F440054

General Info

Members Datasets Scaffolds Average Seq Length
421 272 415 84

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_1734485|Ga0451843_1734485_134_391
Length 85
Sequence MTDATPLPALPPLPDRLSVDPRSPHYVAAVCEHDIGIRFNDKERSDVEEYCISERWIKVPAGKALDRKGQPLMIKLKGTVEVFYK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
5 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
6 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
7 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
246 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
247 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
248 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
258 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
259 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
260 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
269 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.48
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.91
Nodule 0
Rhizoplane 0.71
Rhizosphere 77.43
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2870600 2162886007 Bacteria 1586
2 JGI25405J52794_10057990 3300003911 Bacteria 835
3 Ga0065704_10070999 3300005289 Bacteria 13863
4 Ga0070658_10393396 3300005327 Bacteria 1190
5 Ga0070676_10131583 3300005328 Bacteria 1582
6 Ga0070670_100765454 3300005331 Bacteria 871
7 Ga0070666_10904098 3300005335 Bacteria 653
8 Ga0068868_100054622 3300005338 Bacteria 3149
9 Ga0068868_101773352 3300005338 Bacteria 583
10 Ga0070660_100074414 3300005339 Bacteria 2658
11 Ga0070689_100500764 3300005340 Bacteria 1041
12 Ga0070661_100257927 3300005344 Bacteria 1347
13 Ga0070671_100903009 3300005355 Bacteria 772
14 Ga0070674_100367884 3300005356 Bacteria 1166
15 Ga0070674_100610368 3300005356 Bacteria 923
16 Ga0070667_100678820 3300005367 Bacteria 952
17 Ga0070667_102344472 3300005367 Bacteria 503
18 Ga0070714_100087292 3300005435 Bacteria 2728
19 Ga0070713_101541636 3300005436 Bacteria 645
20 Ga0070663_100085092 3300005455 Bacteria 2333
21 Ga0070663_102060951 3300005455 Bacteria 514
22 Ga0070678_100013811 3300005456 Bacteria 5075
23 Ga0070707_100342683 3300005468 Bacteria 1452
24 Ga0070698_100351396 3300005471 Bacteria 1406
25 Ga0070672_100738007 3300005543 Bacteria 864
26 Ga0070686_100188429 3300005544 Bacteria 1471
27 Ga0070686_101344914 3300005544 Bacteria 598
28 Ga0070665_100066543 3300005548 Bacteria 3614
29 Ga0068855_100271998 3300005563 Bacteria 1884
30 Ga0068855_100714104 3300005563 Bacteria 1072
31 Ga0068855_100893529 3300005563 Bacteria 939
32 Ga0068857_100486477 3300005577 Bacteria 1157
33 Ga0068854_102000725 3300005578 Bacteria 534
34 Ga0068856_100269367 3300005614 Bacteria 1719
35 Ga0068856_100553119 3300005614 Bacteria 1172
36 Ga0068864_100257896 3300005618 Bacteria 1621
37 Ga0068864_102199763 3300005618 Bacteria 558
38 Ga0068866_10631476 3300005718 Bacteria 727
39 Ga0068863_101632362 3300005841 Bacteria 654
40 Ga0068858_100110751 3300005842 Bacteria 2563
41 Ga0068858_100691914 3300005842 Bacteria 992
42 Ga0068858_101596568 3300005842 Bacteria 644
43 Ga0068860_100254923 3300005843 Bacteria 1709
44 Ga0081455_10001040 3300005937 Bacteria 35002
45 Ga0081455_10014867 3300005937 Bacteria 7590
46 Ga0081455_10417654 3300005937 Bacteria 926
47 Ga0081455_10772130 3300005937 Bacteria 605
48 Ga0081539_10079633 3300005985 Bacteria 1726
49 Ga0070717_10461097 3300006028 Bacteria 1146
50 Ga0075365_10135765 3300006038 Bacteria 1705
51 Ga0075365_11263693 3300006038 Bacteria 519
52 Ga0075368_10272827 3300006042 Bacteria 726
53 Ga0075363_100227581 3300006048 Bacteria 1070
54 Ga0075363_100311039 3300006048 Bacteria 915
55 Ga0070716_100289027 3300006173 Bacteria 1135
56 Ga0075362_10004302 3300006177 Bacteria 5092
57 Ga0075362_10060414 3300006177 Bacteria 1713
58 Ga0075367_10467320 3300006178 Bacteria 800
59 Ga0075369_10015613 3300006186 Bacteria 3051
60 Ga0075366_10212413 3300006195 Bacteria 1178
61 Ga0097621_100347383 3300006237 Bacteria 1318
62 Ga0097621_101368477 3300006237 Bacteria 670
63 Ga0075370_10073793 3300006353 Bacteria 1955
64 Ga0068871_100187897 3300006358 Bacteria 1778
65 Ga0075428_101038748 3300006844 Bacteria 867
66 Ga0075429_101316478 3300006880 Bacteria 630
67 Ga0068865_100315303 3300006881 Bacteria 1256
68 Ga0105245_10065841 3300009098 Bacteria 3278
69 Ga0105243_10322780 3300009148 Bacteria 1408
70 Ga0105242_10745964 3300009176 Bacteria 963
71 Ga0105242_12419988 3300009176 Bacteria 573
72 Ga0105248_10237129 3300009177 Bacteria 2053
73 Ga0105237_10571560 3300009545 Bacteria 1137
74 Ga0105238_10899655 3300009551 Bacteria 903
75 Ga0105239_10206501 3300010375 Bacteria 2201
76 Ga0105239_12062720 3300010375 Bacteria 662
77 Ga0105246_10575173 3300011119 Bacteria 969
78 Ga0105246_11386118 3300011119 Bacteria 655
79 Ga0157373_11049701 3300013100 Bacteria 610
80 Ga0157371_10211650 3300013102 Bacteria 1391
81 Ga0157370_10296629 3300013104 Bacteria 1493
82 Ga0157370_10336611 3300013104 Bacteria 1391
83 Ga0157370_11632647 3300013104 Bacteria 579
84 Ga0157369_10524399 3300013105 Bacteria 1225
85 Ga0157378_10321000 3300013297 Bacteria 1504
86 Ga0163162_11126985 3300013306 Bacteria 889
87 Ga0157372_10410312 3300013307 Bacteria 1578
88 Ga0157375_11629855 3300013308 Bacteria 763
89 Ga0163163_10230872 3300014325 Bacteria 1899
90 Ga0157376_10953795 3300014969 Bacteria 878
91 Ga0206349_1969995 3300020075 Bacteria 1099
92 Ga0213872_10074245 3300021361 Bacteria 1531
93 Ga0213874_10232048 3300021377 Bacteria 674
94 Ga0213875_10109267 3300021388 Bacteria 1291
95 Ga0209025_1000503 3300025294 Bacteria 75048
96 Ga0207645_10113257 3300025907 Bacteria 1757
97 Ga0207643_10741035 3300025908 Bacteria 636
98 Ga0207684_10165455 3300025910 Bacteria 1905
99 Ga0207660_11647309 3300025917 Bacteria 517
100 Ga0207657_10081077 3300025919 Bacteria 2726
101 Ga0207646_10423184 3300025922 Bacteria 1202
102 Ga0207694_11124409 3300025924 Bacteria 665
103 Ga0207659_10603832 3300025926 Bacteria 936
104 Ga0207664_10324176 3300025929 Bacteria 1359
105 Ga0207644_10804829 3300025931 Bacteria 786
106 Ga0207706_10534579 3300025933 Bacteria 1010
107 Ga0207669_10249774 3300025937 Bacteria 1320
108 Ga0207669_10999203 3300025937 Bacteria 703
109 Ga0207669_11241924 3300025937 Bacteria 632
110 Ga0207704_10182273 3300025938 Bacteria 1519
111 Ga0207691_10870354 3300025940 Bacteria 755
112 Ga0207711_10509496 3300025941 Bacteria 1122
113 Ga0207679_11939128 3300025945 Bacteria 537
114 Ga0207668_10772658 3300025972 Bacteria 849
115 Ga0207640_10560577 3300025981 Bacteria 961
116 Ga0207658_12057003 3300025986 Bacteria 519
117 Ga0207677_10137950 3300026023 Bacteria 1863
118 Ga0207677_11552824 3300026023 Bacteria 612
119 Ga0207703_10059701 3300026035 Bacteria 3116
120 Ga0207703_10865625 3300026035 Bacteria 864
121 Ga0207703_11950910 3300026035 Bacteria 563
122 Ga0207678_10087337 3300026067 Bacteria 2665
123 Ga0207702_11072008 3300026078 Bacteria 800
124 Ga0207641_12387142 3300026088 Bacteria 528
125 Ga0207676_10195633 3300026095 Bacteria 1783
126 Ga0207674_10048552 3300026116 Bacteria 4344
127 Ga0207698_10964952 3300026142 Bacteria 862
128 Ga0268266_10384512 3300028379 Bacteria 1324
129 Ga0268266_10511459 3300028379 Bacteria 1147
130 Ga0268265_11067683 3300028380 Bacteria 800
131 Ga0268264_10255463 3300028381 Bacteria 1630
132 Ga0265760_10343650 3300031090 Bacteria 533
133 Ga0265331_10398997 3300031250 Bacteria 617
134 Ga0307513_10157695 3300031456 Bacteria 2166
135 Ga0307412_10584938 3300031911 Bacteria 943
136 Ga0307411_11227178 3300032005 Bacteria 681
137 Ga0373959_0136093 3300034820 Bacteria 611
138 Ga0373926_0345517 3300035083 Bacteria 584
139 Ga0373936_0220749 3300035113 Bacteria 841
140 Ga0373953_0006019 3300035117 Bacteria 3973
141 Ga0373954_0034086 3300035118 Bacteria 2356
142 Ga0373956_0103504 3300035119 Bacteria 1322
143 Ga0373957_0199637 3300035120 Bacteria 833
144 Ga0373943_0638953 3300035170 Bacteria 628
145 Ga0373955_0012096 3300035172 Bacteria 4139
146 Ga0373935_0142508 3300035692 Bacteria 1620
147 Ga0373927_0153829 3300035695 Bacteria 1506
148 Ga0373947_1268660 3300035725 Bacteria 502
149 Ga0373937_0024035 3300036401 Bacteria 5494
150 Ga0373937_2025786 3300036401 Bacteria 522
151 Ga0373925_0052067 3300037068 Bacteria 3058
152 Ga0373925_0329348 3300037068 Bacteria 1237
153 Ga0395900_0191946 3300037418 Bacteria 2071
154 Ga0436364_0577370 3300037853 Bacteria 1412
155 Ga0436364_0885971 3300037853 Bacteria 3939
156 Ga0395901_0252542 3300038443 Bacteria 1837
157 Ga0395901_1332569 3300038443 Bacteria 678
158 Ga0436361_0447126 3300039447 Bacteria 2400
159 Ga0439465_0051682 3300041413 Bacteria 1347
160 Ga0439465_0129135 3300041413 Bacteria 891
161 Ga0451787_460550 3300041441 Bacteria 580
162 Ga0451791_1708321 3300041451 Bacteria 533
163 Ga0451793_1764054 3300041452 Bacteria 749
164 Ga0451841_0310947 3300041498 Bacteria 603
165 Ga0451843_1734485 3300041509 Bacteria 638
166 Ga0439431_0026242 3300041997 Bacteria 1427
167 Ga0439432_146620 3300042006 Bacteria 693
168 Ga0466972_0040441 3300044658 Bacteria 2272
169 Ga0466963_0188613 3300044694 Bacteria 1440
170 Ga0466964_0049538 3300044706 Bacteria 1720
171 Ga0466970_0199183 3300044765 Bacteria 1114
172 Ga0466957_0051482 3300044842 Bacteria 2507
173 Ga0466967_0046187 3300045976 Bacteria 3790
174 Ga0466967_0287945 3300045976 Bacteria 1577
175 Ga0495617_037715 3300046452 Bacteria 1618
176 Ga0495590_0169354 3300046457 Bacteria 796
177 Ga0495590_0204625 3300046457 Bacteria 726
178 Ga0495638_0042147 3300046460 Bacteria 2884
179 Ga0495638_0061674 3300046460 Bacteria 2316
180 Ga0495662_0246505 3300046476 Bacteria 880
181 Ga0495584_0004090 3300046491 Bacteria 7874
182 Ga0495596_0255666 3300046500 Bacteria 680
183 Ga0495607_0039351 3300046501 Bacteria 2824
184 Ga0495606_0081245 3300046507 Bacteria 2015
185 Ga0495606_0481652 3300046507 Bacteria 630
186 Ga0495608_0138325 3300046511 Bacteria 1555
187 Ga0495610_0097245 3300046512 Bacteria 1324
188 Ga0495616_0044911 3300046513 Bacteria 2239
189 Ga0495616_0179666 3300046513 Bacteria 941
190 Ga0495618_0284746 3300046514 Bacteria 1030
191 Ga0495620_0020821 3300046515 Bacteria 3195
192 Ga0495628_0984919 3300046516 Bacteria 581
193 Ga0495631_0035097 3300046518 Bacteria 2245
194 Ga0495637_0020824 3300046520 Bacteria 3011
195 Ga0495648_0040213 3300046524 Bacteria 2967
196 Ga0495654_0113406 3300046530 Bacteria 1234
197 Ga0495597_0142246 3300046542 Bacteria 989
198 Ga0495634_0037009 3300046642 Bacteria 3336
199 Ga0495611_0466692 3300046648 Bacteria 575
200 Ga0495635_0177203 3300046663 Bacteria 1449
201 Ga0495661_0045077 3300046665 Bacteria 2698
202 Ga0495657_0100812 3300046675 Bacteria 1840
203 Ga0495599_0489704 3300046678 Bacteria 725
204 Ga0495647_0395054 3300046681 Bacteria 634
205 Ga0495613_0555275 3300046689 Bacteria 768
206 Ga0495670_0009149 3300046691 Bacteria 4871
207 Ga0495589_0407991 3300046794 Bacteria 623
208 Ga0495581_0173045 3300047315 Bacteria 1263
209 Ga0495604_0058921 3300047317 Bacteria 2947
210 Ga0495674_0145484 3300047319 Bacteria 1990
211 Ga0495680_0133539 3300047322 Bacteria 1821
212 Ga0495681_0076368 3300047470 Bacteria 1506
213 Ga0495686_0077550 3300047472 Bacteria 2034
214 Ga0495602_0117318 3300048088 Bacteria 2149
215 Ga0495602_0450378 3300048088 Bacteria 909
216 Ga0495626_0076327 3300048091 Bacteria 1496
217 Ga0496117_0053209 3300048920 Bacteria 2846
218 Ga0496118_0387689 3300048921 Bacteria 730
219 Ga0496119_0001222 3300048922 Bacteria 31999
220 Ga0496119_0098266 3300048922 Bacteria 1648
221 Ga0496120_0128216 3300048923 Bacteria 1303
222 Ga0496121_0006808 3300048924 Bacteria 14001
223 Ga0496121_0230666 3300048924 Bacteria 1297
224 Ga0496122_0063932 3300048925 Bacteria 2681
225 Ga0496123_0106950 3300048926 Bacteria 1610
226 Ga0496124_0084799 3300048927 Bacteria 2597
227 Ga0496125_0000202 3300048928 Bacteria 125963
228 Ga0496125_0390150 3300048928 Bacteria 817
229 Ga0496126_0097306 3300048929 Bacteria 2579
230 Ga0501031_0006086 3300049568 Bacteria 7878
231 Ga0501031_0083361 3300049568 Bacteria 2083
232 Ga0501031_0439587 3300049568 Bacteria 843
233 Ga0501031_0804143 3300049568 Bacteria 603
234 Ga0501032_0000257 3300049569 Bacteria 44325
235 Ga0501032_0002240 3300049569 Bacteria 15223
236 Ga0501032_0064522 3300049569 Bacteria 2451
237 Ga0501032_0109291 3300049569 Bacteria 1830
238 Ga0501032_0227998 3300049569 Bacteria 1211
239 Ga0501033_0000244 3300049570 Bacteria 52231
240 Ga0501033_0000803 3300049570 Bacteria 28734
241 Ga0501033_0037855 3300049570 Bacteria 3609
242 Ga0501033_0060736 3300049570 Bacteria 2787
243 Ga0501034_0000159 3300049571 Bacteria 127397
244 Ga0501034_0013985 3300049571 Bacteria 8260
245 Ga0501034_0019040 3300049571 Bacteria 7033
246 Ga0501034_0130540 3300049571 Bacteria 2496
247 Ga0501034_0271819 3300049571 Bacteria 1635
248 Ga0501036_0000039 3300049572 Bacteria 83065
249 Ga0501036_0000104 3300049572 Bacteria 52974
250 Ga0501036_0075416 3300049572 Bacteria 2852
251 Ga0501036_0163399 3300049572 Bacteria 1877
252 Ga0501036_1461202 3300049572 Bacteria 553
253 Ga0501037_0001025 3300049573 Bacteria 20644
254 Ga0501037_0001386 3300049573 Bacteria 17773
255 Ga0501037_0144400 3300049573 Bacteria 1702
256 Ga0501037_0316942 3300049573 Bacteria 1080
257 Ga0501037_0501351 3300049573 Bacteria 823
258 Ga0501038_0000041 3300049574 Bacteria 120557
259 Ga0501038_0000207 3300049574 Bacteria 50307
260 Ga0501038_0006348 3300049574 Bacteria 10941
261 Ga0501038_0019269 3300049574 Bacteria 6154
262 Ga0501038_0019594 3300049574 Bacteria 6094
263 Ga0501038_0422830 3300049574 Bacteria 1028
264 Ga0501039_0000064 3300049575 Bacteria 83415
265 Ga0501039_0000148 3300049575 Bacteria 47789
266 Ga0501039_0085337 3300049575 Bacteria 2459
267 Ga0501039_0177971 3300049575 Bacteria 1672
268 Ga0501039_0295894 3300049575 Bacteria 1272
269 Ga0501040_0069289 3300049576 Bacteria 2433
270 Ga0501040_0139875 3300049576 Bacteria 1705
271 Ga0501040_0152437 3300049576 Bacteria 1631
272 Ga0501041_0475516 3300049577 Bacteria 794
273 Ga0501042_0152464 3300049578 Bacteria 1666
274 Ga0501043_0000202 3300049579 Bacteria 54441
275 Ga0501043_0012725 3300049579 Bacteria 6576
276 Ga0501043_0085639 3300049579 Bacteria 2476
277 Ga0501043_0142418 3300049579 Bacteria 1877
278 Ga0501043_0212341 3300049579 Bacteria 1499
279 Ga0501043_0422643 3300049579 Bacteria 1004
280 Ga0501046_0000185 3300049580 Bacteria 63459
281 Ga0501046_0278561 3300049580 Bacteria 1225
282 Ga0501046_0286078 3300049580 Bacteria 1206
283 Ga0501047_0000385 3300049581 Bacteria 49635
284 Ga0501047_0000392 3300049581 Bacteria 49114
285 Ga0501047_0092123 3300049581 Bacteria 2909
286 Ga0501047_0195740 3300049581 Bacteria 1883
287 Ga0501047_0898034 3300049581 Bacteria 699
288 Ga0501048_0000536 3300049582 Bacteria 26743
289 Ga0501048_0075538 3300049582 Bacteria 2377
290 Ga0501048_0098346 3300049582 Bacteria 2064
291 Ga0501067_0005941 3300049583 Bacteria 6765
292 Ga0501067_0015707 3300049583 Bacteria 4189
293 Ga0501067_0262938 3300049583 Bacteria 960
294 Ga0501067_0381744 3300049583 Bacteria 786
295 Ga0501067_0647611 3300049583 Bacteria 593
296 Ga0501068_0004880 3300049584 Bacteria 7303
297 Ga0501068_0111701 3300049584 Bacteria 1699
298 Ga0501068_0201146 3300049584 Bacteria 1263
299 Ga0501068_0878862 3300049584 Bacteria 589
300 Ga0501069_0002806 3300049585 Bacteria 8910
301 Ga0501069_0024732 3300049585 Bacteria 3277
302 Ga0501069_0079567 3300049585 Bacteria 1845
303 Ga0501070_0000209 3300049586 Bacteria 55271
304 Ga0501070_0000557 3300049586 Bacteria 34014
305 Ga0501070_0096946 3300049586 Bacteria 2439
306 Ga0501070_0286327 3300049586 Bacteria 1344
307 Ga0501071_0124752 3300049587 Bacteria 1910
308 Ga0501071_0133610 3300049587 Bacteria 1845
309 Ga0501071_0273951 3300049587 Bacteria 1276
310 Ga0501072_0029712 3300049588 Bacteria 4270
311 Ga0501072_0099976 3300049588 Bacteria 2305
312 Ga0501072_0580223 3300049588 Bacteria 885
313 Ga0501073_0000034 3300049589 Bacteria 95224
314 Ga0501073_0008907 3300049589 Bacteria 7417
315 Ga0501073_0025141 3300049589 Bacteria 4273
316 Ga0501073_0575971 3300049589 Bacteria 778
317 Ga0501073_0951316 3300049589 Bacteria 591
318 Ga0501074_0000271 3300049590 Bacteria 29628
319 Ga0501074_0074571 3300049590 Bacteria 2436
320 Ga0501074_0087620 3300049590 Bacteria 2229
321 Ga0501074_0292500 3300049590 Bacteria 1157
322 Ga0501075_0163986 3300049591 Bacteria 1695
323 Ga0501076_0023364 3300049592 Bacteria 4765
324 Ga0501076_0038722 3300049592 Bacteria 3743
325 Ga0501077_0070303 3300049593 Bacteria 2218
326 Ga0501242_023982 3300049674 Bacteria 798
327 Ga0501079_0033756 3300049741 Bacteria 3937
328 Ga0501079_0425777 3300049741 Bacteria 1042
329 Ga0501080_0010052 3300049742 Bacteria 8649
330 Ga0501080_0104752 3300049742 Bacteria 2623
331 Ga0501080_0289846 3300049742 Bacteria 1486
332 Ga0501080_1475280 3300049742 Bacteria 579
333 Ga0501081_0067901 3300049743 Bacteria 2481
334 Ga0501083_0000118 3300049744 Bacteria 54096
335 Ga0501083_0126044 3300049744 Bacteria 1678
336 Ga0501083_0196469 3300049744 Bacteria 1316
337 Ga0501035_0000137 3300049822 Bacteria 89273
338 Ga0501035_0000155 3300049822 Bacteria 84012
339 Ga0501035_0066864 3300049822 Bacteria 3189
340 Ga0501035_0849091 3300049822 Bacteria 726
341 Ga0501044_0000548 3300049823 Bacteria 45787
342 Ga0501044_0001941 3300049823 Bacteria 23927
343 Ga0501044_0006837 3300049823 Bacteria 12569
344 Ga0501044_0068034 3300049823 Bacteria 3628
345 Ga0501044_0286542 3300049823 Bacteria 1579
346 Ga0501044_0291140 3300049823 Bacteria 1564
347 Ga0501044_0691866 3300049823 Bacteria 905
348 Ga0501045_0010495 3300049824 Bacteria 6489
349 Ga0501045_0082202 3300049824 Bacteria 2375
350 Ga0501045_0238528 3300049824 Bacteria 1354
351 Ga0501045_0389996 3300049824 Bacteria 1037
352 nmdc:mga03683_233545_c1 3300050489 Bacteria 851
353 nmdc:mga03683_276897_c1 3300050489 Bacteria 783
354 nmdc:mga03683_97367_c1 3300050489 Bacteria 1289
355 nmdc:mga00v17_444403_c1 3300050491 Bacteria 842
356 nmdc:mga00v17_481070_c1 3300050491 Bacteria 805
357 nmdc:mga0yw44_504102_c1 3300050492 Bacteria 821
358 nmdc:mga0yw44_82777_c1 3300050492 Bacteria 2014
359 nmdc:mga0yw44_96981_c1 3300050492 Bacteria 1872
360 nmdc:mga0k408_605027_c1 3300050493 Bacteria 646
361 nmdc:mga0k408_773654_c1 3300050493 Bacteria 560
362 nmdc:mga06z11_308500_c1 3300050494 Bacteria 942
363 nmdc:mga0n895_488584_c1 3300050512 Bacteria 1241
364 nmdc:mga0sz30_81761_c1 3300050516 Bacteria 1398
365 Ga0495595_0007970 3300053084 Bacteria 4338
366 Ga0495619_0006461 3300053085 Bacteria 7422
367 Ga0500643_033261 3300053087 Bacteria 1560
368 Ga0500643_037822 3300053087 Bacteria 1434
369 Ga0500581_026824 3300053089 Bacteria 2933
370 Ga0500646_0010066 3300053090 Bacteria 2423
371 Ga0500651_0113533 3300053093 Bacteria 1651
372 Ga0500566_0002225 3300053094 Bacteria 11453
373 Ga0500641_0114106 3300053096 Bacteria 1163
374 Ga0500650_0097372 3300053098 Bacteria 1377
375 Ga0500555_079100 3300053103 Bacteria 858
376 Ga0500556_0000039 3300053104 Bacteria 138158
377 Ga0500556_0000089 3300053104 Bacteria 84468
378 Ga0500557_247011 3300053105 Bacteria 559
379 Ga0500569_003630 3300053109 Bacteria 3175
380 Ga0500592_015002 3300053116 Bacteria 1242
381 Ga0500593_128835 3300053117 Bacteria 1014
382 Ga0500594_0004950 3300053118 Bacteria 2946
383 Ga0500608_048253 3300053122 Bacteria 2045
384 Ga0500642_0000030 3300053130 Bacteria 115114
385 Ga0500652_011224 3300053131 Bacteria 3098
386 Ga0500658_0099824 3300053134 Bacteria 1265
387 Ga0500658_0113697 3300053134 Bacteria 1194
388 Ga0500559_0000136 3300053136 Bacteria 56922
389 Ga0500559_0057068 3300053136 Bacteria 1734
390 Ga0500561_0197480 3300053137 Bacteria 636
391 Ga0500568_0001368 3300053139 Bacteria 15849
392 Ga0500577_0259271 3300053142 Bacteria 756
393 Ga0500577_0294865 3300053142 Bacteria 708
394 Ga0500586_000203 3300053145 Bacteria 11555
395 Ga0500588_0127909 3300053146 Bacteria 902
396 Ga0500590_283214 3300053148 Bacteria 635
397 Ga0500604_0231978 3300053151 Bacteria 637
398 Ga0500616_0000026 3300053153 Bacteria 454314
399 Ga0500616_0000028 3300053153 Bacteria 435722
400 Ga0500616_0267448 3300053153 Bacteria 723
401 Ga0500622_0001149 3300053156 Bacteria 22026
402 Ga0500627_0247000 3300053158 Bacteria 790
403 Ga0500633_0288662 3300053160 Bacteria 605
404 Ga0500634_0041575 3300053161 Bacteria 2496
405 Ga0500636_0010184 3300053177 Bacteria 5483
406 Ga0500636_0029180 3300053177 Bacteria 3258
407 Ga0500567_104441 3300053723 Bacteria 1169
408 Ga0500611_117675 3300053727 Bacteria 705
409 Ga0500645_052355 3300053730 Bacteria 1189
410 Ga0501084_0003978 3300054114 Bacteria 12040
411 Ga0501084_0083622 3300054114 Bacteria 2679
412 Ga0501084_1045068 3300054114 Bacteria 686
413 Ga0501082_0061815 3300060353 Bacteria 3223
414 Ga0501082_0078362 3300060353 Bacteria 2850
415 Ga0501082_0482577 3300060353 Bacteria 1083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2904541872 2904549262 74
2 iso_pu_bacteria 2929160207 2929161438 74
3 3300005328 Ga0070676_10131583 Ga0070676_101315832 77
4 3300005335 Ga0070666_10904098 Ga0070666_109040982 77
5 3300005355 Ga0070671_100903009 Ga0070671_1009030091 77
6 3300005367 Ga0070667_102344472 Ga0070667_1023444721 77
7 3300005435 Ga0070714_100087292 Ga0070714_1000872922 77
8 3300005455 Ga0070663_100085092 Ga0070663_1000850921 77
9 3300005456 Ga0070678_100013811 Ga0070678_1000138113 77
10 3300005543 Ga0070672_100738007 Ga0070672_1007380072 77
11 3300005563 Ga0068855_100893529 Ga0068855_1008935292 77
12 3300006048 Ga0075363_100311039 Ga0075363_1003110392 77
13 3300006237 Ga0097621_101368477 Ga0097621_1013684772 77
14 3300006353 Ga0075370_10073793 Ga0075370_100737931 77
15 3300009176 Ga0105242_12419988 Ga0105242_124199882 77
16 3300013306 Ga0163162_11126985 Ga0163162_111269852 77
17 3300014969 Ga0157376_10953795 Ga0157376_109537952 77
18 3300025294 Ga0209025_1000503 Ga0209025_100050356 77
19 3300025907 Ga0207645_10113257 Ga0207645_101132572 77
20 3300025929 Ga0207664_10324176 Ga0207664_103241762 77
21 3300025931 Ga0207644_10804829 Ga0207644_108048292 77
22 3300025937 Ga0207669_10249774 Ga0207669_102497742 77
23 3300025940 Ga0207691_10870354 Ga0207691_108703542 77
24 3300025986 Ga0207658_12057003 Ga0207658_120570032 77
25 3300026067 Ga0207678_10087337 Ga0207678_100873372 77
26 3300031456 Ga0307513_10157695 Ga0307513_101576952 77
27 3300031911 Ga0307412_10584938 Ga0307412_105849382 77
28 3300034820 Ga0373959_0136093 Ga0373959_0136093_268_534 77
29 3300035725 Ga0373947_1268660 Ga0373947_1268660_240_476 77
30 3300037068 Ga0373925_0329348 Ga0373925_0329348_433_669 77
31 3300041451 Ga0451791_1708321 Ga0451791_1708321_147_404 77
32 3300041452 Ga0451793_1764054 Ga0451793_1764054_462_716 77
33 3300041498 Ga0451841_0310947 Ga0451841_0310947_50_304 77
34 3300041509 Ga0451843_1734485 Ga0451843_1734485_134_391 77
35 3300046460 Ga0495638_0061674 Ga0495638_0061674_938_1192 77
36 3300046500 Ga0495596_0255666 Ga0495596_0255666_404_658 77
37 3300046501 Ga0495607_0039351 Ga0495607_0039351_181_435 77
38 3300046507 Ga0495606_0081245 Ga0495606_0081245_1737_1991 77
39 3300046512 Ga0495610_0097245 Ga0495610_0097245_142_396 77
40 3300046513 Ga0495616_0044911 Ga0495616_0044911_248_502 77
41 3300046515 Ga0495620_0020821 Ga0495620_0020821_2135_2389 77
42 3300046516 Ga0495628_0984919 Ga0495628_0984919_163_417 77
43 3300046518 Ga0495631_0035097 Ga0495631_0035097_408_662 77
44 3300046520 Ga0495637_0020824 Ga0495637_0020824_2418_2672 77
45 3300046524 Ga0495648_0040213 Ga0495648_0040213_2466_2720 77
46 3300046530 Ga0495654_0113406 Ga0495654_0113406_310_564 77
47 3300046542 Ga0495597_0142246 Ga0495597_0142246_624_878 77
48 3300046665 Ga0495661_0045077 Ga0495661_0045077_1693_1947 77
49 3300046689 Ga0495613_0555275 Ga0495613_0555275_362_616 77
50 3300046691 Ga0495670_0009149 Ga0495670_0009149_2690_2944 77
51 3300046794 Ga0495589_0407991 Ga0495589_0407991_109_363 77
52 3300047470 Ga0495681_0076368 Ga0495681_0076368_148_402 77
53 3300047472 Ga0495686_0077550 Ga0495686_0077550_1163_1417 77
54 3300048088 Ga0495602_0450378 Ga0495602_0450378_167_421 77
55 3300048091 Ga0495626_0076327 Ga0495626_0076327_855_1109 77
56 3300048920 Ga0496117_0053209 Ga0496117_0053209_348_602 77
57 3300048921 Ga0496118_0387689 Ga0496118_0387689_175_429 77
58 3300048922 Ga0496119_0098266 Ga0496119_0098266_429_683 77
59 3300048923 Ga0496120_0128216 Ga0496120_0128216_306_560 77
60 3300048924 Ga0496121_0006808 Ga0496121_0006808_6548_6802 77
61 3300048925 Ga0496122_0063932 Ga0496122_0063932_1653_1907 77
62 3300048926 Ga0496123_0106950 Ga0496123_0106950_733_987 77
63 3300048927 Ga0496124_0084799 Ga0496124_0084799_1536_1790 77
64 3300048928 Ga0496125_0000202 Ga0496125_0000202_20349_20603 77
65 3300048928 Ga0496125_0390150 Ga0496125_0390150_120_374 77
66 3300048929 Ga0496126_0097306 Ga0496126_0097306_102_356 77
67 3300053087 Ga0500643_033261 Ga0500643_033261_1280_1534 77
68 3300053087 Ga0500643_037822 Ga0500643_037822_131_385 77
69 3300053089 Ga0500581_026824 Ga0500581_026824_1482_1736 77
70 3300053090 Ga0500646_0010066 Ga0500646_0010066_2057_2311 77
71 3300053093 Ga0500651_0113533 Ga0500651_0113533_1385_1639 77
72 3300053094 Ga0500566_0002225 Ga0500566_0002225_2185_2439 77
73 3300053096 Ga0500641_0114106 Ga0500641_0114106_647_901 77
74 3300053098 Ga0500650_0097372 Ga0500650_0097372_553_807 77
75 3300053103 Ga0500555_079100 Ga0500555_079100_294_548 77
76 3300053104 Ga0500556_0000089 Ga0500556_0000089_2622_2876 77
77 3300053105 Ga0500557_247011 Ga0500557_247011_130_384 77
78 3300053109 Ga0500569_003630 Ga0500569_003630_1712_1966 77
79 3300053116 Ga0500592_015002 Ga0500592_015002_70_324 77
80 3300053117 Ga0500593_128835 Ga0500593_128835_441_695 77
81 3300053118 Ga0500594_0004950 Ga0500594_0004950_555_809 77
82 3300053122 Ga0500608_048253 Ga0500608_048253_852_1106 77
83 3300053130 Ga0500642_0000030 Ga0500642_0000030_107573_107827 77
84 3300053131 Ga0500652_011224 Ga0500652_011224_2271_2525 77
85 3300053134 Ga0500658_0099824 Ga0500658_0099824_874_1128 77
86 3300053136 Ga0500559_0000136 Ga0500559_0000136_54527_54781 77
87 3300053139 Ga0500568_0001368 Ga0500568_0001368_15021_15275 77
88 3300053142 Ga0500577_0259271 Ga0500577_0259271_238_492 77
89 3300053145 Ga0500586_000203 Ga0500586_000203_6981_7235 77
90 3300053146 Ga0500588_0127909 Ga0500588_0127909_245_499 77
91 3300053148 Ga0500590_283214 Ga0500590_283214_326_580 77
92 3300053151 Ga0500604_0231978 Ga0500604_0231978_183_437 77
93 3300053153 Ga0500616_0000026 Ga0500616_0000026_86213_86467 77
94 3300053156 Ga0500622_0001149 Ga0500622_0001149_19623_19877 77
95 3300053158 Ga0500627_0247000 Ga0500627_0247000_111_365 77
96 3300053160 Ga0500633_0288662 Ga0500633_0288662_96_350 77
97 3300053177 Ga0500636_0010184 Ga0500636_0010184_2315_2569 77
98 3300053723 Ga0500567_104441 Ga0500567_104441_56_310 77
99 3300053727 Ga0500611_117675 Ga0500611_117675_47_301 77
100 3300053730 Ga0500645_052355 Ga0500645_052355_619_873 77
101 iso_pu_bacteria 2857524615 2857529844 77
102 iso_pu_bacteria 2893066018 2893069509 77
103 iso_pu_bacteria 2919073203 2919077300 77
104 3300003911 JGI25405J52794_10057990 JGI25405J52794_100579902 78
105 3300005338 Ga0068868_101773352 Ga0068868_1017733522 78
106 3300005340 Ga0070689_100500764 Ga0070689_1005007641 78
107 3300005548 Ga0070665_100066543 Ga0070665_1000665434 78
108 3300005563 Ga0068855_100714104 Ga0068855_1007141042 78
109 3300005577 Ga0068857_100486477 Ga0068857_1004864772 78
110 3300005578 Ga0068854_102000725 Ga0068854_1020007252 78
111 3300005614 Ga0068856_100553119 Ga0068856_1005531192 78
112 3300005842 Ga0068858_101596568 Ga0068858_1015965682 78
113 3300005937 Ga0081455_10001040 Ga0081455_100010406 78
114 3300005937 Ga0081455_10014867 Ga0081455_100148675 78
115 3300005937 Ga0081455_10417654 Ga0081455_104176542 78
116 3300005937 Ga0081455_10772130 Ga0081455_107721302 78
117 3300005985 Ga0081539_10079633 Ga0081539_100796332 78
118 3300006038 Ga0075365_10135765 Ga0075365_101357652 78
119 3300006042 Ga0075368_10272827 Ga0075368_102728272 78
120 3300006048 Ga0075363_100227581 Ga0075363_1002275812 78
121 3300006177 Ga0075362_10004302 Ga0075362_100043022 78
122 3300006177 Ga0075362_10060414 Ga0075362_100604143 78
123 3300006178 Ga0075367_10467320 Ga0075367_104673202 78
124 3300006186 Ga0075369_10015613 Ga0075369_100156134 78
125 3300006195 Ga0075366_10212413 Ga0075366_102124132 78
126 3300009148 Ga0105243_10322780 Ga0105243_103227801 78
127 3300010375 Ga0105239_12062720 Ga0105239_120627202 78
128 3300013100 Ga0157373_11049701 Ga0157373_110497012 78
129 3300013104 Ga0157370_10336611 Ga0157370_103366112 78
130 3300013104 Ga0157370_11632647 Ga0157370_116326472 78
131 3300025908 Ga0207643_10741035 Ga0207643_107410352 78
132 3300025926 Ga0207659_10603832 Ga0207659_106038322 78
133 3300025945 Ga0207679_11939128 Ga0207679_119391282 78
134 3300026035 Ga0207703_11950910 Ga0207703_119509102 78
135 3300026078 Ga0207702_11072008 Ga0207702_110720082 78
136 3300026116 Ga0207674_10048552 Ga0207674_100485522 78
137 3300028379 Ga0268266_10384512 Ga0268266_103845122 78
138 3300050489 nmdc:mga03683_97367_c1 nmdc:mga03683_97367_c1_1019_1276 78
139 3300050492 nmdc:mga0yw44_96981_c1 nmdc:mga0yw44_96981_c1_17_274 78
140 3300050493 nmdc:mga0k408_773654_c1 nmdc:mga0k408_773654_c1_25_282 78
141 3300050516 nmdc:mga0sz30_81761_c1 nmdc:mga0sz30_81761_c1_625_882 78
142 3300053136 Ga0500559_0057068 Ga0500559_0057068_1123_1380 78
143 3300053161 Ga0500634_0041575 Ga0500634_0041575_325_582 78
144 3300005544 Ga0070686_101344914 Ga0070686_1013449142 79
145 3300026023 Ga0207677_11552824 Ga0207677_115528242 79
146 3300044658 Ga0466972_0040441 Ga0466972_0040441_421_660 79
147 3300044694 Ga0466963_0188613 Ga0466963_0188613_985_1227 79
148 3300044706 Ga0466964_0049538 Ga0466964_0049538_351_593 79
149 3300044765 Ga0466970_0199183 Ga0466970_0199183_274_513 79
150 3300044842 Ga0466957_0051482 Ga0466957_0051482_68_310 79
151 3300045976 Ga0466967_0287945 Ga0466967_0287945_852_1094 79
152 3300046507 Ga0495606_0481652 Ga0495606_0481652_205_465 79
153 3300049823 Ga0501044_0291140 Ga0501044_0291140_771_1013 79
154 3300050489 nmdc:mga03683_233545_c1 nmdc:mga03683_233545_c1_583_834 79
155 3300050491 nmdc:mga00v17_444403_c1 nmdc:mga00v17_444403_c1_221_472 79
156 3300050491 nmdc:mga00v17_481070_c1 nmdc:mga00v17_481070_c1_419_670 79
157 3300050492 nmdc:mga0yw44_504102_c1 nmdc:mga0yw44_504102_c1_28_279 79
158 3300050492 nmdc:mga0yw44_82777_c1 nmdc:mga0yw44_82777_c1_867_1118 79
159 3300050493 nmdc:mga0k408_605027_c1 nmdc:mga0k408_605027_c1_379_630 79
160 3300050494 nmdc:mga06z11_308500_c1 nmdc:mga06z11_308500_c1_331_582 79
161 3300053137 Ga0500561_0197480 Ga0500561_0197480_20_280 79
162 3300053142 Ga0500577_0294865 Ga0500577_0294865_249_488 79
163 3300053177 Ga0500636_0029180 Ga0500636_0029180_2647_2907 79
164 3300005338 Ga0068868_100054622 Ga0068868_1000546223 80
165 3300005344 Ga0070661_100257927 Ga0070661_1002579274 80
166 3300005367 Ga0070667_100678820 Ga0070667_1006788202 80
167 3300005455 Ga0070663_102060951 Ga0070663_1020609512 80
168 3300005544 Ga0070686_100188429 Ga0070686_1001884292 80
169 3300005563 Ga0068855_100271998 Ga0068855_1002719982 80
170 3300005614 Ga0068856_100269367 Ga0068856_1002693673 80
171 3300005618 Ga0068864_100257896 Ga0068864_1002578962 80
172 3300005718 Ga0068866_10631476 Ga0068866_106314762 80
173 3300005841 Ga0068863_101632362 Ga0068863_1016323622 80
174 3300005842 Ga0068858_100110751 Ga0068858_1001107513 80
175 3300005842 Ga0068858_100691914 Ga0068858_1006919141 80
176 3300005843 Ga0068860_100254923 Ga0068860_1002549232 80
177 3300006038 Ga0075365_11263693 Ga0075365_112636931 80
178 3300006173 Ga0070716_100289027 Ga0070716_1002890271 80
179 3300006237 Ga0097621_100347383 Ga0097621_1003473832 80
180 3300006358 Ga0068871_100187897 Ga0068871_1001878972 80
181 3300006844 Ga0075428_101038748 Ga0075428_1010387482 80
182 3300006881 Ga0068865_100315303 Ga0068865_1003153032 80
183 3300009098 Ga0105245_10065841 Ga0105245_100658412 80
184 3300009176 Ga0105242_10745964 Ga0105242_107459642 80
185 3300009177 Ga0105248_10237129 Ga0105248_102371292 80
186 3300009545 Ga0105237_10571560 Ga0105237_105715602 80
187 3300009551 Ga0105238_10899655 Ga0105238_108996551 80
188 3300011119 Ga0105246_10575173 Ga0105246_105751732 80
189 3300013102 Ga0157371_10211650 Ga0157371_102116503 80
190 3300013104 Ga0157370_10296629 Ga0157370_102966292 80
191 3300013105 Ga0157369_10524399 Ga0157369_105243992 80
192 3300013297 Ga0157378_10321000 Ga0157378_103210002 80
193 3300013307 Ga0157372_10410312 Ga0157372_104103122 80
194 3300013308 Ga0157375_11629855 Ga0157375_116298552 80
195 3300021388 Ga0213875_10109267 Ga0213875_101092672 80
196 3300025917 Ga0207660_11647309 Ga0207660_116473091 80
197 3300025933 Ga0207706_10534579 Ga0207706_105345791 80
198 3300025938 Ga0207704_10182273 Ga0207704_101822732 80
199 3300025941 Ga0207711_10509496 Ga0207711_105094962 80
200 3300025972 Ga0207668_10772658 Ga0207668_107726582 80
201 3300025981 Ga0207640_10560577 Ga0207640_105605772 80
202 3300026023 Ga0207677_10137950 Ga0207677_101379503 80
203 3300026035 Ga0207703_10059701 Ga0207703_100597014 80
204 3300026035 Ga0207703_10865625 Ga0207703_108656253 80
205 3300026088 Ga0207641_12387142 Ga0207641_123871421 80
206 3300026095 Ga0207676_10195633 Ga0207676_101956333 80
207 3300026142 Ga0207698_10964952 Ga0207698_109649522 80
208 3300028381 Ga0268264_10255463 Ga0268264_102554633 80
209 3300036401 Ga0373937_2025786 Ga0373937_2025786_259_501 80
210 3300037853 Ga0436364_0885971 Ga0436364_0885971_1847_2089 80
211 3300038443 Ga0395901_0252542 Ga0395901_0252542_802_1059 80
212 3300041413 Ga0439465_0129135 Ga0439465_0129135_546_788 80
213 3300048924 Ga0496121_0230666 Ga0496121_0230666_258_500 80
214 3300049568 Ga0501031_0083361 Ga0501031_0083361_1083_1340 80
215 3300049568 Ga0501031_0439587 Ga0501031_0439587_282_539 80
216 3300049568 Ga0501031_0804143 Ga0501031_0804143_321_578 80
217 3300049569 Ga0501032_0000257 Ga0501032_0000257_33099_33356 80
218 3300049569 Ga0501032_0064522 Ga0501032_0064522_333_590 80
219 3300049569 Ga0501032_0109291 Ga0501032_0109291_1175_1432 80
220 3300049569 Ga0501032_0227998 Ga0501032_0227998_369_626 80
221 3300049570 Ga0501033_0000244 Ga0501033_0000244_17335_17592 80
222 3300049570 Ga0501033_0060736 Ga0501033_0060736_844_1101 80
223 3300049571 Ga0501034_0000159 Ga0501034_0000159_34640_34897 80
224 3300049571 Ga0501034_0130540 Ga0501034_0130540_1213_1470 80
225 3300049571 Ga0501034_0271819 Ga0501034_0271819_980_1237 80
226 3300049572 Ga0501036_0000039 Ga0501036_0000039_35673_35930 80
227 3300049572 Ga0501036_0075416 Ga0501036_0075416_1834_2091 80
228 3300049572 Ga0501036_0163399 Ga0501036_0163399_423_680 80
229 3300049572 Ga0501036_1461202 Ga0501036_1461202_142_399 80
230 3300049573 Ga0501037_0001386 Ga0501037_0001386_423_680 80
231 3300049573 Ga0501037_0316942 Ga0501037_0316942_709_966 80
232 3300049573 Ga0501037_0501351 Ga0501037_0501351_395_652 80
233 3300049574 Ga0501038_0000207 Ga0501038_0000207_28237_28494 80
234 3300049574 Ga0501038_0006348 Ga0501038_0006348_1708_1965 80
235 3300049574 Ga0501038_0019269 Ga0501038_0019269_1009_1266 80
236 3300049574 Ga0501038_0019594 Ga0501038_0019594_5487_5744 80
237 3300049575 Ga0501039_0000148 Ga0501039_0000148_31515_31772 80
238 3300049575 Ga0501039_0085337 Ga0501039_0085337_1079_1336 80
239 3300049575 Ga0501039_0177971 Ga0501039_0177971_572_829 80
240 3300049575 Ga0501039_0295894 Ga0501039_0295894_375_632 80
241 3300049576 Ga0501040_0069289 Ga0501040_0069289_589_846 80
242 3300049576 Ga0501040_0139875 Ga0501040_0139875_945_1202 80
243 3300049577 Ga0501041_0475516 Ga0501041_0475516_227_484 80
244 3300049578 Ga0501042_0152464 Ga0501042_0152464_884_1141 80
245 3300049579 Ga0501043_0000202 Ga0501043_0000202_51875_52132 80
246 3300049579 Ga0501043_0085639 Ga0501043_0085639_1206_1463 80
247 3300049579 Ga0501043_0142418 Ga0501043_0142418_1066_1326 80
248 3300049579 Ga0501043_0212341 Ga0501043_0212341_844_1101 80
249 3300049579 Ga0501043_0422643 Ga0501043_0422643_396_653 80
250 3300049580 Ga0501046_0000185 Ga0501046_0000185_26377_26634 80
251 3300049580 Ga0501046_0286078 Ga0501046_0286078_700_957 80
252 3300049581 Ga0501047_0000385 Ga0501047_0000385_14739_14996 80
253 3300049581 Ga0501047_0092123 Ga0501047_0092123_925_1182 80
254 3300049581 Ga0501047_0195740 Ga0501047_0195740_1025_1282 80
255 3300049581 Ga0501047_0898034 Ga0501047_0898034_46_303 80
256 3300049582 Ga0501048_0000536 Ga0501048_0000536_2006_2263 80
257 3300049582 Ga0501048_0075538 Ga0501048_0075538_771_1028 80
258 3300049583 Ga0501067_0005941 Ga0501067_0005941_6367_6624 80
259 3300049583 Ga0501067_0262938 Ga0501067_0262938_423_680 80
260 3300049583 Ga0501067_0381744 Ga0501067_0381744_349_606 80
261 3300049584 Ga0501068_0111701 Ga0501068_0111701_142_399 80
262 3300049584 Ga0501068_0201146 Ga0501068_0201146_633_890 80
263 3300049585 Ga0501069_0002806 Ga0501069_0002806_6081_6338 80
264 3300049585 Ga0501069_0079567 Ga0501069_0079567_110_367 80
265 3300049586 Ga0501070_0000557 Ga0501070_0000557_31322_31579 80
266 3300049586 Ga0501070_0096946 Ga0501070_0096946_374_631 80
267 3300049586 Ga0501070_0286327 Ga0501070_0286327_857_1114 80
268 3300049587 Ga0501071_0133610 Ga0501071_0133610_701_958 80
269 3300049587 Ga0501071_0273951 Ga0501071_0273951_733_990 80
270 3300049588 Ga0501072_0029712 Ga0501072_0029712_230_487 80
271 3300049588 Ga0501072_0099976 Ga0501072_0099976_261_518 80
272 3300049588 Ga0501072_0580223 Ga0501072_0580223_225_482 80
273 3300049589 Ga0501073_0000034 Ga0501073_0000034_92290_92547 80
274 3300049589 Ga0501073_0025141 Ga0501073_0025141_1662_1919 80
275 3300049589 Ga0501073_0951316 Ga0501073_0951316_49_306 80
276 3300049590 Ga0501074_0000271 Ga0501074_0000271_13936_14193 80
277 3300049590 Ga0501074_0087620 Ga0501074_0087620_770_1027 80
278 3300049592 Ga0501076_0023364 Ga0501076_0023364_3215_3472 80
279 3300049741 Ga0501079_0033756 Ga0501079_0033756_3602_3859 80
280 3300049742 Ga0501080_0104752 Ga0501080_0104752_1242_1499 80
281 3300049744 Ga0501083_0000118 Ga0501083_0000118_18916_19173 80
282 3300049744 Ga0501083_0126044 Ga0501083_0126044_513_770 80
283 3300049822 Ga0501035_0000137 Ga0501035_0000137_2306_2563 80
284 3300049822 Ga0501035_0066864 Ga0501035_0066864_2361_2618 80
285 3300049822 Ga0501035_0849091 Ga0501035_0849091_148_405 80
286 3300049823 Ga0501044_0000548 Ga0501044_0000548_30665_30922 80
287 3300049823 Ga0501044_0068034 Ga0501044_0068034_1172_1429 80
288 3300049823 Ga0501044_0286542 Ga0501044_0286542_41_298 80
289 3300049823 Ga0501044_0691866 Ga0501044_0691866_399_656 80
290 3300049824 Ga0501045_0010495 Ga0501045_0010495_3216_3473 80
291 3300049824 Ga0501045_0082202 Ga0501045_0082202_1646_1903 80
292 3300050512 nmdc:mga0n895_488584_c1 nmdc:mga0n895_488584_c1_214_456 80
293 3300053153 Ga0500616_0000028 Ga0500616_0000028_265326_265592 80
294 3300054114 Ga0501084_0003978 Ga0501084_0003978_2016_2273 80
295 3300060353 Ga0501082_0061815 Ga0501082_0061815_2251_2508 80
296 3300060353 Ga0501082_0078362 Ga0501082_0078362_310_567 80
297 3300005331 Ga0070670_100765454 Ga0070670_1007654541 81
298 3300005436 Ga0070713_101541636 Ga0070713_1015416361 81
299 3300005618 Ga0068864_102199763 Ga0068864_1021997631 81
300 3300006880 Ga0075429_101316478 Ga0075429_1013164782 81
301 3300020075 Ga0206349_1969995 Ga0206349_19699952 81
302 3300021377 Ga0213874_10232048 Ga0213874_102320481 81
303 3300028380 Ga0268265_11067683 Ga0268265_110676832 81
304 3300031250 Ga0265331_10398997 Ga0265331_103989972 81
305 3300037418 Ga0395900_0191946 Ga0395900_0191946_873_1139 81
306 3300037853 Ga0436364_0577370 Ga0436364_0577370_574_819 81
307 3300038443 Ga0395901_1332569 Ga0395901_1332569_245_511 81
308 3300049568 Ga0501031_0006086 Ga0501031_0006086_4664_4930 81
309 3300049569 Ga0501032_0002240 Ga0501032_0002240_5692_5958 81
310 3300049570 Ga0501033_0000803 Ga0501033_0000803_5619_5885 81
311 3300049571 Ga0501034_0019040 Ga0501034_0019040_3839_4105 81
312 3300049572 Ga0501036_0000104 Ga0501036_0000104_36512_36778 81
313 3300049573 Ga0501037_0001025 Ga0501037_0001025_16544_16810 81
314 3300049574 Ga0501038_0000041 Ga0501038_0000041_79559_79825 81
315 3300049575 Ga0501039_0000064 Ga0501039_0000064_23633_23899 81
316 3300049579 Ga0501043_0012725 Ga0501043_0012725_2422_2688 81
317 3300049580 Ga0501046_0278561 Ga0501046_0278561_434_700 81
318 3300049581 Ga0501047_0000392 Ga0501047_0000392_46926_47192 81
319 3300049582 Ga0501048_0098346 Ga0501048_0098346_1426_1692 81
320 3300049583 Ga0501067_0015707 Ga0501067_0015707_3011_3277 81
321 3300049584 Ga0501068_0004880 Ga0501068_0004880_3245_3511 81
322 3300049585 Ga0501069_0024732 Ga0501069_0024732_2970_3236 81
323 3300049586 Ga0501070_0000209 Ga0501070_0000209_3826_4092 81
324 3300049587 Ga0501071_0124752 Ga0501071_0124752_1451_1717 81
325 3300049589 Ga0501073_0008907 Ga0501073_0008907_5638_5904 81
326 3300049590 Ga0501074_0074571 Ga0501074_0074571_2125_2391 81
327 3300049741 Ga0501079_0425777 Ga0501079_0425777_752_1018 81
328 3300049742 Ga0501080_0010052 Ga0501080_0010052_3427_3693 81
329 3300049742 Ga0501080_1475280 Ga0501080_1475280_28_285 81
330 3300049822 Ga0501035_0000155 Ga0501035_0000155_60769_61035 81
331 3300049823 Ga0501044_0001941 Ga0501044_0001941_7196_7462 81
332 3300049824 Ga0501045_0389996 Ga0501045_0389996_705_971 81
333 3300054114 Ga0501084_1045068 Ga0501084_1045068_377_643 81
334 2162886007 SwRhRL2b_contig_2870600 SwRhRL2b_0063.00001170 82
335 3300005289 Ga0065704_10070999 Ga0065704_1007099910 82
336 3300005327 Ga0070658_10393396 Ga0070658_103933962 82
337 3300005339 Ga0070660_100074414 Ga0070660_1000744143 82
338 3300005356 Ga0070674_100367884 Ga0070674_1003678841 82
339 3300005356 Ga0070674_100610368 Ga0070674_1006103682 82
340 3300005468 Ga0070707_100342683 Ga0070707_1003426832 82
341 3300005471 Ga0070698_100351396 Ga0070698_1003513961 82
342 3300006028 Ga0070717_10461097 Ga0070717_104610972 82
343 3300010375 Ga0105239_10206501 Ga0105239_102065012 82
344 3300011119 Ga0105246_11386118 Ga0105246_113861181 82
345 3300014325 Ga0163163_10230872 Ga0163163_102308723 82
346 3300021361 Ga0213872_10074245 Ga0213872_100742452 82
347 3300025910 Ga0207684_10165455 Ga0207684_101654552 82
348 3300025919 Ga0207657_10081077 Ga0207657_100810773 82
349 3300025922 Ga0207646_10423184 Ga0207646_104231843 82
350 3300025924 Ga0207694_11124409 Ga0207694_111244091 82
351 3300025937 Ga0207669_10999203 Ga0207669_109992032 82
352 3300025937 Ga0207669_11241924 Ga0207669_112419242 82
353 3300028379 Ga0268266_10511459 Ga0268266_105114593 82
354 3300031090 Ga0265760_10343650 Ga0265760_103436502 82
355 3300032005 Ga0307411_11227178 Ga0307411_112271781 82
356 3300035083 Ga0373926_0345517 Ga0373926_0345517_97_369 82
357 3300035113 Ga0373936_0220749 Ga0373936_0220749_124_396 82
358 3300035117 Ga0373953_0006019 Ga0373953_0006019_3659_3919 82
359 3300035118 Ga0373954_0034086 Ga0373954_0034086_1306_1566 82
360 3300035119 Ga0373956_0103504 Ga0373956_0103504_88_348 82
361 3300035120 Ga0373957_0199637 Ga0373957_0199637_52_312 82
362 3300035170 Ga0373943_0638953 Ga0373943_0638953_107_379 82
363 3300035172 Ga0373955_0012096 Ga0373955_0012096_3432_3692 82
364 3300035692 Ga0373935_0142508 Ga0373935_0142508_205_477 82
365 3300035695 Ga0373927_0153829 Ga0373927_0153829_1159_1431 82
366 3300036401 Ga0373937_0024035 Ga0373937_0024035_585_845 82
367 3300037068 Ga0373925_0052067 Ga0373925_0052067_2571_2843 82
368 3300039447 Ga0436361_0447126 Ga0436361_0447126_1565_1861 82
369 3300041413 Ga0439465_0051682 Ga0439465_0051682_1005_1256 82
370 3300041441 Ga0451787_460550 Ga0451787_460550_107_367 82
371 3300041997 Ga0439431_0026242 Ga0439431_0026242_1141_1392 82
372 3300042006 Ga0439432_146620 Ga0439432_146620_173_421 82
373 3300045976 Ga0466967_0046187 Ga0466967_0046187_3319_3588 82
374 3300046452 Ga0495617_037715 Ga0495617_037715_610_900 82
375 3300046457 Ga0495590_0169354 Ga0495590_0169354_87_335 82
376 3300046457 Ga0495590_0204625 Ga0495590_0204625_30_320 82
377 3300046460 Ga0495638_0042147 Ga0495638_0042147_1475_1765 82
378 3300046476 Ga0495662_0246505 Ga0495662_0246505_472_744 82
379 3300046491 Ga0495584_0004090 Ga0495584_0004090_2578_2868 82
380 3300046511 Ga0495608_0138325 Ga0495608_0138325_245_505 82
381 3300046513 Ga0495616_0179666 Ga0495616_0179666_443_733 82
382 3300046514 Ga0495618_0284746 Ga0495618_0284746_225_497 82
383 3300046642 Ga0495634_0037009 Ga0495634_0037009_2898_3170 82
384 3300046648 Ga0495611_0466692 Ga0495611_0466692_142_432 82
385 3300046663 Ga0495635_0177203 Ga0495635_0177203_1148_1408 82
386 3300046675 Ga0495657_0100812 Ga0495657_0100812_1320_1580 82
387 3300046678 Ga0495599_0489704 Ga0495599_0489704_308_568 82
388 3300046681 Ga0495647_0395054 Ga0495647_0395054_248_520 82
389 3300047315 Ga0495581_0173045 Ga0495581_0173045_745_1017 82
390 3300047317 Ga0495604_0058921 Ga0495604_0058921_1059_1319 82
391 3300047319 Ga0495674_0145484 Ga0495674_0145484_406_678 82
392 3300047322 Ga0495680_0133539 Ga0495680_0133539_1236_1496 82
393 3300048088 Ga0495602_0117318 Ga0495602_0117318_1009_1269 82
394 3300048922 Ga0496119_0001222 Ga0496119_0001222_19351_19602 82
395 3300049570 Ga0501033_0037855 Ga0501033_0037855_19_267 82
396 3300049571 Ga0501034_0013985 Ga0501034_0013985_7124_7372 82
397 3300049573 Ga0501037_0144400 Ga0501037_0144400_136_384 82
398 3300049574 Ga0501038_0422830 Ga0501038_0422830_723_974 82
399 3300049576 Ga0501040_0152437 Ga0501040_0152437_128_379 82
400 3300049583 Ga0501067_0647611 Ga0501067_0647611_175_435 82
401 3300049584 Ga0501068_0878862 Ga0501068_0878862_290_541 82
402 3300049589 Ga0501073_0575971 Ga0501073_0575971_449_700 82
403 3300049590 Ga0501074_0292500 Ga0501074_0292500_437_688 82
404 3300049591 Ga0501075_0163986 Ga0501075_0163986_274_525 82
405 3300049592 Ga0501076_0038722 Ga0501076_0038722_2823_3074 82
406 3300049593 Ga0501077_0070303 Ga0501077_0070303_1269_1520 82
407 3300049674 Ga0501242_023982 Ga0501242_023982_391_639 82
408 3300049742 Ga0501080_0289846 Ga0501080_0289846_721_972 82
409 3300049743 Ga0501081_0067901 Ga0501081_0067901_1114_1365 82
410 3300049744 Ga0501083_0196469 Ga0501083_0196469_811_1062 82
411 3300049823 Ga0501044_0006837 Ga0501044_0006837_9407_9655 82
412 3300049824 Ga0501045_0238528 Ga0501045_0238528_814_1065 82
413 3300050489 nmdc:mga03683_276897_c1 nmdc:mga03683_276897_c1_337_591 82
414 3300053084 Ga0495595_0007970 Ga0495595_0007970_2546_2806 82
415 3300053085 Ga0495619_0006461 Ga0495619_0006461_6162_6422 82
416 3300053104 Ga0500556_0000039 Ga0500556_0000039_118102_118353 82
417 3300053134 Ga0500658_0113697 Ga0500658_0113697_406_654 82
418 3300053153 Ga0500616_0267448 Ga0500616_0267448_115_366 82
419 3300054114 Ga0501084_0083622 Ga0501084_0083622_270_521 82
420 3300060353 Ga0501082_0482577 Ga0501082_0482577_244_495 82
421 iso_pu_bacteria 2643221547 2643757727 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11730

DUF3297

Protein of unknown function (DUF3297)

14

84

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pdr-assembly1.cif.gz_A rigid body fit of assembled hmpv n-rna spiral bound to the c-terminal region of p 0.7553 48 68
4oby-assembly1.cif.gz_A crystal structure of e.coli arginyl-trna synthetase and ligand binding studies revealed key residues in arginine recognition 0.6035 49 70
8cx2-assembly1.cif.gz_I cryo-em structure of human apobec3g/hiv-1 vif/cbfbeta/elob/eloc dimeric complex in state 2 0.4314 25 78
3mp6-assembly1.cif.gz_A complex structure of sgf29 and dimethylated h3k4 0.4121 25 80
5t2a-assembly1.cif.gz_X cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution 0.4091 25 78
ID Description Score Start End Superfamily
af_A0A1D6LPC7_51_198_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5761 45 70 3.50.50.60
af_Q8H5X6_117_561_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.5738 38 70 3.50.50.100
af_Q9BL48_11_358_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.5574 44 76 3.90.1410.10
af_Q4DCU2_5_434_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.5309 38 70 3.50.50.100
af_Q0IMW0_214_347_3.90.70.200 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Plus-3 domain 0.5129 44 72 3.90.70.200
ID Description Score Start End GO Terms
AF-A0A1Z1FEJ3-F1-model_v4 DUF3297 family protein 0.997 5 76
AF-A0A1W1H2A7-F1-model_v4 Glutathione peroxidase 0.9925 1 82
AF-A0A0A2WIQ2-F1-model_v4 Glutathione peroxidase 0.9908 1 82 GO:0004601
AF-A0A3C0JBD0-F1-model_v4 DUF3297 domain-containing protein 0.9902 1 49
AF-A0A533J6W8-F1-model_v4 deleted 0.9898 6 75

Feature Viewer

pLDDT pTM Quality
91.45 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map