metagRoot

F440137

General Info

Members	Datasets	Scaffolds	Average Seq Length
421	255	387	271

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2675902999\|2676201423
Length	319
Sequence	SRRPGATPPDPATPATPAIPAIPAIPAGPVTSAGPVTPPGPSGSPAPLTVVPVDDPADPRVTDYVALTDVTLRRLREPAEGMFIAEGERVIRRALGAGYQPRSVLVSPARLGAVPAEIGPDVPVYLAGPEVLAEITGFEVHRGALAAMARHPARDAAELLSWALRVLVLEDLVSHTNLGAVFRSAAGLGMDAVLLSPRCADPLYRRSVRVSMGEVFAVPYARLDPWPASLATLTERGFELLALTPAADATDLSALRLAPDARVAVLLGTEGEGLSAAAQAAASHRIRIPMAAGVDSLNVAATAAITCYALGRRPSPPTG

Samples

	Sample ID	Description	Type	Environment
1	2508501039	Frankia saprophytica CN3	Isolate	Nodule
2	2517572101	Frankia sp. DC12	Isolate	Nodule
3	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
4	2643221619	Agromyces sp. Root81	Isolate	Unclassified
5	2643221692	Nocardia sp. Root136	Isolate	Unclassified
6	2643221697	Aeromicrobium sp. Root495	Isolate	Unclassified
7	2643221961	Aeromicrobium sp. Root236	Isolate	Unclassified
8	2643221962	Aeromicrobium sp. Root344	Isolate	Unclassified
9	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
10	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
11	2739367653	Kocuria sp. OV113	Isolate	Unclassified
12	2773857762	Nocardioides sp. SAI-095	Isolate	Unclassified
13	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
14	2802429296	Streptomyces sampsonii KJ40	Isolate	Rhizosphere
15	2808606372	Agromyces sp. 23-23	Isolate	Unclassified
16	2808606439	Nocardioides sp. SLBN-172	Isolate	Unclassified
17	2811994878	Nocardioides sp. SLBN-169	Isolate	Unclassified
18	2816332305	Kocuria rhizophila FDAARGOS_302	Isolate	Rhizosphere
19	2842888712	Tsukamurella sp. R-71941	Isolate	Unclassified
20	2855683550	Micromonospora sp. RP3T	Isolate	Unclassified
21	2857727296	Kocuria sp. R-72562	Isolate	Unclassified
22	2867369537	Streptomyces sp. Z26	Isolate	Unclassified
23	2883821847	Microlunatus elymi KUDC0627	Isolate	Rhizosphere
24	2887478801	Catellatospora paridis NEAU-CL2	Isolate	Rhizosphere
25	2891968417	Nocardioides luteus SAI-037	Isolate	Unclassified
26	2909042592	Labrys sp. LIt4	Isolate	Nodule
27	2912757875	Streptomyces sp. S4.7	Isolate	Rhizosphere
28	2919443155	Agromyces sp. 3263	Isolate	Rhizosphere
29	3006486233	Streptomyces sp. BR123	Isolate	Rhizosphere
30	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
31	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
32	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
33	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
34	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
37	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
41	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
42	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
43	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
44	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
45	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
46	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
47	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
48	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
49	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
50	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
55	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
61	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
62	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
67	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
68	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
69	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
70	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
71	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
82	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
90	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
91	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
92	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
99	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
100	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
129	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
130	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
133	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
134	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
135	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
136	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
137	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
138	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
139	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
140	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
141	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
142	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
143	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
144	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
145	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
146	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
147	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
148	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
149	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
150	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
151	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
152	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
153	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
154	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
155	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
156	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
157	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
158	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
159	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
160	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
161	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
162	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
163	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
164	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
165	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
166	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
167	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
168	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
169	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
170	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
171	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
172	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
173	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
174	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
175	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
176	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
177	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
178	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
179	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
180	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
181	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
182	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
183	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
184	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
185	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
186	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
187	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
188	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
189	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
190	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
191	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
192	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
193	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
194	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
195	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
196	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
197	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
198	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
199	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
200	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
201	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
202	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
203	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
204	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
205	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
206	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
207	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
227	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
238	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
239	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
240	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
241	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
242	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
243	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
244	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
245	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
246	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
247	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
248	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
249	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
250	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
251	8002775197	Frankia nepalensis CN7	Isolate	Nodule
252	8002784119	Frankia sp. AgB1.9	Isolate	Nodule
253	8025413630	Streptomyces sp. CAI-17	Isolate	Rhizosphere
254	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
255	8055157932	Frankia umida Ag45/Mut15	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	91.69
Metatranscriptomes	0.24
Isolates	8.08

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.28
Nodule	2.14
Rhizoplane	6.65
Rhizosphere	76.48
Stem	0
Stem Tuber	0
Unclassified	10.45

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH2_10139239	3300003320	Bacteria	1033
2	Ga0070658_10017210	3300005327	Bacteria	5785
3	Ga0070658_10052884	3300005327	Bacteria	3295
4	Ga0070658_10130378	3300005327	Bacteria	2095
5	Ga0070658_10237991	3300005327	Bacteria	1542
6	Ga0070658_10241004	3300005327	Bacteria	1533
7	Ga0070683_100019433	3300005329	Bacteria	6034
8	Ga0068869_100347033	3300005334	Bacteria	1209
9	Ga0070680_100047920	3300005336	Bacteria	3481
10	Ga0070680_100097440	3300005336	Bacteria	2438
11	Ga0070680_100134326	3300005336	Bacteria	2071
12	Ga0070680_100693268	3300005336	Bacteria	876
13	Ga0070682_100003020	3300005337	Bacteria	9340
14	Ga0070691_10020055	3300005341	Bacteria	3086
15	Ga0070692_10001392	3300005345	Bacteria	8752
16	Ga0070659_100009593	3300005366	Bacteria	7115
17	Ga0070659_100198979	3300005366	Bacteria	1649
18	Ga0070667_100009867	3300005367	Bacteria	7916
19	Ga0070714_100071055	3300005435	Bacteria	3009
20	Ga0070701_10001815	3300005438	Bacteria	8065
21	Ga0070700_100004347	3300005441	Bacteria	7395
22	Ga0070663_100229336	3300005455	Bacteria	1462
23	Ga0070678_100118762	3300005456	Bacteria	2082
24	Ga0070681_10051930	3300005458	Bacteria	4089
25	Ga0070681_10061260	3300005458	Bacteria	3738
26	Ga0068867_100032739	3300005459	Bacteria	3761
27	Ga0070679_100015768	3300005530	Bacteria	7269
28	Ga0070679_100230890	3300005530	Bacteria	1810
29	Ga0070684_100101615	3300005535	Bacteria	2569
30	Ga0068853_100194153	3300005539	Bacteria	1845
31	Ga0068853_100355808	3300005539	Bacteria	1363
32	Ga0070672_100014089	3300005543	Bacteria	5658
33	Ga0070672_100539307	3300005543	Bacteria	1012
34	Ga0070665_100000290	3300005548	Bacteria	79561
35	Ga0068855_100008392	3300005563	Bacteria	12493
36	Ga0068855_100012814	3300005563	Bacteria	10117
37	Ga0068855_100046986	3300005563	Bacteria	5102
38	Ga0068857_100226399	3300005577	Bacteria	1709
39	Ga0068856_100013153	3300005614	Bacteria	8016
40	Ga0070702_100037276	3300005615	Bacteria	2700
41	Ga0068852_100026197	3300005616	Bacteria	4735
42	Ga0068859_100000039	3300005617	Bacteria	164260
43	Ga0068859_100049868	3300005617	Bacteria	4205
44	Ga0068859_100332251	3300005617	Bacteria	1614
45	Ga0068861_100009670	3300005719	Bacteria	6661
46	Ga0068861_100234415	3300005719	Bacteria	1558
47	Ga0068851_10065018	3300005834	Bacteria	1876
48	Ga0068870_10038759	3300005840	Bacteria	2463
49	Ga0068870_10131744	3300005840	Bacteria	1453
50	Ga0068863_100005493	3300005841	Bacteria	12476
51	Ga0068858_100000028	3300005842	Bacteria	144961
52	Ga0068858_100011868	3300005842	Bacteria	8211
53	Ga0068862_100000206	3300005844	Bacteria	65557
54	Ga0081455_10378063	3300005937	Bacteria	990
55	Ga0081539_10000348	3300005985	Bacteria	101459
56	Ga0081539_10007285	3300005985	Bacteria	10154
57	Ga0081539_10039520	3300005985	Bacteria	2782
58	Ga0075365_10009740	3300006038	Bacteria	5548
59	Ga0075365_10045040	3300006038	Bacteria	2893
60	Ga0075365_10177203	3300006038	Bacteria	1490
61	Ga0075368_10004089	3300006042	Bacteria	4909
62	Ga0075363_100006491	3300006048	Bacteria	5318
63	Ga0075364_10004452	3300006051	Bacteria	8062
64	Ga0075364_10053247	3300006051	Bacteria	2646
65	Ga0075364_10106603	3300006051	Bacteria	1867
66	Ga0075432_10016029	3300006058	Bacteria	2559
67	Ga0075370_10019099	3300006353	Bacteria	3727
68	Ga0075428_100004494	3300006844	Bacteria	15400
69	Ga0075428_100170169	3300006844	Bacteria	2362
70	Ga0075428_100217996	3300006844	Bacteria	2061
71	Ga0075430_100001615	3300006846	Bacteria	18409
72	Ga0075431_100003762	3300006847	Bacteria	14750
73	Ga0075431_100015658	3300006847	Bacteria	7687
74	Ga0075431_100223175	3300006847	Bacteria	1922
75	Ga0075429_100053802	3300006880	Bacteria	3502
76	Ga0068865_100004316	3300006881	Bacteria	8582
77	Ga0068865_100043884	3300006881	Bacteria	3057
78	Ga0097620_100000039	3300006931	Bacteria	164260
79	Ga0097620_100049868	3300006931	Bacteria	4205
80	Ga0097620_100332277	3300006931	Bacteria	1614
81	Ga0105244_10055157	3300009036	Bacteria	2014
82	Ga0105240_10001751	3300009093	Bacteria	36661
83	Ga0105240_10044805	3300009093	Bacteria	5617
84	Ga0105240_10113367	3300009093	Bacteria	3276
85	Ga0105240_10231927	3300009093	Bacteria	2145
86	Ga0111539_10048994	3300009094	Bacteria	5042
87	Ga0111539_10762465	3300009094	Bacteria	1126
88	Ga0105245_10015005	3300009098	Bacteria	6751
89	Ga0105245_10025609	3300009098	Bacteria	5188
90	Ga0105245_10288295	3300009098	Bacteria	1607
91	Ga0105247_10001781	3300009101	Bacteria	15147
92	Ga0105247_10107800	3300009101	Bacteria	1789
93	Ga0114129_10026851	3300009147	Bacteria	8150
94	Ga0105243_10135493	3300009148	Bacteria	2095
95	Ga0105243_10525620	3300009148	Bacteria	1126
96	Ga0105248_10000034	3300009177	Bacteria	192324
97	Ga0105248_10002386	3300009177	Bacteria	20868
98	Ga0105237_10083751	3300009545	Bacteria	3180
99	Ga0105238_10036975	3300009551	Bacteria	4964
100	Ga0105238_10113078	3300009551	Bacteria	2695
101	Ga0105238_10120652	3300009551	Bacteria	2601
102	Ga0105238_10318570	3300009551	Bacteria	1541
103	Ga0105239_10663614	3300010375	Bacteria	1191
104	Ga0157371_10042292	3300013102	Bacteria	3248
105	Ga0157370_10471293	3300013104	Bacteria	1154
106	Ga0157369_10564475	3300013105	Bacteria	1176
107	Ga0157372_10031509	3300013307	Bacteria	5805
108	Ga0157372_10197308	3300013307	Bacteria	2331
109	Ga0157375_10064746	3300013308	Bacteria	3641
110	Ga0163163_10011412	3300014325	Bacteria	8057
111	Ga0163163_10085161	3300014325	Bacteria	3169
112	Ga0157380_10031349	3300014326	Bacteria	4081
113	Ga0182008_10038517	3300014497	Bacteria	2391
114	Ga0182008_10044382	3300014497	Bacteria	2210
115	Ga0157379_10000123	3300014968	Bacteria	53884
116	Ga0206353_10746410	3300020082	Bacteria	2267
117	Ga0209026_1001316	3300025250	Bacteria	11191
118	Ga0207710_10000032	3300025900	Bacteria	274354
119	Ga0207710_10062907	3300025900	Bacteria	1687
120	Ga0207685_10018146	3300025905	Bacteria	2290
121	Ga0207643_10006825	3300025908	Bacteria	6126
122	Ga0207705_10013658	3300025909	Bacteria	5858
123	Ga0207705_10041135	3300025909	Bacteria	3315
124	Ga0207705_10097508	3300025909	Bacteria	2159
125	Ga0207707_10046476	3300025912	Bacteria	3781
126	Ga0207695_10001217	3300025913	Bacteria	44094
127	Ga0207695_10005951	3300025913	Bacteria	15961
128	Ga0207695_10014209	3300025913	Bacteria	9445
129	Ga0207695_10042869	3300025913	Bacteria	4827
130	Ga0207660_10008106	3300025917	Bacteria	6797
131	Ga0207660_10040769	3300025917	Bacteria	3252
132	Ga0207660_10085291	3300025917	Bacteria	2329
133	Ga0207660_10327988	3300025917	Bacteria	1223
134	Ga0207657_10011886	3300025919	Bacteria	8617
135	Ga0207657_10177384	3300025919	Bacteria	1724
136	Ga0207649_10282391	3300025920	Bacteria	1207
137	Ga0207652_10004132	3300025921	Bacteria	11846
138	Ga0207652_10020857	3300025921	Bacteria	5402
139	Ga0207694_10072889	3300025924	Bacteria	2685
140	Ga0207687_10024825	3300025927	Bacteria	4007
141	Ga0207687_10095969	3300025927	Bacteria	2172
142	Ga0207687_10549167	3300025927	Bacteria	969
143	Ga0207670_10387634	3300025936	Bacteria	1114
144	Ga0207704_10013140	3300025938	Bacteria	4135
145	Ga0207704_10085507	3300025938	Bacteria	2054
146	Ga0207691_10006151	3300025940	Bacteria	11606
147	Ga0207711_10000067	3300025941	Bacteria	118985
148	Ga0207711_10002331	3300025941	Bacteria	17013
149	Ga0207689_10155848	3300025942	Bacteria	1883
150	Ga0207667_10013929	3300025949	Bacteria	9188
151	Ga0207712_10028705	3300025961	Bacteria	3723
152	Ga0207658_10003838	3300025986	Bacteria	10588
153	Ga0207703_10000003	3300026035	Bacteria	532213
154	Ga0207703_10031119	3300026035	Bacteria	4217
155	Ga0207639_10025269	3300026041	Bacteria	4306
156	Ga0207708_10000379	3300026075	Bacteria	34728
157	Ga0207641_10007136	3300026088	Bacteria	9329
158	Ga0207641_10153088	3300026088	Bacteria	2090
159	Ga0207648_10002445	3300026089	Bacteria	19971
160	Ga0207675_100022928	3300026118	Bacteria	5807
161	Ga0207683_10135104	3300026121	Bacteria	2220
162	Ga0207698_10014572	3300026142	Bacteria	5233
163	Ga0209813_10014374	3300027866	Bacteria	2131
164	Ga0207428_10447394	3300027907	Bacteria	942
165	Ga0268266_10000311	3300028379	Bacteria	77262
166	Ga0268265_10000015	3300028380	Bacteria	322854
167	Ga0316182_1025085	3300030745	Bacteria	5828
168	Ga0265325_10046701	3300031241	Bacteria	2245
169	Ga0265327_10000106	3300031251	Bacteria	184297
170	Ga0265327_10116955	3300031251	Bacteria	1268
171	Ga0307509_10254671	3300031507	Bacteria	1536
172	Ga0307508_10055090	3300031616	Bacteria	3524
173	Ga0307508_10090223	3300031616	Bacteria	2651
174	Ga0265314_10054420	3300031711	Bacteria	2770
175	Ga0316576_10117452	3300031727	Bacteria	1996
176	Ga0316578_10040196	3300031728	Bacteria	2703
177	Ga0316578_10053681	3300031728	Bacteria	2362
178	Ga0307405_10006057	3300031731	Bacteria	5914
179	Ga0307410_10110789	3300031852	Bacteria	1986
180	Ga0307410_10189230	3300031852	Bacteria	1564
181	Ga0307406_10121511	3300031901	Bacteria	1817
182	Ga0307412_10127204	3300031911	Bacteria	1845
183	Ga0307412_10343947	3300031911	Bacteria	1195
184	Ga0307409_100257102	3300031995	Bacteria	1600
185	Ga0307416_100072687	3300032002	Bacteria	2864
186	Ga0307411_10122591	3300032005	Bacteria	1884
187	Ga0307415_100051371	3300032126	Bacteria	2797
188	Ga0307415_100143743	3300032126	Bacteria	1826
189	Ga0307415_100169924	3300032126	Bacteria	1699
190	Ga0373934_0020958	3300035086	Bacteria	2516
191	Ga0373923_0020992	3300035111	Bacteria	2545
192	Ga0373953_0115767	3300035117	Bacteria	1136
193	Ga0373956_0001926	3300035119	Bacteria	8568
194	Ga0373955_0018048	3300035172	Bacteria	3501
195	Ga0316574_0017724	3300035398	Bacteria	4174
196	Ga0316574_0040187	3300035398	Bacteria	2879
197	Ga0373937_0565755	3300036401	Bacteria	1080
198	Ga0316582_0278637	3300036647	Bacteria	1148
199	Ga0316584_0009116	3300036712	Bacteria	6871
200	Ga0316584_0188592	3300036712	Bacteria	1525
201	Ga0395899_0000766	3300037312	Bacteria	31738
202	Ga0395900_0000127	3300037418	Bacteria	127554
203	Ga0395900_0279624	3300037418	Bacteria	1661
204	Ga0395898_0002880	3300037466	Bacteria	19631
205	Ga0395898_0138950	3300037466	Bacteria	2326
206	Ga0395905_0002951	3300037471	Bacteria	18478
207	Ga0395901_0000098	3300038443	Bacteria	117656
208	Ga0395901_0349425	3300038443	Bacteria	1526
209	Ga0395901_0685485	3300038443	Bacteria	1024
210	Ga0451793_1471279	3300041452	Bacteria	1075
211	Ga0451833_0276607	3300041491	Bacteria	3056
212	Ga0451837_0222302	3300041494	Bacteria	1607
213	Ga0451837_0397994	3300041494	Bacteria	3305
214	Ga0451841_0714075	3300041498	Bacteria	3118
215	Ga0451841_0865034	3300041498	Bacteria	1813
216	Ga0439440_0031706	3300042993	Bacteria	1251
217	Ga0466972_0017577	3300044658	Bacteria	3580
218	Ga0466965_0048782	3300044683	Bacteria	2098
219	Ga0466966_0263581	3300044684	Bacteria	1037
220	Ga0466963_0058414	3300044694	Bacteria	2572
221	Ga0466970_0283242	3300044765	Bacteria	932
222	Ga0466957_0162785	3300044842	Bacteria	1450
223	Ga0466960_0000917	3300044901	Bacteria	10449
224	Ga0466960_0051310	3300044901	Bacteria	1992
225	Ga0466960_0087341	3300044901	Bacteria	1583
226	Ga0466959_0056297	3300045049	Bacteria	2869
227	Ga0466959_0204543	3300045049	Bacteria	1374
228	Ga0451576_0507905	3300045051	Bacteria	1266
229	Ga0466958_0143550	3300045836	Bacteria	1504
230	Ga0466958_0299848	3300045836	Bacteria	1032
231	Ga0466967_0028124	3300045976	Bacteria	4689
232	Ga0466967_0124846	3300045976	Bacteria	2383
233	Ga0466967_0213786	3300045976	Bacteria	1830
234	Ga0466967_0238009	3300045976	Bacteria	1735
235	Ga0466967_0286455	3300045976	Bacteria	1582
236	Ga0466967_0342756	3300045976	Bacteria	1445
237	Ga0466967_0361117	3300045976	Bacteria	1407
238	Ga0495638_0096963	3300046460	Bacteria	1769
239	Ga0495639_0036699	3300046475	Bacteria	2196
240	Ga0495594_0040116	3300046499	Bacteria	2561
241	Ga0495607_0005532	3300046501	Bacteria	9017
242	Ga0495606_0008409	3300046507	Bacteria	8976
243	Ga0495648_0022718	3300046524	Bacteria	4310
244	Ga0495668_0000184	3300046616	Bacteria	93069
245	Ga0495625_0038022	3300046660	Bacteria	3525
246	Ga0495669_0005647	3300046684	Bacteria	5222
247	Ga0495626_0004096	3300048091	Bacteria	9058
248	Ga0496101_0083454	3300048904	Bacteria	2365
249	Ga0496102_0000023	3300048905	Bacteria	237015
250	Ga0496102_0024416	3300048905	Bacteria	5374
251	Ga0496103_0000634	3300048906	Bacteria	26937
252	Ga0496103_0194216	3300048906	Bacteria	1305
253	Ga0496104_0129923	3300048907	Bacteria	2420
254	Ga0496104_0457519	3300048907	Bacteria	1188
255	Ga0496105_0193755	3300048908	Bacteria	1661
256	Ga0496107_0120670	3300048910	Bacteria	1931
257	Ga0496107_0332571	3300048910	Bacteria	1130
258	Ga0496108_0171152	3300048911	Bacteria	1879
259	Ga0496108_0249529	3300048911	Bacteria	1544
260	Ga0496109_0145187	3300048912	Bacteria	2220
261	Ga0496110_0098333	3300048913	Bacteria	2622
262	Ga0496110_0227486	3300048913	Bacteria	1696
263	Ga0496111_0119283	3300048914	Bacteria	1948
264	Ga0496111_0159799	3300048914	Bacteria	1673
265	Ga0496111_0195135	3300048914	Bacteria	1505
266	Ga0496111_0431643	3300048914	Bacteria	973
267	Ga0496111_0433088	3300048914	Bacteria	971
268	Ga0496114_0066237	3300048917	Bacteria	3028
269	Ga0496114_0081109	3300048917	Bacteria	2740
270	Ga0496114_0097394	3300048917	Bacteria	2506
271	Ga0496114_0107664	3300048917	Bacteria	2386
272	Ga0496115_0023891	3300048918	Bacteria	4747
273	Ga0496115_0034758	3300048918	Bacteria	3983
274	Ga0496115_0217435	3300048918	Bacteria	1577
275	Ga0496116_0000374	3300048919	Bacteria	67234
276	Ga0496117_0010260	3300048920	Bacteria	8578
277	Ga0496117_0045913	3300048920	Bacteria	3149
278	Ga0496117_0077163	3300048920	Bacteria	2206
279	Ga0496118_0003629	3300048921	Bacteria	19162
280	Ga0496118_0040105	3300048921	Bacteria	3726
281	Ga0496118_0043066	3300048921	Bacteria	3554
282	Ga0496118_0248315	3300048921	Bacteria	1013
283	Ga0496119_0005404	3300048922	Bacteria	12270
284	Ga0496119_0010499	3300048922	Bacteria	7786
285	Ga0496119_0013968	3300048922	Bacteria	6331
286	Ga0496120_0048400	3300048923	Bacteria	2447
287	Ga0496120_0169584	3300048923	Bacteria	1081
288	Ga0496120_0217847	3300048923	Bacteria	914
289	Ga0496121_0007818	3300048924	Bacteria	12795
290	Ga0496121_0009197	3300048924	Bacteria	11420
291	Ga0496121_0063744	3300048924	Bacteria	3009
292	Ga0496124_0022815	3300048927	Bacteria	5731
293	Ga0501031_0000061	3300049568	Bacteria	58363
294	Ga0501031_0008225	3300049568	Bacteria	6786
295	Ga0501031_0017246	3300049568	Bacteria	4692
296	Ga0501031_0107782	3300049568	Bacteria	1819
297	Ga0501032_0000155	3300049569	Bacteria	55506
298	Ga0501032_0027944	3300049569	Bacteria	3877
299	Ga0501033_0000217	3300049570	Bacteria	55235
300	Ga0501033_0263183	3300049570	Bacteria	1220
301	Ga0501034_0001062	3300049571	Bacteria	38941
302	Ga0501034_0068323	3300049571	Bacteria	3564
303	Ga0501036_0002172	3300049572	Bacteria	15309
304	Ga0501036_0663964	3300049572	Bacteria	863
305	Ga0501037_0000241	3300049573	Bacteria	46956
306	Ga0501037_0043254	3300049573	Bacteria	3311
307	Ga0501037_0243755	3300049573	Bacteria	1259
308	Ga0501038_0000167	3300049574	Bacteria	55508
309	Ga0501039_0000153	3300049575	Bacteria	47341
310	Ga0501039_0044837	3300049575	Bacteria	3416
311	Ga0501039_0080315	3300049575	Bacteria	2538
312	Ga0501039_0194902	3300049575	Bacteria	1593
313	Ga0501040_0113971	3300049576	Bacteria	1892
314	Ga0501041_0006202	3300049577	Bacteria	6990
315	Ga0501041_0058458	3300049577	Bacteria	2359
316	Ga0501042_0033213	3300049578	Bacteria	3657
317	Ga0501042_0132518	3300049578	Bacteria	1797
318	Ga0501042_0391780	3300049578	Bacteria	1006
319	Ga0501043_0000079	3300049579	Bacteria	85383
320	Ga0501043_0054829	3300049579	Bacteria	3131
321	Ga0501043_0308078	3300049579	Bacteria	1209
322	Ga0501046_0000400	3300049580	Bacteria	43372
323	Ga0501046_0007110	3300049580	Bacteria	9848
324	Ga0501047_0000268	3300049581	Bacteria	60315
325	Ga0501047_0000565	3300049581	Bacteria	39569
326	Ga0501047_0203759	3300049581	Bacteria	1838
327	Ga0501048_0000141	3300049582	Bacteria	43576
328	Ga0501048_0034871	3300049582	Bacteria	3626
329	Ga0501048_0167673	3300049582	Bacteria	1555
330	Ga0501067_0007323	3300049583	Bacteria	6129
331	Ga0501067_0044157	3300049583	Bacteria	2476
332	Ga0501069_0000117	3300049585	Bacteria	35159
333	Ga0501069_0021793	3300049585	Bacteria	3480
334	Ga0501069_0130937	3300049585	Bacteria	1436
335	Ga0501070_0000217	3300049586	Bacteria	54554
336	Ga0501070_0000752	3300049586	Bacteria	29593
337	Ga0501070_0003299	3300049586	Bacteria	14007
338	Ga0501070_0010741	3300049586	Bacteria	7736
339	Ga0501070_0022024	3300049586	Bacteria	5338
340	Ga0501070_0030971	3300049586	Bacteria	4481
341	Ga0501070_0038787	3300049586	Bacteria	3975
342	Ga0501070_0054828	3300049586	Bacteria	3305
343	Ga0501071_0010499	3300049587	Bacteria	6209
344	Ga0501071_0029390	3300049587	Bacteria	3879
345	Ga0501071_0413163	3300049587	Bacteria	1031
346	Ga0501072_0008263	3300049588	Bacteria	7908
347	Ga0501073_0000633	3300049589	Bacteria	24648
348	Ga0501073_0155063	3300049589	Bacteria	1587
349	Ga0501073_0323237	3300049589	Bacteria	1065
350	Ga0501074_0000226	3300049590	Bacteria	31303
351	Ga0501074_0173988	3300049590	Bacteria	1536
352	Ga0501075_0027862	3300049591	Bacteria	4166
353	Ga0501079_0000991	3300049741	Bacteria	19598
354	Ga0501080_0000079	3300049742	Bacteria	65752
355	Ga0501080_0000830	3300049742	Bacteria	25229
356	Ga0501080_0019678	3300049742	Bacteria	6252
357	Ga0501080_0023320	3300049742	Bacteria	5738
358	Ga0501080_0372979	3300049742	Bacteria	1286
359	Ga0501081_0042312	3300049743	Bacteria	3121
360	Ga0501083_0017475	3300049744	Bacteria	5000
361	Ga0501035_0000786	3300049822	Bacteria	33990
362	Ga0501035_0372715	3300049822	Bacteria	1191
363	Ga0501035_0467181	3300049822	Bacteria	1042
364	Ga0501044_0001530	3300049823	Bacteria	27125
365	Ga0501044_0025514	3300049823	Bacteria	6266
366	Ga0501045_0027611	3300049824	Bacteria	4092
367	nmdc:mga00v17_76637_c1	3300050491	Bacteria	2080
368	nmdc:mga0yw44_184288_c1	3300050492	Bacteria	1375
369	nmdc:mga0yw44_28757_c1	3300050492	Bacteria	3202
370	nmdc:mga06z11_65691_c1	3300050494	Bacteria	1905
371	nmdc:mga04h51_808_c1	3300050495	Bacteria	7281
372	nmdc:mga05p37_10055_c1	3300050507	Bacteria	11228
373	nmdc:mga09592_39508_c1	3300050508	Bacteria	3964
374	nmdc:mga0qj67_116425_c1	3300050509	Bacteria	2160
375	nmdc:mga0qj67_490_c1	3300050509	Bacteria	26993
376	nmdc:mga06r32_74190_c1	3300050510	Bacteria	3297
377	nmdc:mga06r32_819_c1	3300050510	Bacteria	27566
378	nmdc:mga0sz30_212272_c1	3300050516	Bacteria	860
379	Ga0500595_060178	3300053119	Bacteria	1150
380	Ga0500573_0000017	3300053140	Bacteria	181426
381	Ga0501084_0006789	3300054114	Bacteria	9411
382	Ga0501084_0210339	3300054114	Bacteria	1641
383	Ga0501082_0136066	3300060353	Bacteria	2132
384	Ga0501082_0145673	3300060353	Bacteria	2056
385	Ga0501082_0208857	3300060353	Bacteria	1699
386	Ga0530510_0040700	3300061734	Bacteria	3354
387	Ga0530510_0295687	3300061734	Bacteria	1211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2802429296	2804843810	214
2	3300048917	Ga0496114_0107664	Ga0496114_0107664_1192_2013	230
3	3300041494	Ga0451837_0222302	Ga0451837_0222302_73_930	248
4	3300049573	Ga0501037_0043254	Ga0501037_0043254_2128_2931	248
5	3300049581	Ga0501047_0203759	Ga0501047_0203759_230_1033	248
6	3300045976	Ga0466967_0238009	Ga0466967_0238009_807_1622	251
7	3300049575	Ga0501039_0194902	Ga0501039_0194902_401_1204	251
8	iso_pu_bacteria	2909042592	2909047539	251
9	3300048918	Ga0496115_0023891	Ga0496115_0023891_3499_4308	253
10	3300005327	Ga0070658_10017210	Ga0070658_100172105	254
11	3300005327	Ga0070658_10241004	Ga0070658_102410042	254
12	3300005336	Ga0070680_100047920	Ga0070680_1000479202	254
13	3300005458	Ga0070681_10051930	Ga0070681_100519302	254
14	3300005563	Ga0068855_100046986	Ga0068855_1000469864	254
15	3300009093	Ga0105240_10044805	Ga0105240_100448051	254
16	3300010375	Ga0105239_10663614	Ga0105239_106636141	254
17	3300013307	Ga0157372_10197308	Ga0157372_101973082	254
18	3300025909	Ga0207705_10041135	Ga0207705_100411353	254
19	3300025912	Ga0207707_10046476	Ga0207707_100464761	254
20	3300025913	Ga0207695_10014209	Ga0207695_100142098	254
21	3300025917	Ga0207660_10085291	Ga0207660_100852912	254
22	3300025927	Ga0207687_10095969	Ga0207687_100959692	254
23	3300045049	Ga0466959_0204543	Ga0466959_0204543_375_1181	254
24	3300046684	Ga0495669_0005647	Ga0495669_0005647_3074_3856	255
25	iso_pu_bacteria	2842888712	2842890758	255
26	3300005327	Ga0070658_10052884	Ga0070658_100528842	256
27	3300005327	Ga0070658_10237991	Ga0070658_102379912	256
28	3300005336	Ga0070680_100097440	Ga0070680_1000974402	256
29	3300005336	Ga0070680_100134326	Ga0070680_1001343261	256
30	3300005336	Ga0070680_100693268	Ga0070680_1006932681	256
31	3300005341	Ga0070691_10020055	Ga0070691_100200552	256
32	3300005366	Ga0070659_100009593	Ga0070659_1000095934	256
33	3300005458	Ga0070681_10061260	Ga0070681_100612602	256
34	3300005530	Ga0070679_100015768	Ga0070679_1000157682	256
35	3300005539	Ga0068853_100194153	Ga0068853_1001941532	256
36	3300005539	Ga0068853_100355808	Ga0068853_1003558081	256
37	3300005548	Ga0070665_100000290	Ga0070665_1000002907	256
38	3300005563	Ga0068855_100008392	Ga0068855_1000083927	256
39	3300005563	Ga0068855_100012814	Ga0068855_1000128142	256
40	3300005577	Ga0068857_100226399	Ga0068857_1002263991	256
41	3300005617	Ga0068859_100000039	Ga0068859_100000039120	256
42	3300006881	Ga0068865_100043884	Ga0068865_1000438842	256
43	3300006931	Ga0097620_100000039	Ga0097620_100000039120	256
44	3300009093	Ga0105240_10001751	Ga0105240_1000175120	256
45	3300009093	Ga0105240_10113367	Ga0105240_101133672	256
46	3300009093	Ga0105240_10231927	Ga0105240_102319272	256
47	3300009177	Ga0105248_10002386	Ga0105248_1000238618	256
48	3300009551	Ga0105238_10036975	Ga0105238_100369752	256
49	3300009551	Ga0105238_10120652	Ga0105238_101206522	256
50	3300009551	Ga0105238_10318570	Ga0105238_103185702	256
51	3300013104	Ga0157370_10471293	Ga0157370_104712932	256
52	3300013105	Ga0157369_10564475	Ga0157369_105644752	256
53	3300014325	Ga0163163_10011412	Ga0163163_100114122	256
54	3300014325	Ga0163163_10085161	Ga0163163_100851612	256
55	3300025250	Ga0209026_1001316	Ga0209026_10013167	256
56	3300025909	Ga0207705_10013658	Ga0207705_100136583	256
57	3300025909	Ga0207705_10097508	Ga0207705_100975082	256
58	3300025913	Ga0207695_10001217	Ga0207695_1000121713	256
59	3300025913	Ga0207695_10005951	Ga0207695_1000595114	256
60	3300025913	Ga0207695_10042869	Ga0207695_100428695	256
61	3300025917	Ga0207660_10008106	Ga0207660_100081062	256
62	3300025917	Ga0207660_10040769	Ga0207660_100407692	256
63	3300025919	Ga0207657_10011886	Ga0207657_100118867	256
64	3300025920	Ga0207649_10282391	Ga0207649_102823912	256
65	3300025921	Ga0207652_10004132	Ga0207652_100041323	256
66	3300025921	Ga0207652_10020857	Ga0207652_100208572	256
67	3300025924	Ga0207694_10072889	Ga0207694_100728892	256
68	3300025927	Ga0207687_10549167	Ga0207687_105491671	256
69	3300025938	Ga0207704_10013140	Ga0207704_100131402	256
70	3300025941	Ga0207711_10002331	Ga0207711_100023312	256
71	3300025949	Ga0207667_10013929	Ga0207667_100139293	256
72	3300026041	Ga0207639_10025269	Ga0207639_100252692	256
73	3300028379	Ga0268266_10000311	Ga0268266_1000031122	256
74	3300031251	Ga0265327_10116955	Ga0265327_101169551	256
75	3300031727	Ga0316576_10117452	Ga0316576_101174524	256
76	3300036401	Ga0373937_0565755	Ga0373937_0565755_81_896	256
77	3300037312	Ga0395899_0000766	Ga0395899_0000766_5483_6295	256
78	3300037418	Ga0395900_0000127	Ga0395900_0000127_40694_41506	256
79	3300037466	Ga0395898_0002880	Ga0395898_0002880_2673_3485	256
80	3300037471	Ga0395905_0002951	Ga0395905_0002951_4001_4813	256
81	3300038443	Ga0395901_0000098	Ga0395901_0000098_76151_76963	256
82	3300041498	Ga0451841_0865034	Ga0451841_0865034_179_985	256
83	3300048918	Ga0496115_0034758	Ga0496115_0034758_1567_2385	256
84	3300053119	Ga0500595_060178	Ga0500595_060178_77_883	256
85	3300005327	Ga0070658_10130378	Ga0070658_101303782	257
86	3300031728	Ga0316578_10040196	Ga0316578_100401962	257
87	3300031728	Ga0316578_10053681	Ga0316578_100536812	257
88	3300031852	Ga0307410_10189230	Ga0307410_101892301	257
89	3300032005	Ga0307411_10122591	Ga0307411_101225912	257
90	3300035086	Ga0373934_0020958	Ga0373934_0020958_428_1225	257
91	3300035111	Ga0373923_0020992	Ga0373923_0020992_1714_2511	257
92	3300035117	Ga0373953_0115767	Ga0373953_0115767_219_1016	257
93	3300035119	Ga0373956_0001926	Ga0373956_0001926_5488_6285	257
94	3300035172	Ga0373955_0018048	Ga0373955_0018048_2137_2934	257
95	3300035398	Ga0316574_0017724	Ga0316574_0017724_2198_3094	257
96	3300035398	Ga0316574_0040187	Ga0316574_0040187_1816_2646	257
97	3300036647	Ga0316582_0278637	Ga0316582_0278637_221_1117	257
98	3300036712	Ga0316584_0009116	Ga0316584_0009116_2617_3447	257
99	3300045051	Ga0451576_0507905	Ga0451576_0507905_402_1247	257
100	3300048921	Ga0496118_0248315	Ga0496118_0248315_175_993	257
101	3300048923	Ga0496120_0217847	Ga0496120_0217847_96_896	257
102	3300050516	nmdc:mga0sz30_212272_c1	nmdc:mga0sz30_212272_c1_11_829	257
103	iso_pu_bacteria	2551306166	2552105647	257
104	iso_pu_bacteria	2643221692	2644515498	257
105	iso_pu_bacteria	2887478801	2887481374	257
106	iso_pu_bacteria	8055157932	8055161050	257
107	3300046501	Ga0495607_0005532	Ga0495607_0005532_6351_7145	258
108	iso_pu_bacteria	2687453737	2689955580	258
109	3300005985	Ga0081539_10039520	Ga0081539_100395202	259
110	3300030745	Ga0316182_1025085	Ga0316182_10250855	259
111	3300045049	Ga0466959_0056297	Ga0466959_0056297_383_1165	259
112	3300046475	Ga0495639_0036699	Ga0495639_0036699_1357_2148	259
113	3300049742	Ga0501080_0023320	Ga0501080_0023320_2933_3736	259
114	iso_pu_bacteria	2883821847	2883825421	259
115	3300031901	Ga0307406_10121511	Ga0307406_101215111	260
116	3300032126	Ga0307415_100143743	Ga0307415_1001437431	260
117	3300045976	Ga0466967_0028124	Ga0466967_0028124_1811_2608	260
118	iso_pu_bacteria	2855683550	2855683883	260
119	3300005367	Ga0070667_100009867	Ga0070667_1000098679	261
120	3300005435	Ga0070714_100071055	Ga0070714_1000710552	261
121	3300005614	Ga0068856_100013153	Ga0068856_1000131534	261
122	3300005617	Ga0068859_100049868	Ga0068859_1000498683	261
123	3300005617	Ga0068859_100332251	Ga0068859_1003322512	261
124	3300005937	Ga0081455_10378063	Ga0081455_103780631	261
125	3300006844	Ga0075428_100170169	Ga0075428_1001701692	261
126	3300006847	Ga0075431_100015658	Ga0075431_1000156587	261
127	3300006880	Ga0075429_100053802	Ga0075429_1000538023	261
128	3300006931	Ga0097620_100049868	Ga0097620_1000498683	261
129	3300006931	Ga0097620_100332277	Ga0097620_1003322772	261
130	3300009101	Ga0105247_10107800	Ga0105247_101078003	261
131	3300009147	Ga0114129_10026851	Ga0114129_100268513	261
132	3300025900	Ga0207710_10062907	Ga0207710_100629072	261
133	3300025986	Ga0207658_10003838	Ga0207658_100038389	261
134	3300026088	Ga0207641_10153088	Ga0207641_101530882	261
135	3300046507	Ga0495606_0008409	Ga0495606_0008409_966_1763	261
136	3300046616	Ga0495668_0000184	Ga0495668_0000184_91345_92142	261
137	3300046660	Ga0495625_0038022	Ga0495625_0038022_755_1552	261
138	3300048091	Ga0495626_0004096	Ga0495626_0004096_978_1775	261
139	3300048904	Ga0496101_0083454	Ga0496101_0083454_1379_2194	261
140	3300048905	Ga0496102_0000023	Ga0496102_0000023_112566_113381	261
141	3300048906	Ga0496103_0000634	Ga0496103_0000634_20313_21128	261
142	3300048910	Ga0496107_0332571	Ga0496107_0332571_20_835	261
143	3300048920	Ga0496117_0077163	Ga0496117_0077163_861_1676	261
144	3300048922	Ga0496119_0013968	Ga0496119_0013968_5018_5833	261
145	3300048923	Ga0496120_0169584	Ga0496120_0169584_172_987	261
146	3300048924	Ga0496121_0063744	Ga0496121_0063744_516_1331	261
147	3300050507	nmdc:mga05p37_10055_c1	nmdc:mga05p37_10055_c1_595_1398	261
148	3300050508	nmdc:mga09592_39508_c1	nmdc:mga09592_39508_c1_1905_2708	261
149	3300050509	nmdc:mga0qj67_116425_c1	nmdc:mga0qj67_116425_c1_618_1421	261
150	iso_pu_bacteria	8025413630	8025418763	261
151	3300005985	Ga0081539_10007285	Ga0081539_100072852	262
152	3300006844	Ga0075428_100004494	Ga0075428_1000044947	262
153	3300006847	Ga0075431_100003762	Ga0075431_1000037628	262
154	3300006847	Ga0075431_100223175	Ga0075431_1002231752	262
155	3300031616	Ga0307508_10055090	Ga0307508_100550903	262
156	3300031616	Ga0307508_10090223	Ga0307508_100902233	262
157	3300037466	Ga0395898_0138950	Ga0395898_0138950_721_1545	262
158	3300038443	Ga0395901_0349425	Ga0395901_0349425_544_1368	262
159	3300041491	Ga0451833_0276607	Ga0451833_0276607_1869_2708	262
160	3300041494	Ga0451837_0397994	Ga0451837_0397994_501_1340	262
161	3300041498	Ga0451841_0714075	Ga0451841_0714075_465_1304	262
162	3300044658	Ga0466972_0017577	Ga0466972_0017577_1030_1833	262
163	3300044683	Ga0466965_0048782	Ga0466965_0048782_1012_1815	262
164	3300044901	Ga0466960_0051310	Ga0466960_0051310_366_1169	262
165	3300045836	Ga0466958_0299848	Ga0466958_0299848_180_983	262
166	3300045976	Ga0466967_0124846	Ga0466967_0124846_1237_2049	262
167	3300045976	Ga0466967_0286455	Ga0466967_0286455_282_1085	262
168	3300050510	nmdc:mga06r32_74190_c1	nmdc:mga06r32_74190_c1_2303_3103	262
169	3300050510	nmdc:mga06r32_819_c1	nmdc:mga06r32_819_c1_18017_18817	262
170	iso_pu_bacteria	2643221619	2644111003	262
171	iso_pu_bacteria	2643221697	2644537635	262
172	iso_pu_bacteria	2643221961	2645719553	262
173	iso_pu_bacteria	2643221962	2645726456	262
174	iso_pu_bacteria	2773857762	2774392193	262
175	iso_pu_bacteria	2808606372	2808902129	262
176	iso_pu_bacteria	2808606439	2809195993	262
177	iso_pu_bacteria	2811994878	2812351866	262
178	iso_pu_bacteria	2891968417	2891970494	262
179	iso_pu_bacteria	2919443155	2919446148	262
180	iso_pu_bacteria	8025530807	8025531037	262
181	3300005334	Ga0068869_100347033	Ga0068869_1003470331	263
182	3300005455	Ga0070663_100229336	Ga0070663_1002293362	263
183	3300005543	Ga0070672_100539307	Ga0070672_1005393072	263
184	3300005841	Ga0068863_100005493	Ga0068863_1000054934	263
185	3300005842	Ga0068858_100011868	Ga0068858_1000118686	263
186	3300005985	Ga0081539_10000348	Ga0081539_1000034866	263
187	3300006846	Ga0075430_100001615	Ga0075430_1000016157	263
188	3300025942	Ga0207689_10155848	Ga0207689_101558482	263
189	3300026035	Ga0207703_10031119	Ga0207703_100311193	263
190	3300026088	Ga0207641_10007136	Ga0207641_100071369	263
191	3300026121	Ga0207683_10135104	Ga0207683_101351042	263
192	3300031507	Ga0307509_10254671	Ga0307509_102546712	263
193	3300031731	Ga0307405_10006057	Ga0307405_100060572	263
194	3300031852	Ga0307410_10110789	Ga0307410_101107892	263
195	3300031911	Ga0307412_10127204	Ga0307412_101272042	263
196	3300032126	Ga0307415_100051371	Ga0307415_1000513712	263
197	3300036712	Ga0316584_0188592	Ga0316584_0188592_85_885	263
198	3300046499	Ga0495594_0040116	Ga0495594_0040116_1319_2119	263
199	3300048921	Ga0496118_0043066	Ga0496118_0043066_2122_2967	263
200	3300050509	nmdc:mga0qj67_490_c1	nmdc:mga0qj67_490_c1_22658_23461	263
201	3300060353	Ga0501082_0136066	Ga0501082_0136066_1285_2091	263
202	iso_pu_bacteria	2867369537	2867369909	263
203	iso_pu_bacteria	2912757875	2912758941	263
204	3300009098	Ga0105245_10015005	Ga0105245_100150054	264
205	3300025927	Ga0207687_10024825	Ga0207687_100248254	264
206	3300031241	Ga0265325_10046701	Ga0265325_100467012	264
207	3300031711	Ga0265314_10054420	Ga0265314_100544203	264
208	3300045836	Ga0466958_0143550	Ga0466958_0143550_249_1055	264
209	3300045976	Ga0466967_0213786	Ga0466967_0213786_658_1467	264
210	3300046524	Ga0495648_0022718	Ga0495648_0022718_2879_3814	264
211	3300048914	Ga0496111_0433088	Ga0496111_0433088_111_950	264
212	3300049573	Ga0501037_0243755	Ga0501037_0243755_207_1013	264
213	3300049585	Ga0501069_0021793	Ga0501069_0021793_2238_3041	264
214	3300049586	Ga0501070_0000752	Ga0501070_0000752_18589_19395	264
215	3300049586	Ga0501070_0003299	Ga0501070_0003299_5439_6248	264
216	3300049586	Ga0501070_0010741	Ga0501070_0010741_5706_6509	264
217	3300049586	Ga0501070_0022024	Ga0501070_0022024_262_1065	264
218	3300049589	Ga0501073_0155063	Ga0501073_0155063_421_1227	264
219	3300049589	Ga0501073_0323237	Ga0501073_0323237_47_850	264
220	3300049590	Ga0501074_0173988	Ga0501074_0173988_366_1172	264
221	3300049741	Ga0501079_0000991	Ga0501079_0000991_14277_15083	264
222	3300049742	Ga0501080_0000830	Ga0501080_0000830_16274_17080	264
223	3300049742	Ga0501080_0372979	Ga0501080_0372979_95_901	264
224	3300049823	Ga0501044_0025514	Ga0501044_0025514_5414_6223	264
225	3300054114	Ga0501084_0210339	Ga0501084_0210339_263_1069	264
226	3300013308	Ga0157375_10064746	Ga0157375_100647462	265
227	3300041452	Ga0451793_1471279	Ga0451793_1471279_132_983	265
228	3300042993	Ga0439440_0031706	Ga0439440_0031706_64_954	265
229	3300005329	Ga0070683_100019433	Ga0070683_1000194334	266
230	3300005337	Ga0070682_100003020	Ga0070682_1000030203	266
231	3300005345	Ga0070692_10001392	Ga0070692_100013925	266
232	3300005366	Ga0070659_100198979	Ga0070659_1001989791	266
233	3300005438	Ga0070701_10001815	Ga0070701_100018157	266
234	3300005441	Ga0070700_100004347	Ga0070700_1000043475	266
235	3300005456	Ga0070678_100118762	Ga0070678_1001187622	266
236	3300005459	Ga0068867_100032739	Ga0068867_1000327393	266
237	3300005530	Ga0070679_100230890	Ga0070679_1002308902	266
238	3300005535	Ga0070684_100101615	Ga0070684_1001016153	266
239	3300005543	Ga0070672_100014089	Ga0070672_1000140896	266
240	3300005615	Ga0070702_100037276	Ga0070702_1000372762	266
241	3300005616	Ga0068852_100026197	Ga0068852_1000261973	266
242	3300005719	Ga0068861_100009670	Ga0068861_1000096706	266
243	3300005719	Ga0068861_100234415	Ga0068861_1002344152	266
244	3300005834	Ga0068851_10065018	Ga0068851_100650183	266
245	3300005840	Ga0068870_10038759	Ga0068870_100387593	266
246	3300005840	Ga0068870_10131744	Ga0068870_101317442	266
247	3300005842	Ga0068858_100000028	Ga0068858_10000002882	266
248	3300005844	Ga0068862_100000206	Ga0068862_10000020627	266
249	3300006038	Ga0075365_10009740	Ga0075365_100097403	266
250	3300006038	Ga0075365_10045040	Ga0075365_100450402	266
251	3300006038	Ga0075365_10177203	Ga0075365_101772032	266
252	3300006042	Ga0075368_10004089	Ga0075368_100040892	266
253	3300006048	Ga0075363_100006491	Ga0075363_1000064915	266
254	3300006051	Ga0075364_10004452	Ga0075364_100044527	266
255	3300006051	Ga0075364_10053247	Ga0075364_100532472	266
256	3300006051	Ga0075364_10106603	Ga0075364_101066033	266
257	3300006058	Ga0075432_10016029	Ga0075432_100160293	266
258	3300006353	Ga0075370_10019099	Ga0075370_100190993	266
259	3300006844	Ga0075428_100217996	Ga0075428_1002179963	266
260	3300006881	Ga0068865_100004316	Ga0068865_1000043168	266
261	3300009036	Ga0105244_10055157	Ga0105244_100551571	266
262	3300009094	Ga0111539_10048994	Ga0111539_100489944	266
263	3300009094	Ga0111539_10762465	Ga0111539_107624651	266
264	3300009098	Ga0105245_10025609	Ga0105245_100256092	266
265	3300009098	Ga0105245_10288295	Ga0105245_102882952	266
266	3300009101	Ga0105247_10001781	Ga0105247_100017818	266
267	3300009148	Ga0105243_10135493	Ga0105243_101354931	266
268	3300009148	Ga0105243_10525620	Ga0105243_105256202	266
269	3300009177	Ga0105248_10000034	Ga0105248_10000034109	266
270	3300009545	Ga0105237_10083751	Ga0105237_100837514	266
271	3300009551	Ga0105238_10113078	Ga0105238_101130784	266
272	3300013102	Ga0157371_10042292	Ga0157371_100422923	266
273	3300013307	Ga0157372_10031509	Ga0157372_100315095	266
274	3300014326	Ga0157380_10031349	Ga0157380_100313493	266
275	3300014497	Ga0182008_10038517	Ga0182008_100385172	266
276	3300014497	Ga0182008_10044382	Ga0182008_100443822	266
277	3300014968	Ga0157379_10000123	Ga0157379_1000012347	266
278	3300020082	Ga0206353_10746410	Ga0206353_107464102	266
279	3300025900	Ga0207710_10000032	Ga0207710_10000032104	266
280	3300025908	Ga0207643_10006825	Ga0207643_100068256	266
281	3300025917	Ga0207660_10327988	Ga0207660_103279881	266
282	3300025919	Ga0207657_10177384	Ga0207657_101773842	266
283	3300025936	Ga0207670_10387634	Ga0207670_103876342	266
284	3300025938	Ga0207704_10085507	Ga0207704_100855072	266
285	3300025940	Ga0207691_10006151	Ga0207691_100061519	266
286	3300025941	Ga0207711_10000067	Ga0207711_1000006726	266
287	3300025961	Ga0207712_10028705	Ga0207712_100287052	266
288	3300026035	Ga0207703_10000003	Ga0207703_10000003129	266
289	3300026075	Ga0207708_10000379	Ga0207708_100003795	266
290	3300026089	Ga0207648_10002445	Ga0207648_100024457	266
291	3300026118	Ga0207675_100022928	Ga0207675_1000229285	266
292	3300026142	Ga0207698_10014572	Ga0207698_100145722	266
293	3300027866	Ga0209813_10014374	Ga0209813_100143742	266
294	3300027907	Ga0207428_10447394	Ga0207428_104473941	266
295	3300028380	Ga0268265_10000015	Ga0268265_10000015169	266
296	3300031911	Ga0307412_10343947	Ga0307412_103439471	266
297	3300031995	Ga0307409_100257102	Ga0307409_1002571022	266
298	3300032002	Ga0307416_100072687	Ga0307416_1000726873	266
299	3300032126	Ga0307415_100169924	Ga0307415_1001699241	266
300	3300037418	Ga0395900_0279624	Ga0395900_0279624_791_1606	266
301	3300038443	Ga0395901_0685485	Ga0395901_0685485_200_1006	266
302	3300044684	Ga0466966_0263581	Ga0466966_0263581_117_920	266
303	3300044694	Ga0466963_0058414	Ga0466963_0058414_57_872	266
304	3300044765	Ga0466970_0283242	Ga0466970_0283242_86_889	266
305	3300044842	Ga0466957_0162785	Ga0466957_0162785_203_1018	266
306	3300044901	Ga0466960_0000917	Ga0466960_0000917_3855_4676	266
307	3300044901	Ga0466960_0087341	Ga0466960_0087341_221_1078	266
308	3300045976	Ga0466967_0361117	Ga0466967_0361117_93_896	266
309	3300046460	Ga0495638_0096963	Ga0495638_0096963_636_1442	266
310	3300048905	Ga0496102_0024416	Ga0496102_0024416_106_951	266
311	3300048906	Ga0496103_0194216	Ga0496103_0194216_244_1089	266
312	3300048907	Ga0496104_0129923	Ga0496104_0129923_1164_1991	266
313	3300048907	Ga0496104_0457519	Ga0496104_0457519_122_925	266
314	3300048908	Ga0496105_0193755	Ga0496105_0193755_715_1599	266
315	3300048910	Ga0496107_0120670	Ga0496107_0120670_833_1636	266
316	3300048911	Ga0496108_0171152	Ga0496108_0171152_871_1683	266
317	3300048911	Ga0496108_0249529	Ga0496108_0249529_450_1277	266
318	3300048912	Ga0496109_0145187	Ga0496109_0145187_603_1406	266
319	3300048913	Ga0496110_0098333	Ga0496110_0098333_1622_2449	266
320	3300048913	Ga0496110_0227486	Ga0496110_0227486_611_1414	266
321	3300048914	Ga0496111_0119283	Ga0496111_0119283_938_1765	266
322	3300048914	Ga0496111_0159799	Ga0496111_0159799_309_1112	266
323	3300048914	Ga0496111_0195135	Ga0496111_0195135_282_1085	266
324	3300048914	Ga0496111_0431643	Ga0496111_0431643_141_953	266
325	3300048917	Ga0496114_0066237	Ga0496114_0066237_2019_2822	266
326	3300048917	Ga0496114_0081109	Ga0496114_0081109_34_837	266
327	3300048917	Ga0496114_0097394	Ga0496114_0097394_240_1073	266
328	3300048918	Ga0496115_0217435	Ga0496115_0217435_27_839	266
329	3300048919	Ga0496116_0000374	Ga0496116_0000374_6904_7749	266
330	3300048920	Ga0496117_0010260	Ga0496117_0010260_1438_2283	266
331	3300048920	Ga0496117_0045913	Ga0496117_0045913_1257_2144	266
332	3300048921	Ga0496118_0003629	Ga0496118_0003629_11440_12285	266
333	3300048921	Ga0496118_0040105	Ga0496118_0040105_2032_2919	266
334	3300048922	Ga0496119_0005404	Ga0496119_0005404_6839_7684	266
335	3300048922	Ga0496119_0010499	Ga0496119_0010499_5057_5941	266
336	3300048923	Ga0496120_0048400	Ga0496120_0048400_343_1188	266
337	3300048924	Ga0496121_0007818	Ga0496121_0007818_7372_8256	266
338	3300048924	Ga0496121_0009197	Ga0496121_0009197_7493_8347	266
339	3300048927	Ga0496124_0022815	Ga0496124_0022815_3206_4009	266
340	3300049568	Ga0501031_0000061	Ga0501031_0000061_28333_29184	266
341	3300049568	Ga0501031_0008225	Ga0501031_0008225_3897_4706	266
342	3300049569	Ga0501032_0000155	Ga0501032_0000155_16560_17411	266
343	3300049569	Ga0501032_0027944	Ga0501032_0027944_1619_2428	266
344	3300049570	Ga0501033_0000217	Ga0501033_0000217_26476_27327	266
345	3300049570	Ga0501033_0263183	Ga0501033_0263183_298_1107	266
346	3300049571	Ga0501034_0001062	Ga0501034_0001062_432_1283	266
347	3300049572	Ga0501036_0002172	Ga0501036_0002172_6096_6947	266
348	3300049572	Ga0501036_0663964	Ga0501036_0663964_14_817	266
349	3300049573	Ga0501037_0000241	Ga0501037_0000241_38310_39161	266
350	3300049574	Ga0501038_0000167	Ga0501038_0000167_28808_29659	266
351	3300049575	Ga0501039_0000153	Ga0501039_0000153_38309_39160	266
352	3300049575	Ga0501039_0044837	Ga0501039_0044837_1477_2286	266
353	3300049575	Ga0501039_0080315	Ga0501039_0080315_1604_2407	266
354	3300049576	Ga0501040_0113971	Ga0501040_0113971_654_1505	266
355	3300049577	Ga0501041_0006202	Ga0501041_0006202_1524_2333	266
356	3300049577	Ga0501041_0058458	Ga0501041_0058458_1472_2275	266
357	3300049578	Ga0501042_0033213	Ga0501042_0033213_170_979	266
358	3300049578	Ga0501042_0132518	Ga0501042_0132518_613_1419	266
359	3300049579	Ga0501043_0000079	Ga0501043_0000079_38839_39690	266
360	3300049579	Ga0501043_0054829	Ga0501043_0054829_1101_1925	266
361	3300049580	Ga0501046_0000400	Ga0501046_0000400_38513_39337	266
362	3300049580	Ga0501046_0007110	Ga0501046_0007110_7670_8521	266
363	3300049581	Ga0501047_0000565	Ga0501047_0000565_28703_29554	266
364	3300049582	Ga0501048_0000141	Ga0501048_0000141_16763_17614	266
365	3300049582	Ga0501048_0034871	Ga0501048_0034871_711_1520	266
366	3300049583	Ga0501067_0007323	Ga0501067_0007323_1975_2826	266
367	3300049583	Ga0501067_0044157	Ga0501067_0044157_1606_2412	266
368	3300049585	Ga0501069_0000117	Ga0501069_0000117_13118_13969	266
369	3300049585	Ga0501069_0130937	Ga0501069_0130937_545_1351	266
370	3300049586	Ga0501070_0000217	Ga0501070_0000217_33612_34463	266
371	3300049586	Ga0501070_0030971	Ga0501070_0030971_2674_3507	266
372	3300049586	Ga0501070_0038787	Ga0501070_0038787_17_826	266
373	3300049586	Ga0501070_0054828	Ga0501070_0054828_513_1316	266
374	3300049587	Ga0501071_0010499	Ga0501071_0010499_2081_2890	266
375	3300049587	Ga0501071_0029390	Ga0501071_0029390_1818_2669	266
376	3300049588	Ga0501072_0008263	Ga0501072_0008263_1229_2038	266
377	3300049589	Ga0501073_0000633	Ga0501073_0000633_19127_19978	266
378	3300049590	Ga0501074_0000226	Ga0501074_0000226_29100_29951	266
379	3300049591	Ga0501075_0027862	Ga0501075_0027862_907_1716	266
380	3300049742	Ga0501080_0000079	Ga0501080_0000079_37540_38391	266
381	3300049742	Ga0501080_0019678	Ga0501080_0019678_4456_5265	266
382	3300049743	Ga0501081_0042312	Ga0501081_0042312_2208_3017	266
383	3300049744	Ga0501083_0017475	Ga0501083_0017475_1833_2684	266
384	3300049822	Ga0501035_0000786	Ga0501035_0000786_32529_33380	266
385	3300049822	Ga0501035_0467181	Ga0501035_0467181_125_928	266
386	3300049823	Ga0501044_0001530	Ga0501044_0001530_9715_10566	266
387	3300049824	Ga0501045_0027611	Ga0501045_0027611_207_1058	266
388	3300050491	nmdc:mga00v17_76637_c1	nmdc:mga00v17_76637_c1_721_1524	266
389	3300050492	nmdc:mga0yw44_184288_c1	nmdc:mga0yw44_184288_c1_11_814	266
390	3300050492	nmdc:mga0yw44_28757_c1	nmdc:mga0yw44_28757_c1_877_1680	266
391	3300050494	nmdc:mga06z11_65691_c1	nmdc:mga06z11_65691_c1_694_1497	266
392	3300050495	nmdc:mga04h51_808_c1	nmdc:mga04h51_808_c1_3336_4139	266
393	3300053140	Ga0500573_0000017	Ga0500573_0000017_110670_111473	266
394	3300054114	Ga0501084_0006789	Ga0501084_0006789_5508_6359	266
395	3300060353	Ga0501082_0145673	Ga0501082_0145673_729_1580	266
396	3300060353	Ga0501082_0208857	Ga0501082_0208857_730_1539	266
397	3300061734	Ga0530510_0040700	Ga0530510_0040700_592_1398	266
398	3300061734	Ga0530510_0295687	Ga0530510_0295687_186_995	266
399	iso_pu_bacteria	2508501039	2508677222	266
400	iso_pu_bacteria	2517572101	2517762870	266
401	iso_pu_bacteria	2675902999	2676201423	266
402	iso_pu_bacteria	2773857921	2774845999	266
403	iso_pu_bacteria	3006486233	3006488675	266
404	iso_pu_bacteria	8002775197	8002776962	266
405	iso_pu_bacteria	8002784119	8002791673	266
406	3300025905	Ga0207685_10018146	Ga0207685_100181462	267
407	3300031251	Ga0265327_10000106	Ga0265327_1000010644	267
408	3300045976	Ga0466967_0342756	Ga0466967_0342756_523_1335	267
409	3300049582	Ga0501048_0167673	Ga0501048_0167673_588_1409	267
410	3300049587	Ga0501071_0413163	Ga0501071_0413163_13_834	267
411	iso_pu_bacteria	2739367653	2739602346	267
412	iso_pu_bacteria	2816332305	2817509152	267
413	iso_pu_bacteria	2857727296	2857728954	267
414	3300003320	rootH2_10139239	rootH2_101392391	271
415	3300049568	Ga0501031_0017246	Ga0501031_0017246_12_851	271
416	3300049568	Ga0501031_0107782	Ga0501031_0107782_690_1505	271
417	3300049571	Ga0501034_0068323	Ga0501034_0068323_1618_2433	271
418	3300049578	Ga0501042_0391780	Ga0501042_0391780_167_982	271
419	3300049579	Ga0501043_0308078	Ga0501043_0308078_302_1117	271
420	3300049581	Ga0501047_0000268	Ga0501047_0000268_13939_14754	271
421	3300049822	Ga0501035_0372715	Ga0501035_0372715_315_1130	271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

164

308

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1gz0-assembly4.cif.gz_E	23s ribosomal rna g2251 2'o-methyltransferase rlmb	0.9265	113	270
2ha8-assembly1.cif.gz_B	methyltransferase domain of human tar (hiv-1) rna binding protein 1	0.9078	123	270
1x7p-assembly1.cif.gz_B	crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet	0.8928	12	269
4x3m-assembly1.cif.gz_B	crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121	0.8911	5	269
5l0z-assembly1.cif.gz_B	crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti	0.891	6	270

ID	Description	Score	Start	End	Superfamily
af_P9WFY3_121_283_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9686	110	270	3.40.1280.10
af_P94978_97_258_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.945	109	270	3.40.1280.10
af_A0A0R0FE30_2_163_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9437	167	269	3.40.1280.10
af_Q557D9_138_303_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9347	122	242	3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain	0.9338	110	270	3.40.1280.10

ID	Description	Score	Start	End	GO Terms
AF-A0A022M7G2-F1-model_v4	Uroporphyrin-III C-methyltransferase	0.984	1	270	GO:0003723 GO:0004851 GO:0006396 GO:0008173 GO:0009236 GO:0016829 GO:0019354 GO:0032259 GO:0043115
AF-A0A0P7GK08-F1-model_v4	rRNA methyltransferase	0.9819	5	271	GO:0003723 GO:0006396 GO:0008173 GO:0032259
AF-A0A1E5KJP0-F1-model_v4	deleted	0.9818	5	271
AF-A0A542G9A9-F1-model_v4	tRNA G18 (Ribose-2'-O)-methylase SpoU	0.9816	5	270	GO:0003723 GO:0006396 GO:0008173 GO:0032259
AF-A0A4Y3W1B3-F1-model_v4	deleted	0.973	132	268

Feature Viewer

pLDDT	pTM	Quality
95.25	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F440137

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00588

SpoU_methylase

SpoU rRNA Methylase family

164

308

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map