
339 Ga0495687_012842 3300047443 Bacteria 4404
340 Ga0495687_035042 3300047443 Bacteria 2261
341 Ga0495675_0137876 3300047444 Bacteria 1513
342 Ga0495677_0000272 3300047445 Bacteria 22753
343 Ga0495677_0005109 3300047445 Bacteria 4997
344 Ga0495677_0013195 3300047445 Bacteria 3006
345 Ga0495677_0020891 3300047445 Bacteria 2373
346 Ga0495677_0021648 3300047445 Bacteria 2330
347 Ga0495679_008615 3300047446 Bacteria 4132
348 Ga0495685_002890 3300047447 Bacteria 5428
349 Ga0495685_006798 3300047447 Bacteria 3759
350 Ga0495685_009231 3300047447 Bacteria 3288
351 Ga0495673_0000031 3300047469 Bacteria 447868
352 Ga0495673_0000032 3300047469 Bacteria 375856
353 Ga0495673_0004425 3300047469 Bacteria 8794
354 Ga0495681_0001145 3300047470 Bacteria 20136
355 Ga0495681_0006452 3300047470 Bacteria 7708
356 Ga0495681_0010452 3300047470 Bacteria 5617
357 Ga0495681_0053132 3300047470 Bacteria 1898
358 Ga0495686_0000244 3300047472 Bacteria 98321
359 Ga0495686_0002300 3300047472 Bacteria 18278
360 Ga0495686_0003368 3300047472 Bacteria 13922
361 Ga0495686_0006443 3300047472 Bacteria 8986
362 Ga0495593_0011176 3300047673 Bacteria 5160
363 Ga0495593_0012494 3300047673 Bacteria 4853
364 Ga0495602_0017035 3300048088 Bacteria 7289
365 Ga0495614_0003589 3300048089 Bacteria 6950
366 Ga0495615_0001602 3300048090 Bacteria 3406
367 Ga0495626_0005653 3300048091 Bacteria 7240
368 Ga0495626_0010306 3300048091 Bacteria 4999
369 Ga0495626_0011422 3300048091 Bacteria 4698
370 Ga0495626_0013119 3300048091 Bacteria 4316
371 Ga0495626_0016652 3300048091 Bacteria 3729
372 Ga0496101_0022615 3300048904 Bacteria 4330
373 Ga0496102_0000877 3300048905 Bacteria 28674
374 Ga0496102_0006156 3300048905 Bacteria 10227
375 Ga0496103_0003638 3300048906 Bacteria 9384
376 Ga0496108_0201706 3300048911 Bacteria 1726
377 Ga0496109_0083747 3300048912 Bacteria 2941
378 Ga0496110_0001850 3300048913 Bacteria 15622
379 Ga0496110_0417730 3300048913 Bacteria 1223
380 Ga0496111_0022586 3300048914 Bacteria 4406
381 Ga0496114_0058187 3300048917 Bacteria 3227
382 Ga0496116_0008818 3300048919 Bacteria 8690
383 Ga0496119_0176694 3300048922 Bacteria 1123
384 Ga0496121_0016540 3300048924 Bacteria 7609
385 Ga0496121_0095199 3300048924 Bacteria 2315
386 Ga0496121_0114456 3300048924 Bacteria 2050
387 Ga0496122_0003500 3300048925 Bacteria 20624
388 Ga0496123_0001889 3300048926 Bacteria 27331
389 Ga0496123_0009431 3300048926 Bacteria 8792
390 Ga0496126_0011656 3300048929 Bacteria 9070
391 Ga0495678_001123 3300049459 Bacteria 22226
392 Ga0495678_001477 3300049459 Bacteria 18405
393 Ga0495678_001970 3300049459 Bacteria 14790
394 Ga0495678_029732 3300049459 Bacteria 2292
395 Ga0495682_0002764 3300049460 Bacteria 8126
396 Ga0495682_0012550 3300049460 Bacteria 3245
397 Ga0501043_0048017 3300049579 Bacteria 3356
398 Ga0501046_0011992 3300049580 Bacteria 7396
399 Ga0501047_0073170 3300049581 Bacteria 3299
400 Ga0501080_0056406 3300049742 Bacteria 3658
401 Ga0501035_0032351 3300049822 Bacteria 4759
402 Ga0501044_0027347 3300049823 Bacteria 6029
403 nmdc:mga03n38_39506_c1 3300050490 Bacteria 2046
404 nmdc:mga07m45_3812_c1 3300050496 Bacteria 7295
405 nmdc:mga09592_3703_c1 3300050508 Bacteria 12323
406 nmdc:mga0qj67_59853_c1 3300050509 Bacteria 3021
407 Ga0500618_000613 3300053125 Bacteria 21774
408 Ga0500645_008288 3300053730 Bacteria 3558
409 2515692375 2515154123 Bacteria 6387382
410 2644027185 2643221603 Bacteria 6147767
411 2738827684 2738541297 Bacteria 6549566
412 2739151480 2738541357 Bacteria 6549408
413 2739193400 2738543003 Bacteria 6549560
414 2739319876 2738543026 Bacteria 6549408
415 2739338117 2738543029 Bacteria 6549249
416 2809147244 2808606418 Bacteria 6724496
417 2821135950 2821131069 Bacteria 6108407
418 2857569313 2857564685 Bacteria 6290584
419 2904429470 2904424332 Bacteria 7633521
420 2919479299 2919476304 Bacteria 5888696
421 2932415263 2932410948 Bacteria 6312192
422 2932421089 2932416698 Bacteria 6315112
423 Ga0070676_10072576
424 JGI24737J22298_10019895
425 JGI25154J39366_1001845
426 JGI25150J39212_1002592
427 JGI25159J45721_1005468
428 Ga0055526_1012868
429 Ga0055537_1000103
430 Ga0055524_1007297
431 Ga0055534_1000254
432 Ga0055528_1000031
433 Ga0055543_1017036
434 Ga0065165_1002165
435 Ga0070670_100016785
436 Ga0070682_100030015
437 Ga0070661_100185168
438 Ga0070668_100077415
439 Ga0070669_100019940
440 Ga0070673_100016007
441 Ga0070678_100009793
442 Ga0070662_100158668
443 Ga0068867_100130629
444 Ga0070672_100050542
445 Ga0068855_100150683
446 Ga0068864_100011258
447 Ga0068863_100156252
448 Ga0097621_100089197
449 Ga0075370_10058601
450 Ga0075370_10206387
451 Ga0068871_100019062
452 Ga0075430_100067062
453 Ga0075429_100003304
454 Ga0068865_100025669
455 Ga0079104_1005436
456 Ga0099826_10000006
457 Ga0157371_10000010
458 Ga0157374_10098827
459 Ga0157378_10152972
460 Ga0163162_10128918
461 Ga0182008_10030315
462 Ga0209436_111656
463 Ga0207425_1000370
464 Ga0209565_1000035
465 Ga0209565_1003933
466 Ga0209673_1000006
467 Ga0209130_1002565
468 Ga0209675_1000005
469 Ga0209025_1002336
470 Ga0209564_1000028
471 Ga0209564_1000032
472 Ga0209564_1000083
473 Ga0209758_1000343
474 Ga0209256_1000035
475 Ga0209256_1000141
476 Ga0207655_1024625
477 Ga0207682_10000367
478 Ga0207680_10255750
479 Ga0207643_10028426
480 Ga0207681_10012252
481 Ga0207650_10001551
482 Ga0207659_10007033
483 Ga0207690_10183417
484 Ga0207706_10254490
485 Ga0207704_10015222
486 Ga0207691_10002901
487 Ga0207651_10111338
488 Ga0207668_10126408
489 Ga0207658_10029945
490 Ga0207648_10010177
491 Ga0207676_10039256
492 Ga0207683_10008651
493 Ga0209282_1000003
494 Ga0307515_10006352
495 Ga0307515_10109171
496 Ga0307513_10005580
497 Ga0307408_100000932
498 Ga0307516_10001568
499 Ga0307413_10009589
500 Ga0307518_10002251
501 Ga0307410_10186760
502 Ga0307406_10085268
503 Ga0307412_10113021
504 Ga0307409_100016902
505 Ga0307416_100005698
506 Ga0395899_0000123
507 Ga0395899_0001071
508 Ga0395899_0012569
509 Ga0395900_0017331
510 Ga0395900_0122605
511 Ga0395900_0127404
512 Ga0395898_0012493
513 Ga0395898_0013532
514 Ga0395898_0059797
515 Ga0395905_0000088
516 Ga0395905_0000474
517 Ga0395905_0004424
518 Ga0395905_0009932
519 Ga0395905_0017952
520 Ga0395905_0026406
521 Ga0395905_0056634
522 Ga0395905_0174179
523 Ga0395901_0001676
524 Ga0395901_0004265
525 Ga0395901_0112345
526 Ga0395901_0162222
527 Ga0436361_1202762
528 Ga0436361_1216631
529 Ga0439439_0021014
530 Ga0439449_0003903
531 Ga0450911_000443
532 Ga0451577_0002356
533 Ga0466969_0004420
534 Ga0466969_0013796
535 Ga0466969_0112251
536 Ga0466972_0008068
537 Ga0466966_0005700
538 Ga0466961_0006843
539 Ga0466961_0052628
540 Ga0466961_0087510
541 Ga0453684_0601249
542 Ga0466968_0012482
543 Ga0466968_0042435
544 Ga0466970_0038704
545 Ga0466957_0055552
546 Ga0466957_0169325
547 Ga0466959_0000431
548 Ga0466958_0136257
549 Ga0495617_000011
550 Ga0495617_000014
551 Ga0495617_000515
552 Ga0495627_000763
553 Ga0495627_013383
554 Ga0495627_028534
555 Ga0495603_0045952
556 Ga0495590_0000106
557 Ga0495590_0002915
558 Ga0495591_001143
559 Ga0495591_013180
560 Ga0495638_0007268
561 Ga0495638_0068897
562 Ga0495653_0000014
563 Ga0495653_0014838
564 Ga0495650_0000133
565 Ga0495650_0000460
566 Ga0495650_0001265
567 Ga0495650_0002431
568 Ga0495580_0067352
569 Ga0495582_0049564
570 Ga0495605_0000010
571 Ga0495605_0000538
572 Ga0495605_0004090
573 Ga0495605_0042307
574 Ga0495605_0093333
575 Ga0495584_0000013
576 Ga0495584_0000883
577 Ga0495584_0001234
578 Ga0495584_0005207
579 Ga0495584_0005593
580 Ga0495584_0021106
581 Ga0495584_0022491
582 Ga0495584_0030869
583 Ga0495585_0000022
584 Ga0495585_0000113
585 Ga0495585_0001317
586 Ga0495585_0001386
587 Ga0495585_0005288
588 Ga0495585_0005593
589 Ga0495585_0015342
590 Ga0495585_0020731
591 Ga0495585_0024543
592 Ga0495585_0025677
593 Ga0495585_0086668
594 Ga0495585_0185679
595 Ga0495594_0007202
596 Ga0495594_0007344
597 Ga0495594_0016798
598 Ga0495596_0002530
599 Ga0495596_0004466
600 Ga0495596_0017174
601 Ga0495596_0046985
602 Ga0495607_0005885
603 Ga0495607_0027111
604 Ga0495607_0048542
605 Ga0495583_0000116
606 Ga0495583_0002025
607 Ga0495583_0005154
608 Ga0495583_0013886
609 Ga0495583_0015189
610 Ga0495583_0050082
611 Ga0495606_0000004
612 Ga0495606_0003214
613 Ga0495606_0005950
614 Ga0495606_0030375
615 Ga0495606_0042623
616 Ga0495606_0079171
617 Ga0495606_0146240
618 Ga0495610_0000007
619 Ga0495610_0001668
620 Ga0495610_0002052
621 Ga0495616_0000886
622 Ga0495616_0025694
623 Ga0495616_0040976
624 Ga0495616_0081754
625 Ga0495616_0102924
626 Ga0495630_0022294
627 Ga0495631_0003968
628 Ga0495631_0007913
629 Ga0495631_0008133
630 Ga0495631_0019802
631 Ga0495631_0020881
632 Ga0495631_0025490
633 Ga0495631_0038596
634 Ga0495631_0038710
635 Ga0495632_0001028
636 Ga0495632_0001647
637 Ga0495632_0004405
638 Ga0495632_0005126
639 Ga0495632_0016258
640 Ga0495637_0000028
641 Ga0495637_0000954
642 Ga0495643_0009906
643 Ga0495643_0011676
644 Ga0495643_0015141
645 Ga0495643_0142867
646 Ga0495644_0009409
647 Ga0495644_0011440
648 Ga0495644_0056768
649 Ga0495648_0000959
650 Ga0495648_0004787
651 Ga0495648_0036401
652 Ga0495648_0044106
653 Ga0495663_0005333
654 Ga0495663_0014289
655 Ga0495666_0002080
656 Ga0495642_0000192
657 Ga0495642_0003955
658 Ga0495642_0018663
659 Ga0495642_0028406
660 Ga0495642_0032129
661 Ga0495652_0074461
662 Ga0495654_0000034
663 Ga0495654_0003169
664 Ga0495654_0012335
665 Ga0495665_0005989
666 Ga0495665_0009022
667 Ga0495586_0010311
668 Ga0495586_0127039
669 Ga0495587_0019266
670 Ga0495609_0000637
671 Ga0495609_0002279
672 Ga0495609_0002824
673 Ga0495609_0006650
674 Ga0495609_0014267
675 Ga0495609_0039959
676 Ga0495597_0001005
677 Ga0495597_0001773
678 Ga0495597_0002013
679 Ga0495597_0006816
680 Ga0495622_0010066
681 Ga0495633_0004326
682 Ga0495633_0017113
683 Ga0495633_0028732
684 Ga0495633_0106368
685 Ga0495656_0014938
686 Ga0495668_0000136
687 Ga0495668_0000714
688 Ga0495668_0005984
689 Ga0495668_0007517
690 Ga0495668_0007992
691 Ga0495668_0014920
692 Ga0495668_0059635
693 Ga0495668_0064206
694 Ga0495611_0001165
695 Ga0495611_0013920
696 Ga0495611_0023729
697 Ga0495611_0036521
698 Ga0495611_0059696
699 Ga0495611_0105959
700 Ga0495625_0002385
701 Ga0495625_0007669
702 Ga0495625_0037177
703 Ga0495625_0052226
704 Ga0495625_0189511
705 Ga0495635_0010494
706 Ga0495659_0002583
707 Ga0495659_0016856
708 Ga0495661_0001306
709 Ga0495661_0002692
710 Ga0495661_0010535
711 Ga0495661_0019171
712 Ga0495588_0004738
713 Ga0495588_0039776
714 Ga0495588_0068708
715 Ga0495623_0019487
716 Ga0495623_0061685
717 Ga0495669_0000095
718 Ga0495669_0000478
719 Ga0495669_0000703
720 Ga0495669_0004123
721 Ga0495669_0008385
722 Ga0495670_0001130
723 Ga0495670_0001683
724 Ga0495670_0036491
725 Ga0495670_0037398
726 Ga0495671_0000033
727 Ga0495671_0000718
728 Ga0495671_0033317
729 Ga0495649_0000648
730 Ga0495649_0002264
731 Ga0495649_0009079
732 Ga0495649_0015540
733 Ga0495649_0101155
734 Ga0495589_0000266
735 Ga0495589_0005551
736 Ga0495589_0024185
737 Ga0495589_0045854
738 Ga0495589_0049353
739 Ga0495600_0024879
740 Ga0495600_0052979
741 Ga0495660_0015485
742 Ga0495581_0035442
743 Ga0495604_0052338
744 Ga0495604_0110456
745 Ga0495636_0004099
746 Ga0495636_0012298
747 Ga0495674_0049928
748 Ga0495672_0000227
749 Ga0495672_0001291
750 Ga0495672_0056716
751 Ga0495672_0086051
752 Ga0495676_0000135
753 Ga0495680_0002926
754 Ga0495680_0033905
755 Ga0495683_0000330
756 Ga0495683_0014558
757 Ga0495683_0093540
758 Ga0495687_000442
759 Ga0495687_001103
760 Ga0495687_006880
761 Ga0495687_012842
762 Ga0495687_035042
763 Ga0495675_0137876
764 Ga0495677_0000272
765 Ga0495677_0005109
766 Ga0495677_0013195
767 Ga0495677_0020891
768 Ga0495677_0021648
769 Ga0495679_008615
770 Ga0495685_002890
771 Ga0495685_006798
772 Ga0495685_009231
773 Ga0495673_0000031
774 Ga0495673_0000032
775 Ga0495673_0004425
776 Ga0495681_0001145
777 Ga0495681_0006452
778 Ga0495681_0010452
779 Ga0495681_0053132
780 Ga0495686_0000244
781 Ga0495686_0002300
782 Ga0495686_0003368
783 Ga0495686_0006443
784 Ga0495593_0011176
785 Ga0495593_0012494
786 Ga0495602_0017035
787 Ga0495614_0003589
788 Ga0495615_0001602
789 Ga0495626_0005653
790 Ga0495626_0010306
791 Ga0495626_0011422
792 Ga0495626_0013119
793 Ga0495626_0016652
794 Ga0496101_0022615
795 Ga0496102_0000877
796 Ga0496102_0006156
797 Ga0496103_0003638
798 Ga0496108_0201706
799 Ga0496109_0083747
800 Ga0496110_0001850
801 Ga0496110_0417730
802 Ga0496111_0022586
803 Ga0496114_0058187
804 Ga0496116_0008818
805 Ga0496119_0176694
806 Ga0496121_0016540
807 Ga0496121_0095199
808 Ga0496121_0114456
809 Ga0496122_0003500
810 Ga0496123_0001889
811 Ga0496123_0009431
812 Ga0496126_0011656
813 Ga0495678_001123
814 Ga0495678_001477
815 Ga0495678_001970
816 Ga0495678_029732
817 Ga0495682_0002764
818 Ga0495682_0012550
819 Ga0501043_0048017
820 Ga0501046_0011992
821 Ga0501047_0073170
822 Ga0501080_0056406
823 Ga0501035_0032351
824 Ga0501044_0027347
825 nmdc:mga03n38_39506_c1
826 nmdc:mga07m45_3812_c1
827 nmdc:mga09592_3703_c1
828 nmdc:mga0qj67_59853_c1
829 Ga0500618_000613
830 Ga0500645_008288
831 2515692375
832 2644027185
833 2738827684
834 2739151480
835 2739193400
836 2739319876
837 2739338117
838 2809147244
839 2821135950
840 2857569313
841 2904429470
842 2919479299
843 2932415263
844 2932421089

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

6

311

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9584 11 316
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9518 11 316
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9446 13 317
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9413 13 317
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9222 11 315
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9734 116 220 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9543 115 220 1.10.150.170
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9515 13 317 3.40.50.150
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9485 13 317 3.40.50.150
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9447 116 220 1.10.150.170
ID Description Score Start End GO Terms
AF-A0A455V830-F1-model_v4 deleted 0.9847 17 177
AF-A0A2X1N3B5-F1-model_v4 S-adenosyl-methyltransferase MraW (EC 2.1.1.199) 0.9699 56 259 GO:0005737
GO:0070475
GO:0071424
AF-A0A3M1K6A7-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9664 11 260 GO:0005737
GO:0070475
GO:0071424
AF-A0A257X594-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9646 11 257 GO:0005737
GO:0070475
GO:0071424
AF-A0A5Q4FCA8-F1-model_v4 deleted 0.964 10 261

Map