F440180
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 422 | 215 | 844 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10072576|Ga0070676_100725761 |
| Length | 336 |
| Sequence | MQAAIPLQHKSVLLDEAVDALVTRTDGVYVDGTFGRGGHARRLLERLSAEARLIAFDRDPEAIASASAGAEAIADPRFSIHHVTFGQMKATLAALGIERVDGVLLDLGVSSPQIDAAERGFSFRFDGPLDMRMDPTRGESAADFLERADERHIAEVIRDYGEERFAVQVAKALVARRQSGNPVRTTRQLSDVVAGAVKTREPGQDPATRTFQALRIFVNAELEELEQGLIAALEMLAPGGRLVVISFHSLEDRIVKTFIVRESRSTIDRRAPFAAAAPTRLRAIARVRAGETELRANPRARSAVMRVAERTDAPLGDVVPVPAATPRGRAARKGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 39 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 41 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 47 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 67 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 68 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 69 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 70 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 71 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 72 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 73 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 74 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 77 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 78 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 79 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 82 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 83 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 84 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 85 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 86 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 87 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 88 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 89 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 90 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 91 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 92 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 93 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 94 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 95 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 96 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 97 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 98 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 183 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 202 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 203 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 204 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 205 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 206 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 207 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 208 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 209 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 210 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 211 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 212 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 213 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 214 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 215 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.68 |
| Metatranscriptomes | 0 |
| Isolates | 3.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.87 |
| Nodule | 0.95 |
| Rhizoplane | 2.37 |
| Rhizosphere | 84.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10072576 | 3300005328 | Bacteria | 2069 |
| 2 | JGI24737J22298_10019895 | 3300001990 | Bacteria | 2146 |
| 3 | JGI25154J39366_1001845 | 3300002738 | Bacteria | 6470 |
| 4 | JGI25150J39212_1002592 | 3300002774 | Bacteria | 4446 |
| 5 | JGI25159J45721_1005468 | 3300002987 | Bacteria | 3986 |
| 6 | Ga0055526_1012868 | 3300003771 | Bacteria | 3599 |
| 7 | Ga0055537_1000103 | 3300003773 | Bacteria | 63399 |
| 8 | Ga0055524_1007297 | 3300003775 | Bacteria | 4718 |
| 9 | Ga0055534_1000254 | 3300003784 | Bacteria | 37129 |
| 10 | Ga0055528_1000031 | 3300003790 | Bacteria | 120960 |
| 11 | Ga0055543_1017036 | 3300004625 | Bacteria | 1372 |
| 12 | Ga0065165_1002165 | 3300005262 | Bacteria | 17754 |
| 13 | Ga0070670_100016785 | 3300005331 | Bacteria | 6283 |
| 14 | Ga0070682_100030015 | 3300005337 | Bacteria | 3278 |
| 15 | Ga0070661_100185168 | 3300005344 | Bacteria | 1586 |
| 16 | Ga0070668_100077415 | 3300005347 | Bacteria | 2600 |
| 17 | Ga0070669_100019940 | 3300005353 | Bacteria | 4789 |
| 18 | Ga0070673_100016007 | 3300005364 | Bacteria | 5287 |
| 19 | Ga0070678_100009793 | 3300005456 | Bacteria | 5825 |
| 20 | Ga0070662_100158668 | 3300005457 | Bacteria | 1768 |
| 21 | Ga0068867_100130629 | 3300005459 | Bacteria | 1951 |
| 22 | Ga0070672_100050542 | 3300005543 | Bacteria | 3238 |
| 23 | Ga0068855_100150683 | 3300005563 | Bacteria | 2645 |
| 24 | Ga0068864_100011258 | 3300005618 | Bacteria | 7391 |
| 25 | Ga0068863_100156252 | 3300005841 | Bacteria | 2184 |
| 26 | Ga0097621_100089197 | 3300006237 | Bacteria | 2578 |
| 27 | Ga0075370_10058601 | 3300006353 | Bacteria | 2191 |
| 28 | Ga0075370_10206387 | 3300006353 | Bacteria | 1160 |
| 29 | Ga0068871_100019062 | 3300006358 | Bacteria | 5231 |
| 30 | Ga0075430_100067062 | 3300006846 | Bacteria | 3013 |
| 31 | Ga0075429_100003304 | 3300006880 | Bacteria | 13735 |
| 32 | Ga0068865_100025669 | 3300006881 | Bacteria | 3878 |
| 33 | Ga0079104_1005436 | 3300006946 | Bacteria | 5090 |
| 34 | Ga0099826_10000006 | 3300006948 | Bacteria | 432260 |
| 35 | Ga0157371_10000010 | 3300013102 | Bacteria | 384921 |
| 36 | Ga0157374_10098827 | 3300013296 | Bacteria | 2795 |
| 37 | Ga0157378_10152972 | 3300013297 | Bacteria | 2150 |
| 38 | Ga0163162_10128918 | 3300013306 | Bacteria | 2637 |
| 39 | Ga0182008_10030315 | 3300014497 | Bacteria | 2727 |
| 40 | Ga0209436_111656 | 3300025208 | Bacteria | 1533 |
| 41 | Ga0207425_1000370 | 3300025245 | Bacteria | 31022 |
| 42 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 43 | Ga0209565_1003933 | 3300025263 | Bacteria | 4654 |
| 44 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 45 | Ga0209130_1002565 | 3300025284 | Bacteria | 8862 |
| 46 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 47 | Ga0209025_1002336 | 3300025294 | Bacteria | 20474 |
| 48 | Ga0209564_1000028 | 3300025295 | Bacteria | 510986 |
| 49 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 50 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 51 | Ga0209758_1000343 | 3300025297 | Bacteria | 85198 |
| 52 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 53 | Ga0209256_1000141 | 3300025299 | Bacteria | 152280 |
| 54 | Ga0207655_1024625 | 3300025728 | Bacteria | 2944 |
| 55 | Ga0207682_10000367 | 3300025893 | Bacteria | 20767 |
| 56 | Ga0207680_10255750 | 3300025903 | Bacteria | 1211 |
| 57 | Ga0207643_10028426 | 3300025908 | Bacteria | 3105 |
| 58 | Ga0207681_10012252 | 3300025923 | Bacteria | 5287 |
| 59 | Ga0207650_10001551 | 3300025925 | Bacteria | 16459 |
| 60 | Ga0207659_10007033 | 3300025926 | Bacteria | 6909 |
| 61 | Ga0207690_10183417 | 3300025932 | Bacteria | 1578 |
| 62 | Ga0207706_10254490 | 3300025933 | Bacteria | 1533 |
| 63 | Ga0207704_10015222 | 3300025938 | Bacteria | 3913 |
| 64 | Ga0207691_10002901 | 3300025940 | Bacteria | 16713 |
| 65 | Ga0207651_10111338 | 3300025960 | Bacteria | 2056 |
| 66 | Ga0207668_10126408 | 3300025972 | Bacteria | 1945 |
| 67 | Ga0207658_10029945 | 3300025986 | Bacteria | 3850 |
| 68 | Ga0207648_10010177 | 3300026089 | Bacteria | 8943 |
| 69 | Ga0207676_10039256 | 3300026095 | Bacteria | 3620 |
| 70 | Ga0207683_10008651 | 3300026121 | Bacteria | 8704 |
| 71 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 72 | Ga0307515_10006352 | 3300028794 | Bacteria | 23656 |
| 73 | Ga0307515_10109171 | 3300028794 | Bacteria | 3252 |
| 74 | Ga0307513_10005580 | 3300031456 | Bacteria | 16591 |
| 75 | Ga0307408_100000932 | 3300031548 | Bacteria | 22811 |
| 76 | Ga0307516_10001568 | 3300031730 | Bacteria | 31474 |
| 77 | Ga0307413_10009589 | 3300031824 | Bacteria | 4643 |
| 78 | Ga0307518_10002251 | 3300031838 | Bacteria | 14124 |
| 79 | Ga0307410_10186760 | 3300031852 | Bacteria | 1573 |
| 80 | Ga0307406_10085268 | 3300031901 | Bacteria | 2112 |
| 81 | Ga0307412_10113021 | 3300031911 | Bacteria | 1942 |
| 82 | Ga0307409_100016902 | 3300031995 | Bacteria | 4845 |
| 83 | Ga0307416_100005698 | 3300032002 | Bacteria | 7700 |
| 84 | Ga0395899_0000123 | 3300037312 | Bacteria | 123390 |
| 85 | Ga0395899_0001071 | 3300037312 | Bacteria | 24692 |
| 86 | Ga0395899_0012569 | 3300037312 | Bacteria | 6489 |
| 87 | Ga0395900_0017331 | 3300037418 | Bacteria | 7353 |
| 88 | Ga0395900_0122605 | 3300037418 | Bacteria | 2666 |
| 89 | Ga0395900_0127404 | 3300037418 | Bacteria | 2610 |
| 90 | Ga0395898_0012493 | 3300037466 | Bacteria | 8780 |
| 91 | Ga0395898_0013532 | 3300037466 | Bacteria | 8400 |
| 92 | Ga0395898_0059797 | 3300037466 | Bacteria | 3705 |
| 93 | Ga0395905_0000088 | 3300037471 | Bacteria | 152506 |
| 94 | Ga0395905_0000474 | 3300037471 | Bacteria | 55503 |
| 95 | Ga0395905_0004424 | 3300037471 | Bacteria | 14604 |
| 96 | Ga0395905_0009932 | 3300037471 | Bacteria | 9272 |
| 97 | Ga0395905_0017952 | 3300037471 | Bacteria | 6718 |
| 98 | Ga0395905_0026406 | 3300037471 | Bacteria | 5475 |
| 99 | Ga0395905_0056634 | 3300037471 | Bacteria | 3666 |
| 100 | Ga0395905_0174179 | 3300037471 | Bacteria | 2020 |
| 101 | Ga0395901_0001676 | 3300038443 | Bacteria | 22857 |
| 102 | Ga0395901_0004265 | 3300038443 | Bacteria | 14421 |
| 103 | Ga0395901_0112345 | 3300038443 | Bacteria | 2861 |
| 104 | Ga0395901_0162222 | 3300038443 | Bacteria | 2347 |
| 105 | Ga0436361_1202762 | 3300039447 | Bacteria | 1069 |
| 106 | Ga0436361_1216631 | 3300039447 | Bacteria | 3316 |
| 107 | Ga0439439_0021014 | 3300041406 | Bacteria | 1624 |
| 108 | Ga0439449_0003903 | 3300042007 | Bacteria | 5779 |
| 109 | Ga0450911_000443 | 3300042115 | Bacteria | 13445 |
| 110 | Ga0451577_0002356 | 3300042876 | Bacteria | 22717 |
| 111 | Ga0466969_0004420 | 3300044656 | Bacteria | 7477 |
| 112 | Ga0466969_0013796 | 3300044656 | Bacteria | 4254 |
| 113 | Ga0466969_0112251 | 3300044656 | Bacteria | 1275 |
| 114 | Ga0466972_0008068 | 3300044658 | Bacteria | 5277 |
| 115 | Ga0466966_0005700 | 3300044684 | Bacteria | 8194 |
| 116 | Ga0466961_0006843 | 3300044693 | Bacteria | 7254 |
| 117 | Ga0466961_0052628 | 3300044693 | Bacteria | 2598 |
| 118 | Ga0466961_0087510 | 3300044693 | Bacteria | 1968 |
| 119 | Ga0453684_0601249 | 3300044712 | Bacteria | 1205 |
| 120 | Ga0466968_0012482 | 3300044735 | Bacteria | 3327 |
| 121 | Ga0466968_0042435 | 3300044735 | Bacteria | 1923 |
| 122 | Ga0466970_0038704 | 3300044765 | Bacteria | 2530 |
| 123 | Ga0466957_0055552 | 3300044842 | Bacteria | 2420 |
| 124 | Ga0466957_0169325 | 3300044842 | Bacteria | 1422 |
| 125 | Ga0466959_0000431 | 3300045049 | Bacteria | 24419 |
| 126 | Ga0466958_0136257 | 3300045836 | Bacteria | 1544 |
| 127 | Ga0495617_000011 | 3300046452 | Bacteria | 301936 |
| 128 | Ga0495617_000014 | 3300046452 | Bacteria | 286979 |
| 129 | Ga0495617_000515 | 3300046452 | Bacteria | 20231 |
| 130 | Ga0495627_000763 | 3300046453 | Bacteria | 23901 |
| 131 | Ga0495627_013383 | 3300046453 | Bacteria | 2886 |
| 132 | Ga0495627_028534 | 3300046453 | Bacteria | 1782 |
| 133 | Ga0495603_0045952 | 3300046455 | Bacteria | 2602 |
| 134 | Ga0495590_0000106 | 3300046457 | Bacteria | 50464 |
| 135 | Ga0495590_0002915 | 3300046457 | Bacteria | 7042 |
| 136 | Ga0495591_001143 | 3300046458 | Bacteria | 17450 |
| 137 | Ga0495591_013180 | 3300046458 | Bacteria | 3040 |
| 138 | Ga0495638_0007268 | 3300046460 | Bacteria | 7962 |
| 139 | Ga0495638_0068897 | 3300046460 | Bacteria | 2168 |
| 140 | Ga0495653_0000014 | 3300046463 | Bacteria | 215253 |
| 141 | Ga0495653_0014838 | 3300046463 | Bacteria | 6355 |
| 142 | Ga0495650_0000133 | 3300046471 | Bacteria | 173878 |
| 143 | Ga0495650_0000460 | 3300046471 | Bacteria | 63424 |
| 144 | Ga0495650_0001265 | 3300046471 | Bacteria | 26082 |
| 145 | Ga0495650_0002431 | 3300046471 | Bacteria | 15100 |
| 146 | Ga0495580_0067352 | 3300046472 | Bacteria | 2505 |
| 147 | Ga0495582_0049564 | 3300046473 | Bacteria | 2312 |
| 148 | Ga0495605_0000010 | 3300046474 | Bacteria | 319487 |
| 149 | Ga0495605_0000538 | 3300046474 | Bacteria | 31464 |
| 150 | Ga0495605_0004090 | 3300046474 | Bacteria | 8605 |
| 151 | Ga0495605_0042307 | 3300046474 | Bacteria | 2265 |
| 152 | Ga0495605_0093333 | 3300046474 | Bacteria | 1392 |
| 153 | Ga0495584_0000013 | 3300046491 | Bacteria | 185735 |
| 154 | Ga0495584_0000883 | 3300046491 | Bacteria | 19287 |
| 155 | Ga0495584_0001234 | 3300046491 | Bacteria | 15595 |
| 156 | Ga0495584_0005207 | 3300046491 | Bacteria | 6901 |
| 157 | Ga0495584_0005593 | 3300046491 | Bacteria | 6645 |
| 158 | Ga0495584_0021106 | 3300046491 | Bacteria | 3307 |
| 159 | Ga0495584_0022491 | 3300046491 | Bacteria | 3198 |
| 160 | Ga0495584_0030869 | 3300046491 | Bacteria | 2713 |
| 161 | Ga0495585_0000022 | 3300046492 | Bacteria | 153475 |
| 162 | Ga0495585_0000113 | 3300046492 | Bacteria | 86842 |
| 163 | Ga0495585_0001317 | 3300046492 | Bacteria | 19761 |
| 164 | Ga0495585_0001386 | 3300046492 | Bacteria | 19160 |
| 165 | Ga0495585_0005288 | 3300046492 | Bacteria | 8155 |
| 166 | Ga0495585_0005593 | 3300046492 | Bacteria | 7897 |
| 167 | Ga0495585_0015342 | 3300046492 | Bacteria | 4451 |
| 168 | Ga0495585_0020731 | 3300046492 | Bacteria | 3778 |
| 169 | Ga0495585_0024543 | 3300046492 | Bacteria | 3455 |
| 170 | Ga0495585_0025677 | 3300046492 | Bacteria | 3370 |
| 171 | Ga0495585_0086668 | 3300046492 | Bacteria | 1691 |
| 172 | Ga0495585_0185679 | 3300046492 | Bacteria | 1066 |
| 173 | Ga0495594_0007202 | 3300046499 | Bacteria | 5721 |
| 174 | Ga0495594_0007344 | 3300046499 | Bacteria | 5669 |
| 175 | Ga0495594_0016798 | 3300046499 | Bacteria | 3860 |
| 176 | Ga0495596_0002530 | 3300046500 | Bacteria | 9789 |
| 177 | Ga0495596_0004466 | 3300046500 | Bacteria | 6801 |
| 178 | Ga0495596_0017174 | 3300046500 | Bacteria | 3000 |
| 179 | Ga0495596_0046985 | 3300046500 | Bacteria | 1694 |
| 180 | Ga0495607_0005885 | 3300046501 | Bacteria | 8708 |
| 181 | Ga0495607_0027111 | 3300046501 | Bacteria | 3547 |
| 182 | Ga0495607_0048542 | 3300046501 | Bacteria | 2481 |
| 183 | Ga0495583_0000116 | 3300046506 | Bacteria | 135355 |
| 184 | Ga0495583_0002025 | 3300046506 | Bacteria | 18447 |
| 185 | Ga0495583_0005154 | 3300046506 | Bacteria | 8999 |
| 186 | Ga0495583_0013886 | 3300046506 | Bacteria | 4465 |
| 187 | Ga0495583_0015189 | 3300046506 | Bacteria | 4199 |
| 188 | Ga0495583_0050082 | 3300046506 | Bacteria | 1910 |
| 189 | Ga0495606_0000004 | 3300046507 | Bacteria | 406209 |
| 190 | Ga0495606_0003214 | 3300046507 | Bacteria | 17599 |
| 191 | Ga0495606_0005950 | 3300046507 | Bacteria | 11447 |
| 192 | Ga0495606_0030375 | 3300046507 | Bacteria | 3776 |
| 193 | Ga0495606_0042623 | 3300046507 | Bacteria | 3033 |
| 194 | Ga0495606_0079171 | 3300046507 | Bacteria | 2047 |
| 195 | Ga0495606_0146240 | 3300046507 | Bacteria | 1391 |
| 196 | Ga0495610_0000007 | 3300046512 | Bacteria | 820919 |
| 197 | Ga0495610_0001668 | 3300046512 | Bacteria | 19525 |
| 198 | Ga0495610_0002052 | 3300046512 | Bacteria | 17212 |
| 199 | Ga0495616_0000886 | 3300046513 | Bacteria | 21668 |
| 200 | Ga0495616_0025694 | 3300046513 | Bacteria | 3143 |
| 201 | Ga0495616_0040976 | 3300046513 | Bacteria | 2364 |
| 202 | Ga0495616_0081754 | 3300046513 | Bacteria | 1544 |
| 203 | Ga0495616_0102924 | 3300046513 | Bacteria | 1337 |
| 204 | Ga0495630_0022294 | 3300046517 | Bacteria | 4678 |
| 205 | Ga0495631_0003968 | 3300046518 | Bacteria | 7987 |
| 206 | Ga0495631_0007913 | 3300046518 | Bacteria | 5381 |
| 207 | Ga0495631_0008133 | 3300046518 | Bacteria | 5294 |
| 208 | Ga0495631_0019802 | 3300046518 | Bacteria | 3151 |
| 209 | Ga0495631_0020881 | 3300046518 | Bacteria | 3054 |
| 210 | Ga0495631_0025490 | 3300046518 | Bacteria | 2722 |
| 211 | Ga0495631_0038596 | 3300046518 | Bacteria | 2122 |
| 212 | Ga0495631_0038710 | 3300046518 | Bacteria | 2118 |
| 213 | Ga0495632_0001028 | 3300046519 | Bacteria | 24124 |
| 214 | Ga0495632_0001647 | 3300046519 | Bacteria | 18288 |
| 215 | Ga0495632_0004405 | 3300046519 | Bacteria | 9568 |
| 216 | Ga0495632_0005126 | 3300046519 | Bacteria | 8750 |
| 217 | Ga0495632_0016258 | 3300046519 | Bacteria | 4146 |
| 218 | Ga0495637_0000028 | 3300046520 | Bacteria | 144203 |
| 219 | Ga0495637_0000954 | 3300046520 | Bacteria | 18480 |
| 220 | Ga0495643_0009906 | 3300046522 | Bacteria | 5892 |
| 221 | Ga0495643_0011676 | 3300046522 | Bacteria | 5335 |
| 222 | Ga0495643_0015141 | 3300046522 | Bacteria | 4568 |
| 223 | Ga0495643_0142867 | 3300046522 | Bacteria | 1192 |
| 224 | Ga0495644_0009409 | 3300046523 | Bacteria | 3768 |
| 225 | Ga0495644_0011440 | 3300046523 | Bacteria | 3416 |
| 226 | Ga0495644_0056768 | 3300046523 | Bacteria | 1471 |
| 227 | Ga0495648_0000959 | 3300046524 | Bacteria | 29756 |
| 228 | Ga0495648_0004787 | 3300046524 | Bacteria | 11444 |
| 229 | Ga0495648_0036401 | 3300046524 | Bacteria | 3176 |
| 230 | Ga0495648_0044106 | 3300046524 | Bacteria | 2786 |
| 231 | Ga0495663_0005333 | 3300046525 | Bacteria | 3570 |
| 232 | Ga0495663_0014289 | 3300046525 | Bacteria | 2225 |
| 233 | Ga0495666_0002080 | 3300046526 | Bacteria | 9916 |
| 234 | Ga0495642_0000192 | 3300046528 | Bacteria | 36285 |
| 235 | Ga0495642_0003955 | 3300046528 | Bacteria | 5798 |
| 236 | Ga0495642_0018663 | 3300046528 | Bacteria | 2715 |
| 237 | Ga0495642_0028406 | 3300046528 | Bacteria | 2229 |
| 238 | Ga0495642_0032129 | 3300046528 | Bacteria | 2105 |
| 239 | Ga0495652_0074461 | 3300046529 | Bacteria | 2823 |
| 240 | Ga0495654_0000034 | 3300046530 | Bacteria | 196519 |
| 241 | Ga0495654_0003169 | 3300046530 | Bacteria | 10211 |
| 242 | Ga0495654_0012335 | 3300046530 | Bacteria | 4592 |
| 243 | Ga0495665_0005989 | 3300046531 | Bacteria | 6555 |
| 244 | Ga0495665_0009022 | 3300046531 | Bacteria | 5410 |
| 245 | Ga0495586_0010311 | 3300046535 | Bacteria | 4970 |
| 246 | Ga0495586_0127039 | 3300046535 | Bacteria | 1426 |
| 247 | Ga0495587_0019266 | 3300046536 | Bacteria | 4225 |
| 248 | Ga0495609_0000637 | 3300046538 | Bacteria | 27304 |
| 249 | Ga0495609_0002279 | 3300046538 | Bacteria | 11960 |
| 250 | Ga0495609_0002824 | 3300046538 | Bacteria | 10402 |
| 251 | Ga0495609_0006650 | 3300046538 | Bacteria | 5866 |
| 252 | Ga0495609_0014267 | 3300046538 | Bacteria | 3740 |
| 253 | Ga0495609_0039959 | 3300046538 | Bacteria | 2111 |
| 254 | Ga0495597_0001005 | 3300046542 | Bacteria | 21608 |
| 255 | Ga0495597_0001773 | 3300046542 | Bacteria | 14819 |
| 256 | Ga0495597_0002013 | 3300046542 | Bacteria | 13612 |
| 257 | Ga0495597_0006816 | 3300046542 | Bacteria | 5870 |
| 258 | Ga0495622_0010066 | 3300046557 | Bacteria | 4374 |
| 259 | Ga0495633_0004326 | 3300046558 | Bacteria | 9066 |
| 260 | Ga0495633_0017113 | 3300046558 | Bacteria | 3716 |
| 261 | Ga0495633_0028732 | 3300046558 | Bacteria | 2707 |
| 262 | Ga0495633_0106368 | 3300046558 | Bacteria | 1301 |
| 263 | Ga0495656_0014938 | 3300046615 | Bacteria | 2921 |
| 264 | Ga0495668_0000136 | 3300046616 | Bacteria | 111262 |
| 265 | Ga0495668_0000714 | 3300046616 | Bacteria | 40056 |
| 266 | Ga0495668_0005984 | 3300046616 | Bacteria | 8080 |
| 267 | Ga0495668_0007517 | 3300046616 | Bacteria | 6955 |
| 268 | Ga0495668_0007992 | 3300046616 | Bacteria | 6666 |
| 269 | Ga0495668_0014920 | 3300046616 | Bacteria | 4545 |
| 270 | Ga0495668_0059635 | 3300046616 | Bacteria | 2106 |
| 271 | Ga0495668_0064206 | 3300046616 | Bacteria | 2021 |
| 272 | Ga0495611_0001165 | 3300046648 | Bacteria | 13719 |
| 273 | Ga0495611_0013920 | 3300046648 | Bacteria | 3431 |
| 274 | Ga0495611_0023729 | 3300046648 | Bacteria | 2664 |
| 275 | Ga0495611_0036521 | 3300046648 | Bacteria | 2180 |
| 276 | Ga0495611_0059696 | 3300046648 | Bacteria | 1731 |
| 277 | Ga0495611_0105959 | 3300046648 | Bacteria | 1307 |
| 278 | Ga0495625_0002385 | 3300046660 | Bacteria | 20412 |
| 279 | Ga0495625_0007669 | 3300046660 | Bacteria | 9355 |
| 280 | Ga0495625_0037177 | 3300046660 | Bacteria | 3574 |
| 281 | Ga0495625_0052226 | 3300046660 | Bacteria | 2927 |
| 282 | Ga0495625_0189511 | 3300046660 | Bacteria | 1363 |
| 283 | Ga0495635_0010494 | 3300046663 | Bacteria | 6482 |
| 284 | Ga0495659_0002583 | 3300046664 | Bacteria | 5838 |
| 285 | Ga0495659_0016856 | 3300046664 | Bacteria | 2414 |
| 286 | Ga0495661_0001306 | 3300046665 | Bacteria | 21236 |
| 287 | Ga0495661_0002692 | 3300046665 | Bacteria | 13556 |
| 288 | Ga0495661_0010535 | 3300046665 | Bacteria | 6304 |
| 289 | Ga0495661_0019171 | 3300046665 | Bacteria | 4488 |
| 290 | Ga0495588_0004738 | 3300046674 | Bacteria | 6015 |
| 291 | Ga0495588_0039776 | 3300046674 | Bacteria | 2396 |
| 292 | Ga0495588_0068708 | 3300046674 | Bacteria | 1840 |
| 293 | Ga0495623_0019487 | 3300046679 | Bacteria | 4383 |
| 294 | Ga0495623_0061685 | 3300046679 | Bacteria | 2351 |
| 295 | Ga0495669_0000095 | 3300046684 | Bacteria | 57161 |
| 296 | Ga0495669_0000478 | 3300046684 | Bacteria | 18569 |
| 297 | Ga0495669_0000703 | 3300046684 | Bacteria | 14609 |
| 298 | Ga0495669_0004123 | 3300046684 | Bacteria | 5977 |
| 299 | Ga0495669_0008385 | 3300046684 | Bacteria | 4344 |
| 300 | Ga0495670_0001130 | 3300046691 | Bacteria | 12953 |
| 301 | Ga0495670_0001683 | 3300046691 | Bacteria | 10861 |
| 302 | Ga0495670_0036491 | 3300046691 | Bacteria | 2449 |
| 303 | Ga0495670_0037398 | 3300046691 | Bacteria | 2419 |
| 304 | Ga0495671_0000033 | 3300046692 | Bacteria | 197509 |
| 305 | Ga0495671_0000718 | 3300046692 | Bacteria | 23936 |
| 306 | Ga0495671_0033317 | 3300046692 | Bacteria | 2625 |
| 307 | Ga0495649_0000648 | 3300046694 | Bacteria | 28291 |
| 308 | Ga0495649_0002264 | 3300046694 | Bacteria | 13677 |
| 309 | Ga0495649_0009079 | 3300046694 | Bacteria | 5933 |
| 310 | Ga0495649_0015540 | 3300046694 | Bacteria | 4330 |
| 311 | Ga0495649_0101155 | 3300046694 | Bacteria | 1532 |
| 312 | Ga0495589_0000266 | 3300046794 | Bacteria | 42658 |
| 313 | Ga0495589_0005551 | 3300046794 | Bacteria | 6654 |
| 314 | Ga0495589_0024185 | 3300046794 | Bacteria | 3088 |
| 315 | Ga0495589_0045854 | 3300046794 | Bacteria | 2170 |
| 316 | Ga0495589_0049353 | 3300046794 | Bacteria | 2082 |
| 317 | Ga0495600_0024879 | 3300046809 | Bacteria | 3854 |
| 318 | Ga0495600_0052979 | 3300046809 | Bacteria | 2650 |
| 319 | Ga0495660_0015485 | 3300046810 | Bacteria | 4405 |
| 320 | Ga0495581_0035442 | 3300047315 | Bacteria | 2887 |
| 321 | Ga0495604_0052338 | 3300047317 | Bacteria | 3162 |
| 322 | Ga0495604_0110456 | 3300047317 | Bacteria | 2005 |
| 323 | Ga0495636_0004099 | 3300047318 | Bacteria | 5701 |
| 324 | Ga0495636_0012298 | 3300047318 | Bacteria | 3388 |
| 325 | Ga0495674_0049928 | 3300047319 | Bacteria | 3693 |
| 326 | Ga0495672_0000227 | 3300047320 | Bacteria | 80295 |
| 327 | Ga0495672_0001291 | 3300047320 | Bacteria | 24984 |
| 328 | Ga0495672_0056716 | 3300047320 | Bacteria | 2277 |
| 329 | Ga0495672_0086051 | 3300047320 | Bacteria | 1739 |
| 330 | Ga0495676_0000135 | 3300047321 | Bacteria | 55966 |
| 331 | Ga0495680_0002926 | 3300047322 | Bacteria | 17151 |
| 332 | Ga0495680_0033905 | 3300047322 | Bacteria | 4130 |
| 333 | Ga0495683_0000330 | 3300047323 | Bacteria | 39863 |
| 334 | Ga0495683_0014558 | 3300047323 | Bacteria | 4098 |
| 335 | Ga0495683_0093540 | 3300047323 | Bacteria | 1453 |
| 336 | Ga0495687_000442 | 3300047443 | Bacteria | 51118 |
| 337 | Ga0495687_001103 | 3300047443 | Bacteria | 26281 |
| 338 | Ga0495687_006880 | 3300047443 | Bacteria | 6850 |
| 339 | Ga0495687_012842 | 3300047443 | Bacteria | 4404 |
| 340 | Ga0495687_035042 | 3300047443 | Bacteria | 2261 |
| 341 | Ga0495675_0137876 | 3300047444 | Bacteria | 1513 |
| 342 | Ga0495677_0000272 | 3300047445 | Bacteria | 22753 |
| 343 | Ga0495677_0005109 | 3300047445 | Bacteria | 4997 |
| 344 | Ga0495677_0013195 | 3300047445 | Bacteria | 3006 |
| 345 | Ga0495677_0020891 | 3300047445 | Bacteria | 2373 |
| 346 | Ga0495677_0021648 | 3300047445 | Bacteria | 2330 |
| 347 | Ga0495679_008615 | 3300047446 | Bacteria | 4132 |
| 348 | Ga0495685_002890 | 3300047447 | Bacteria | 5428 |
| 349 | Ga0495685_006798 | 3300047447 | Bacteria | 3759 |
| 350 | Ga0495685_009231 | 3300047447 | Bacteria | 3288 |
| 351 | Ga0495673_0000031 | 3300047469 | Bacteria | 447868 |
| 352 | Ga0495673_0000032 | 3300047469 | Bacteria | 375856 |
| 353 | Ga0495673_0004425 | 3300047469 | Bacteria | 8794 |
| 354 | Ga0495681_0001145 | 3300047470 | Bacteria | 20136 |
| 355 | Ga0495681_0006452 | 3300047470 | Bacteria | 7708 |
| 356 | Ga0495681_0010452 | 3300047470 | Bacteria | 5617 |
| 357 | Ga0495681_0053132 | 3300047470 | Bacteria | 1898 |
| 358 | Ga0495686_0000244 | 3300047472 | Bacteria | 98321 |
| 359 | Ga0495686_0002300 | 3300047472 | Bacteria | 18278 |
| 360 | Ga0495686_0003368 | 3300047472 | Bacteria | 13922 |
| 361 | Ga0495686_0006443 | 3300047472 | Bacteria | 8986 |
| 362 | Ga0495593_0011176 | 3300047673 | Bacteria | 5160 |
| 363 | Ga0495593_0012494 | 3300047673 | Bacteria | 4853 |
| 364 | Ga0495602_0017035 | 3300048088 | Bacteria | 7289 |
| 365 | Ga0495614_0003589 | 3300048089 | Bacteria | 6950 |
| 366 | Ga0495615_0001602 | 3300048090 | Bacteria | 3406 |
| 367 | Ga0495626_0005653 | 3300048091 | Bacteria | 7240 |
| 368 | Ga0495626_0010306 | 3300048091 | Bacteria | 4999 |
| 369 | Ga0495626_0011422 | 3300048091 | Bacteria | 4698 |
| 370 | Ga0495626_0013119 | 3300048091 | Bacteria | 4316 |
| 371 | Ga0495626_0016652 | 3300048091 | Bacteria | 3729 |
| 372 | Ga0496101_0022615 | 3300048904 | Bacteria | 4330 |
| 373 | Ga0496102_0000877 | 3300048905 | Bacteria | 28674 |
| 374 | Ga0496102_0006156 | 3300048905 | Bacteria | 10227 |
| 375 | Ga0496103_0003638 | 3300048906 | Bacteria | 9384 |
| 376 | Ga0496108_0201706 | 3300048911 | Bacteria | 1726 |
| 377 | Ga0496109_0083747 | 3300048912 | Bacteria | 2941 |
| 378 | Ga0496110_0001850 | 3300048913 | Bacteria | 15622 |
| 379 | Ga0496110_0417730 | 3300048913 | Bacteria | 1223 |
| 380 | Ga0496111_0022586 | 3300048914 | Bacteria | 4406 |
| 381 | Ga0496114_0058187 | 3300048917 | Bacteria | 3227 |
| 382 | Ga0496116_0008818 | 3300048919 | Bacteria | 8690 |
| 383 | Ga0496119_0176694 | 3300048922 | Bacteria | 1123 |
| 384 | Ga0496121_0016540 | 3300048924 | Bacteria | 7609 |
| 385 | Ga0496121_0095199 | 3300048924 | Bacteria | 2315 |
| 386 | Ga0496121_0114456 | 3300048924 | Bacteria | 2050 |
| 387 | Ga0496122_0003500 | 3300048925 | Bacteria | 20624 |
| 388 | Ga0496123_0001889 | 3300048926 | Bacteria | 27331 |
| 389 | Ga0496123_0009431 | 3300048926 | Bacteria | 8792 |
| 390 | Ga0496126_0011656 | 3300048929 | Bacteria | 9070 |
| 391 | Ga0495678_001123 | 3300049459 | Bacteria | 22226 |
| 392 | Ga0495678_001477 | 3300049459 | Bacteria | 18405 |
| 393 | Ga0495678_001970 | 3300049459 | Bacteria | 14790 |
| 394 | Ga0495678_029732 | 3300049459 | Bacteria | 2292 |
| 395 | Ga0495682_0002764 | 3300049460 | Bacteria | 8126 |
| 396 | Ga0495682_0012550 | 3300049460 | Bacteria | 3245 |
| 397 | Ga0501043_0048017 | 3300049579 | Bacteria | 3356 |
| 398 | Ga0501046_0011992 | 3300049580 | Bacteria | 7396 |
| 399 | Ga0501047_0073170 | 3300049581 | Bacteria | 3299 |
| 400 | Ga0501080_0056406 | 3300049742 | Bacteria | 3658 |
| 401 | Ga0501035_0032351 | 3300049822 | Bacteria | 4759 |
| 402 | Ga0501044_0027347 | 3300049823 | Bacteria | 6029 |
| 403 | nmdc:mga03n38_39506_c1 | 3300050490 | Bacteria | 2046 |
| 404 | nmdc:mga07m45_3812_c1 | 3300050496 | Bacteria | 7295 |
| 405 | nmdc:mga09592_3703_c1 | 3300050508 | Bacteria | 12323 |
| 406 | nmdc:mga0qj67_59853_c1 | 3300050509 | Bacteria | 3021 |
| 407 | Ga0500618_000613 | 3300053125 | Bacteria | 21774 |
| 408 | Ga0500645_008288 | 3300053730 | Bacteria | 3558 |
| 409 | 2515692375 | 2515154123 | Bacteria | 6387382 |
| 410 | 2644027185 | 2643221603 | Bacteria | 6147767 |
| 411 | 2738827684 | 2738541297 | Bacteria | 6549566 |
| 412 | 2739151480 | 2738541357 | Bacteria | 6549408 |
| 413 | 2739193400 | 2738543003 | Bacteria | 6549560 |
| 414 | 2739319876 | 2738543026 | Bacteria | 6549408 |
| 415 | 2739338117 | 2738543029 | Bacteria | 6549249 |
| 416 | 2809147244 | 2808606418 | Bacteria | 6724496 |
| 417 | 2821135950 | 2821131069 | Bacteria | 6108407 |
| 418 | 2857569313 | 2857564685 | Bacteria | 6290584 |
| 419 | 2904429470 | 2904424332 | Bacteria | 7633521 |
| 420 | 2919479299 | 2919476304 | Bacteria | 5888696 |
| 421 | 2932415263 | 2932410948 | Bacteria | 6312192 |
| 422 | 2932421089 | 2932416698 | Bacteria | 6315112 |
| 423 | Ga0070676_10072576 | |||
| 424 | JGI24737J22298_10019895 | |||
| 425 | JGI25154J39366_1001845 | |||
| 426 | JGI25150J39212_1002592 | |||
| 427 | JGI25159J45721_1005468 | |||
| 428 | Ga0055526_1012868 | |||
| 429 | Ga0055537_1000103 | |||
| 430 | Ga0055524_1007297 | |||
| 431 | Ga0055534_1000254 | |||
| 432 | Ga0055528_1000031 | |||
| 433 | Ga0055543_1017036 | |||
| 434 | Ga0065165_1002165 | |||
| 435 | Ga0070670_100016785 | |||
| 436 | Ga0070682_100030015 | |||
| 437 | Ga0070661_100185168 | |||
| 438 | Ga0070668_100077415 | |||
| 439 | Ga0070669_100019940 | |||
| 440 | Ga0070673_100016007 | |||
| 441 | Ga0070678_100009793 | |||
| 442 | Ga0070662_100158668 | |||
| 443 | Ga0068867_100130629 | |||
| 444 | Ga0070672_100050542 | |||
| 445 | Ga0068855_100150683 | |||
| 446 | Ga0068864_100011258 | |||
| 447 | Ga0068863_100156252 | |||
| 448 | Ga0097621_100089197 | |||
| 449 | Ga0075370_10058601 | |||
| 450 | Ga0075370_10206387 | |||
| 451 | Ga0068871_100019062 | |||
| 452 | Ga0075430_100067062 | |||
| 453 | Ga0075429_100003304 | |||
| 454 | Ga0068865_100025669 | |||
| 455 | Ga0079104_1005436 | |||
| 456 | Ga0099826_10000006 | |||
| 457 | Ga0157371_10000010 | |||
| 458 | Ga0157374_10098827 | |||
| 459 | Ga0157378_10152972 | |||
| 460 | Ga0163162_10128918 | |||
| 461 | Ga0182008_10030315 | |||
| 462 | Ga0209436_111656 | |||
| 463 | Ga0207425_1000370 | |||
| 464 | Ga0209565_1000035 | |||
| 465 | Ga0209565_1003933 | |||
| 466 | Ga0209673_1000006 | |||
| 467 | Ga0209130_1002565 | |||
| 468 | Ga0209675_1000005 | |||
| 469 | Ga0209025_1002336 | |||
| 470 | Ga0209564_1000028 | |||
| 471 | Ga0209564_1000032 | |||
| 472 | Ga0209564_1000083 | |||
| 473 | Ga0209758_1000343 | |||
| 474 | Ga0209256_1000035 | |||
| 475 | Ga0209256_1000141 | |||
| 476 | Ga0207655_1024625 | |||
| 477 | Ga0207682_10000367 | |||
| 478 | Ga0207680_10255750 | |||
| 479 | Ga0207643_10028426 | |||
| 480 | Ga0207681_10012252 | |||
| 481 | Ga0207650_10001551 | |||
| 482 | Ga0207659_10007033 | |||
| 483 | Ga0207690_10183417 | |||
| 484 | Ga0207706_10254490 | |||
| 485 | Ga0207704_10015222 | |||
| 486 | Ga0207691_10002901 | |||
| 487 | Ga0207651_10111338 | |||
| 488 | Ga0207668_10126408 | |||
| 489 | Ga0207658_10029945 | |||
| 490 | Ga0207648_10010177 | |||
| 491 | Ga0207676_10039256 | |||
| 492 | Ga0207683_10008651 | |||
| 493 | Ga0209282_1000003 | |||
| 494 | Ga0307515_10006352 | |||
| 495 | Ga0307515_10109171 | |||
| 496 | Ga0307513_10005580 | |||
| 497 | Ga0307408_100000932 | |||
| 498 | Ga0307516_10001568 | |||
| 499 | Ga0307413_10009589 | |||
| 500 | Ga0307518_10002251 | |||
| 501 | Ga0307410_10186760 | |||
| 502 | Ga0307406_10085268 | |||
| 503 | Ga0307412_10113021 | |||
| 504 | Ga0307409_100016902 | |||
| 505 | Ga0307416_100005698 | |||
| 506 | Ga0395899_0000123 | |||
| 507 | Ga0395899_0001071 | |||
| 508 | Ga0395899_0012569 | |||
| 509 | Ga0395900_0017331 | |||
| 510 | Ga0395900_0122605 | |||
| 511 | Ga0395900_0127404 | |||
| 512 | Ga0395898_0012493 | |||
| 513 | Ga0395898_0013532 | |||
| 514 | Ga0395898_0059797 | |||
| 515 | Ga0395905_0000088 | |||
| 516 | Ga0395905_0000474 | |||
| 517 | Ga0395905_0004424 | |||
| 518 | Ga0395905_0009932 | |||
| 519 | Ga0395905_0017952 | |||
| 520 | Ga0395905_0026406 | |||
| 521 | Ga0395905_0056634 | |||
| 522 | Ga0395905_0174179 | |||
| 523 | Ga0395901_0001676 | |||
| 524 | Ga0395901_0004265 | |||
| 525 | Ga0395901_0112345 | |||
| 526 | Ga0395901_0162222 | |||
| 527 | Ga0436361_1202762 | |||
| 528 | Ga0436361_1216631 | |||
| 529 | Ga0439439_0021014 | |||
| 530 | Ga0439449_0003903 | |||
| 531 | Ga0450911_000443 | |||
| 532 | Ga0451577_0002356 | |||
| 533 | Ga0466969_0004420 | |||
| 534 | Ga0466969_0013796 | |||
| 535 | Ga0466969_0112251 | |||
| 536 | Ga0466972_0008068 | |||
| 537 | Ga0466966_0005700 | |||
| 538 | Ga0466961_0006843 | |||
| 539 | Ga0466961_0052628 | |||
| 540 | Ga0466961_0087510 | |||
| 541 | Ga0453684_0601249 | |||
| 542 | Ga0466968_0012482 | |||
| 543 | Ga0466968_0042435 | |||
| 544 | Ga0466970_0038704 | |||
| 545 | Ga0466957_0055552 | |||
| 546 | Ga0466957_0169325 | |||
| 547 | Ga0466959_0000431 | |||
| 548 | Ga0466958_0136257 | |||
| 549 | Ga0495617_000011 | |||
| 550 | Ga0495617_000014 | |||
| 551 | Ga0495617_000515 | |||
| 552 | Ga0495627_000763 | |||
| 553 | Ga0495627_013383 | |||
| 554 | Ga0495627_028534 | |||
| 555 | Ga0495603_0045952 | |||
| 556 | Ga0495590_0000106 | |||
| 557 | Ga0495590_0002915 | |||
| 558 | Ga0495591_001143 | |||
| 559 | Ga0495591_013180 | |||
| 560 | Ga0495638_0007268 | |||
| 561 | Ga0495638_0068897 | |||
| 562 | Ga0495653_0000014 | |||
| 563 | Ga0495653_0014838 | |||
| 564 | Ga0495650_0000133 | |||
| 565 | Ga0495650_0000460 | |||
| 566 | Ga0495650_0001265 | |||
| 567 | Ga0495650_0002431 | |||
| 568 | Ga0495580_0067352 | |||
| 569 | Ga0495582_0049564 | |||
| 570 | Ga0495605_0000010 | |||
| 571 | Ga0495605_0000538 | |||
| 572 | Ga0495605_0004090 | |||
| 573 | Ga0495605_0042307 | |||
| 574 | Ga0495605_0093333 | |||
| 575 | Ga0495584_0000013 | |||
| 576 | Ga0495584_0000883 | |||
| 577 | Ga0495584_0001234 | |||
| 578 | Ga0495584_0005207 | |||
| 579 | Ga0495584_0005593 | |||
| 580 | Ga0495584_0021106 | |||
| 581 | Ga0495584_0022491 | |||
| 582 | Ga0495584_0030869 | |||
| 583 | Ga0495585_0000022 | |||
| 584 | Ga0495585_0000113 | |||
| 585 | Ga0495585_0001317 | |||
| 586 | Ga0495585_0001386 | |||
| 587 | Ga0495585_0005288 | |||
| 588 | Ga0495585_0005593 | |||
| 589 | Ga0495585_0015342 | |||
| 590 | Ga0495585_0020731 | |||
| 591 | Ga0495585_0024543 | |||
| 592 | Ga0495585_0025677 | |||
| 593 | Ga0495585_0086668 | |||
| 594 | Ga0495585_0185679 | |||
| 595 | Ga0495594_0007202 | |||
| 596 | Ga0495594_0007344 | |||
| 597 | Ga0495594_0016798 | |||
| 598 | Ga0495596_0002530 | |||
| 599 | Ga0495596_0004466 | |||
| 600 | Ga0495596_0017174 | |||
| 601 | Ga0495596_0046985 | |||
| 602 | Ga0495607_0005885 | |||
| 603 | Ga0495607_0027111 | |||
| 604 | Ga0495607_0048542 | |||
| 605 | Ga0495583_0000116 | |||
| 606 | Ga0495583_0002025 | |||
| 607 | Ga0495583_0005154 | |||
| 608 | Ga0495583_0013886 | |||
| 609 | Ga0495583_0015189 | |||
| 610 | Ga0495583_0050082 | |||
| 611 | Ga0495606_0000004 | |||
| 612 | Ga0495606_0003214 | |||
| 613 | Ga0495606_0005950 | |||
| 614 | Ga0495606_0030375 | |||
| 615 | Ga0495606_0042623 | |||
| 616 | Ga0495606_0079171 | |||
| 617 | Ga0495606_0146240 | |||
| 618 | Ga0495610_0000007 | |||
| 619 | Ga0495610_0001668 | |||
| 620 | Ga0495610_0002052 | |||
| 621 | Ga0495616_0000886 | |||
| 622 | Ga0495616_0025694 | |||
| 623 | Ga0495616_0040976 | |||
| 624 | Ga0495616_0081754 | |||
| 625 | Ga0495616_0102924 | |||
| 626 | Ga0495630_0022294 | |||
| 627 | Ga0495631_0003968 | |||
| 628 | Ga0495631_0007913 | |||
| 629 | Ga0495631_0008133 | |||
| 630 | Ga0495631_0019802 | |||
| 631 | Ga0495631_0020881 | |||
| 632 | Ga0495631_0025490 | |||
| 633 | Ga0495631_0038596 | |||
| 634 | Ga0495631_0038710 | |||
| 635 | Ga0495632_0001028 | |||
| 636 | Ga0495632_0001647 | |||
| 637 | Ga0495632_0004405 | |||
| 638 | Ga0495632_0005126 | |||
| 639 | Ga0495632_0016258 | |||
| 640 | Ga0495637_0000028 | |||
| 641 | Ga0495637_0000954 | |||
| 642 | Ga0495643_0009906 | |||
| 643 | Ga0495643_0011676 | |||
| 644 | Ga0495643_0015141 | |||
| 645 | Ga0495643_0142867 | |||
| 646 | Ga0495644_0009409 | |||
| 647 | Ga0495644_0011440 | |||
| 648 | Ga0495644_0056768 | |||
| 649 | Ga0495648_0000959 | |||
| 650 | Ga0495648_0004787 | |||
| 651 | Ga0495648_0036401 | |||
| 652 | Ga0495648_0044106 | |||
| 653 | Ga0495663_0005333 | |||
| 654 | Ga0495663_0014289 | |||
| 655 | Ga0495666_0002080 | |||
| 656 | Ga0495642_0000192 | |||
| 657 | Ga0495642_0003955 | |||
| 658 | Ga0495642_0018663 | |||
| 659 | Ga0495642_0028406 | |||
| 660 | Ga0495642_0032129 | |||
| 661 | Ga0495652_0074461 | |||
| 662 | Ga0495654_0000034 | |||
| 663 | Ga0495654_0003169 | |||
| 664 | Ga0495654_0012335 | |||
| 665 | Ga0495665_0005989 | |||
| 666 | Ga0495665_0009022 | |||
| 667 | Ga0495586_0010311 | |||
| 668 | Ga0495586_0127039 | |||
| 669 | Ga0495587_0019266 | |||
| 670 | Ga0495609_0000637 | |||
| 671 | Ga0495609_0002279 | |||
| 672 | Ga0495609_0002824 | |||
| 673 | Ga0495609_0006650 | |||
| 674 | Ga0495609_0014267 | |||
| 675 | Ga0495609_0039959 | |||
| 676 | Ga0495597_0001005 | |||
| 677 | Ga0495597_0001773 | |||
| 678 | Ga0495597_0002013 | |||
| 679 | Ga0495597_0006816 | |||
| 680 | Ga0495622_0010066 | |||
| 681 | Ga0495633_0004326 | |||
| 682 | Ga0495633_0017113 | |||
| 683 | Ga0495633_0028732 | |||
| 684 | Ga0495633_0106368 | |||
| 685 | Ga0495656_0014938 | |||
| 686 | Ga0495668_0000136 | |||
| 687 | Ga0495668_0000714 | |||
| 688 | Ga0495668_0005984 | |||
| 689 | Ga0495668_0007517 | |||
| 690 | Ga0495668_0007992 | |||
| 691 | Ga0495668_0014920 | |||
| 692 | Ga0495668_0059635 | |||
| 693 | Ga0495668_0064206 | |||
| 694 | Ga0495611_0001165 | |||
| 695 | Ga0495611_0013920 | |||
| 696 | Ga0495611_0023729 | |||
| 697 | Ga0495611_0036521 | |||
| 698 | Ga0495611_0059696 | |||
| 699 | Ga0495611_0105959 | |||
| 700 | Ga0495625_0002385 | |||
| 701 | Ga0495625_0007669 | |||
| 702 | Ga0495625_0037177 | |||
| 703 | Ga0495625_0052226 | |||
| 704 | Ga0495625_0189511 | |||
| 705 | Ga0495635_0010494 | |||
| 706 | Ga0495659_0002583 | |||
| 707 | Ga0495659_0016856 | |||
| 708 | Ga0495661_0001306 | |||
| 709 | Ga0495661_0002692 | |||
| 710 | Ga0495661_0010535 | |||
| 711 | Ga0495661_0019171 | |||
| 712 | Ga0495588_0004738 | |||
| 713 | Ga0495588_0039776 | |||
| 714 | Ga0495588_0068708 | |||
| 715 | Ga0495623_0019487 | |||
| 716 | Ga0495623_0061685 | |||
| 717 | Ga0495669_0000095 | |||
| 718 | Ga0495669_0000478 | |||
| 719 | Ga0495669_0000703 | |||
| 720 | Ga0495669_0004123 | |||
| 721 | Ga0495669_0008385 | |||
| 722 | Ga0495670_0001130 | |||
| 723 | Ga0495670_0001683 | |||
| 724 | Ga0495670_0036491 | |||
| 725 | Ga0495670_0037398 | |||
| 726 | Ga0495671_0000033 | |||
| 727 | Ga0495671_0000718 | |||
| 728 | Ga0495671_0033317 | |||
| 729 | Ga0495649_0000648 | |||
| 730 | Ga0495649_0002264 | |||
| 731 | Ga0495649_0009079 | |||
| 732 | Ga0495649_0015540 | |||
| 733 | Ga0495649_0101155 | |||
| 734 | Ga0495589_0000266 | |||
| 735 | Ga0495589_0005551 | |||
| 736 | Ga0495589_0024185 | |||
| 737 | Ga0495589_0045854 | |||
| 738 | Ga0495589_0049353 | |||
| 739 | Ga0495600_0024879 | |||
| 740 | Ga0495600_0052979 | |||
| 741 | Ga0495660_0015485 | |||
| 742 | Ga0495581_0035442 | |||
| 743 | Ga0495604_0052338 | |||
| 744 | Ga0495604_0110456 | |||
| 745 | Ga0495636_0004099 | |||
| 746 | Ga0495636_0012298 | |||
| 747 | Ga0495674_0049928 | |||
| 748 | Ga0495672_0000227 | |||
| 749 | Ga0495672_0001291 | |||
| 750 | Ga0495672_0056716 | |||
| 751 | Ga0495672_0086051 | |||
| 752 | Ga0495676_0000135 | |||
| 753 | Ga0495680_0002926 | |||
| 754 | Ga0495680_0033905 | |||
| 755 | Ga0495683_0000330 | |||
| 756 | Ga0495683_0014558 | |||
| 757 | Ga0495683_0093540 | |||
| 758 | Ga0495687_000442 | |||
| 759 | Ga0495687_001103 | |||
| 760 | Ga0495687_006880 | |||
| 761 | Ga0495687_012842 | |||
| 762 | Ga0495687_035042 | |||
| 763 | Ga0495675_0137876 | |||
| 764 | Ga0495677_0000272 | |||
| 765 | Ga0495677_0005109 | |||
| 766 | Ga0495677_0013195 | |||
| 767 | Ga0495677_0020891 | |||
| 768 | Ga0495677_0021648 | |||
| 769 | Ga0495679_008615 | |||
| 770 | Ga0495685_002890 | |||
| 771 | Ga0495685_006798 | |||
| 772 | Ga0495685_009231 | |||
| 773 | Ga0495673_0000031 | |||
| 774 | Ga0495673_0000032 | |||
| 775 | Ga0495673_0004425 | |||
| 776 | Ga0495681_0001145 | |||
| 777 | Ga0495681_0006452 | |||
| 778 | Ga0495681_0010452 | |||
| 779 | Ga0495681_0053132 | |||
| 780 | Ga0495686_0000244 | |||
| 781 | Ga0495686_0002300 | |||
| 782 | Ga0495686_0003368 | |||
| 783 | Ga0495686_0006443 | |||
| 784 | Ga0495593_0011176 | |||
| 785 | Ga0495593_0012494 | |||
| 786 | Ga0495602_0017035 | |||
| 787 | Ga0495614_0003589 | |||
| 788 | Ga0495615_0001602 | |||
| 789 | Ga0495626_0005653 | |||
| 790 | Ga0495626_0010306 | |||
| 791 | Ga0495626_0011422 | |||
| 792 | Ga0495626_0013119 | |||
| 793 | Ga0495626_0016652 | |||
| 794 | Ga0496101_0022615 | |||
| 795 | Ga0496102_0000877 | |||
| 796 | Ga0496102_0006156 | |||
| 797 | Ga0496103_0003638 | |||
| 798 | Ga0496108_0201706 | |||
| 799 | Ga0496109_0083747 | |||
| 800 | Ga0496110_0001850 | |||
| 801 | Ga0496110_0417730 | |||
| 802 | Ga0496111_0022586 | |||
| 803 | Ga0496114_0058187 | |||
| 804 | Ga0496116_0008818 | |||
| 805 | Ga0496119_0176694 | |||
| 806 | Ga0496121_0016540 | |||
| 807 | Ga0496121_0095199 | |||
| 808 | Ga0496121_0114456 | |||
| 809 | Ga0496122_0003500 | |||
| 810 | Ga0496123_0001889 | |||
| 811 | Ga0496123_0009431 | |||
| 812 | Ga0496126_0011656 | |||
| 813 | Ga0495678_001123 | |||
| 814 | Ga0495678_001477 | |||
| 815 | Ga0495678_001970 | |||
| 816 | Ga0495678_029732 | |||
| 817 | Ga0495682_0002764 | |||
| 818 | Ga0495682_0012550 | |||
| 819 | Ga0501043_0048017 | |||
| 820 | Ga0501046_0011992 | |||
| 821 | Ga0501047_0073170 | |||
| 822 | Ga0501080_0056406 | |||
| 823 | Ga0501035_0032351 | |||
| 824 | Ga0501044_0027347 | |||
| 825 | nmdc:mga03n38_39506_c1 | |||
| 826 | nmdc:mga07m45_3812_c1 | |||
| 827 | nmdc:mga09592_3703_c1 | |||
| 828 | nmdc:mga0qj67_59853_c1 | |||
| 829 | Ga0500618_000613 | |||
| 830 | Ga0500645_008288 | |||
| 831 | 2515692375 | |||
| 832 | 2644027185 | |||
| 833 | 2738827684 | |||
| 834 | 2739151480 | |||
| 835 | 2739193400 | |||
| 836 | 2739319876 | |||
| 837 | 2739338117 | |||
| 838 | 2809147244 | |||
| 839 | 2821135950 | |||
| 840 | 2857569313 | |||
| 841 | 2904429470 | |||
| 842 | 2919479299 | |||
| 843 | 2932415263 | |||
| 844 | 2932421089 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9584 | 11 | 316 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9518 | 11 | 316 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9446 | 13 | 317 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9413 | 13 | 317 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9222 | 11 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9734 | 116 | 220 | 1.10.150.170 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9543 | 115 | 220 | 1.10.150.170 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9515 | 13 | 317 | 3.40.50.150 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9485 | 13 | 317 | 3.40.50.150 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9447 | 116 | 220 | 1.10.150.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455V830-F1-model_v4 | deleted | 0.9847 | 17 | 177 |
|
| AF-A0A2X1N3B5-F1-model_v4 | S-adenosyl-methyltransferase MraW (EC 2.1.1.199) | 0.9699 | 56 | 259 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A3M1K6A7-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH | 0.9664 | 11 | 260 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A257X594-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.9646 | 11 | 257 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A5Q4FCA8-F1-model_v4 | deleted | 0.964 | 10 | 261 |
|