F439957

General Info

Members Datasets Scaffolds Average Seq Length
421 264 842 77

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101061381|Ga0075428_1010613812
Length 92
Sequence METYTYSFIVGISKQSLYLILILSAPSVLIAMVIGLITSLIKATTQIQEQTLTFVPKLVAVMAILALTGPWCMQQLVVFTHNILDQFPKYLR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
256 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
264 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.99
Nodule 0
Rhizoplane 7.6
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101061381 3300006844 Bacteria 856
2 MBSR1b_contig_13511962 2162886012 Bacteria 1049
3 JGI24739J22299_10037288 3300001989 Bacteria 1638
4 JGI24737J22298_10014298 3300001990 Bacteria 2577
5 JGI24737J22298_10105368 3300001990 Bacteria 835
6 JGI24735J21928_10000925 3300002067 Bacteria 10495
7 JGI24735J21928_10025449 3300002067 Bacteria 1786
8 JGI25156J39149_1027353 3300002705 Bacteria 892
9 JGI25160J50197_1062253 3300003354 Bacteria 740
10 Ga0065712_10317415 3300005290 Bacteria 819
11 Ga0065715_10297562 3300005293 Bacteria 1049
12 Ga0070658_10162714 3300005327 Bacteria 1872
13 Ga0070658_10819728 3300005327 Bacteria 808
14 Ga0070658_11553104 3300005327 Bacteria 574
15 Ga0070683_101709006 3300005329 Bacteria 605
16 Ga0070677_10657405 3300005333 Bacteria 586
17 Ga0068869_100780743 3300005334 Bacteria 820
18 Ga0070666_10011694 3300005335 Bacteria 5519
19 Ga0070666_10116257 3300005335 Bacteria 1852
20 Ga0070682_100485422 3300005337 Bacteria 954
21 Ga0068868_101380376 3300005338 Bacteria 656
22 Ga0070660_100005575 3300005339 Bacteria 8724
23 Ga0070661_101285144 3300005344 Bacteria 614
24 Ga0070661_101473029 3300005344 Bacteria 574
25 Ga0070669_100954694 3300005353 Bacteria 734
26 Ga0070669_101062099 3300005353 Bacteria 696
27 Ga0070675_100656997 3300005354 Bacteria 953
28 Ga0070671_100562659 3300005355 Bacteria 984
29 Ga0070674_100481566 3300005356 Bacteria 1030
30 Ga0070659_100691703 3300005366 Bacteria 881
31 Ga0070667_100035736 3300005367 Bacteria 4164
32 Ga0070667_100229756 3300005367 Bacteria 1654
33 Ga0070667_100568622 3300005367 Bacteria 1043
34 Ga0070667_100667710 3300005367 Bacteria 960
35 Ga0070714_100922372 3300005435 Bacteria 848
36 Ga0070714_101012088 3300005435 Bacteria 809
37 Ga0070663_100062178 3300005455 Bacteria 2691
38 Ga0070663_100362193 3300005455 Bacteria 1176
39 Ga0070678_100131513 3300005456 Bacteria 1989
40 Ga0070678_100294629 3300005456 Bacteria 1377
41 Ga0070678_101952725 3300005456 Bacteria 555
42 Ga0070662_100708600 3300005457 Bacteria 852
43 Ga0070681_10050869 3300005458 Bacteria 4134
44 Ga0070707_101774107 3300005468 Bacteria 584
45 Ga0070698_100266573 3300005471 Bacteria 1645
46 Ga0070699_100115638 3300005518 Bacteria 2357
47 Ga0070679_100554414 3300005530 Bacteria 1093
48 Ga0070672_101416295 3300005543 Bacteria 622
49 Ga0070665_100395594 3300005548 Bacteria 1389
50 Ga0070665_102188830 3300005548 Bacteria 557
51 Ga0068855_100452689 3300005563 Bacteria 1400
52 Ga0070664_100190176 3300005564 Bacteria 1829
53 Ga0068854_100379684 3300005578 Bacteria 1164
54 Ga0068852_100531615 3300005616 Bacteria 1174
55 Ga0068859_100090998 3300005617 Bacteria 3102
56 Ga0068864_100982476 3300005618 Bacteria 837
57 Ga0068861_100599361 3300005719 Bacteria 1011
58 Ga0068861_101194162 3300005719 Bacteria 735
59 Ga0068858_101313583 3300005842 Bacteria 712
60 Ga0068860_100002910 3300005843 Bacteria 17737
61 Ga0068860_101598739 3300005843 Bacteria 674
62 Ga0068860_102824392 3300005843 Bacteria 503
63 Ga0068862_100215932 3300005844 Bacteria 1735
64 Ga0068862_100258019 3300005844 Bacteria 1590
65 Ga0068862_101485721 3300005844 Bacteria 683
66 Ga0068862_101893186 3300005844 Bacteria 606
67 Ga0081540_1045238 3300005983 Bacteria 2238
68 Ga0075365_10022403 3300006038 Bacteria 3958
69 Ga0075428_100005737 3300006844 Bacteria 13797
70 Ga0075428_100421157 3300006844 Bacteria 1431
71 Ga0075430_101744140 3300006846 Bacteria 511
72 Ga0075431_100000953 3300006847 Bacteria 25591
73 Ga0075429_100002934 3300006880 Bacteria 14458
74 Ga0075429_100075287 3300006880 Bacteria 2940
75 Ga0075429_100823870 3300006880 Bacteria 812
76 Ga0097620_100091000 3300006931 Bacteria 3102
77 Ga0105251_10005927 3300009011 Bacteria 7897
78 Ga0105251_10273300 3300009011 Bacteria 763
79 Ga0105244_10052908 3300009036 Bacteria 2065
80 Ga0105244_10417165 3300009036 Bacteria 617
81 Ga0105240_10012208 3300009093 Bacteria 11877
82 Ga0105240_11359641 3300009093 Bacteria 747
83 Ga0111539_10004925 3300009094 Bacteria 17378
84 Ga0111539_10526227 3300009094 Bacteria 1377
85 Ga0111539_10593228 3300009094 Unclassified 1290
86 Ga0105245_11462111 3300009098 Bacteria 734
87 Ga0105245_11885957 3300009098 Bacteria 651
88 Ga0105247_10252825 3300009101 Bacteria 1205
89 Ga0114129_10013394 3300009147 Bacteria 11687
90 Ga0105243_11140305 3300009148 Unclassified 790
91 Ga0105242_10662347 3300009176 Bacteria 1016
92 Ga0105242_11384692 3300009176 Bacteria 730
93 Ga0105248_10035844 3300009177 Bacteria 5549
94 Ga0105248_11432621 3300009177 Bacteria 782
95 Ga0105237_10368665 3300009545 Bacteria 1441
96 Ga0105238_10033821 3300009551 Bacteria 5201
97 Ga0105238_11542520 3300009551 Bacteria 694
98 Ga0105249_13017658 3300009553 Bacteria 540
99 Ga0105239_10368914 3300010375 Bacteria 1622
100 Ga0105239_10458284 3300010375 Bacteria 1447
101 Ga0105239_11430341 3300010375 Bacteria 798
102 Ga0105246_10159880 3300011119 Bacteria 1715
103 Ga0105246_11385433 3300011119 Bacteria 655
104 Ga0157369_10342677 3300013105 Bacteria 1552
105 Ga0157374_10019479 3300013296 Bacteria 6005
106 Ga0157374_11398519 3300013296 Bacteria 722
107 Ga0163162_10005023 3300013306 Bacteria 12743
108 Ga0163162_10548155 3300013306 Bacteria 1285
109 Ga0163162_11189931 3300013306 Bacteria 865
110 Ga0163162_11654551 3300013306 Bacteria 731
111 Ga0157372_10946018 3300013307 Bacteria 999
112 Ga0157375_10013696 3300013308 Bacteria 7229
113 Ga0157380_12434838 3300014326 Unclassified 589
114 Ga0157377_11687302 3300014745 Bacteria 511
115 Ga0157379_11175932 3300014968 Unclassified 737
116 Ga0157376_10808982 3300014969 Bacteria 950
117 Ga0157376_10967496 3300014969 Bacteria 872
118 Ga0182007_10001737 3300015262 Bacteria 11467
119 Ga0163161_10504562 3300017792 Bacteria 986
120 Ga0213872_10000080 3300021361 Bacteria 88817
121 Ga0213872_10003124 3300021361 Bacteria 9307
122 Ga0213876_10003414 3300021384 Bacteria 9087
123 Ga0213876_10120957 3300021384 Bacteria 1390
124 Ga0209759_1002720 3300025256 Bacteria 7533
125 Ga0207426_1004087 3300025302 Bacteria 7360
126 Ga0207713_1050363 3300025735 Bacteria 1663
127 Ga0207682_10472563 3300025893 Bacteria 594
128 Ga0207680_10165135 3300025903 Bacteria 1487
129 Ga0207647_10022288 3300025904 Bacteria 4210
130 Ga0207705_10725762 3300025909 Bacteria 772
131 Ga0207707_10050151 3300025912 Bacteria 3637
132 Ga0207695_10068407 3300025913 Bacteria 3638
133 Ga0207695_10214566 3300025913 Bacteria 1834
134 Ga0207671_10099042 3300025914 Bacteria 2206
135 Ga0207671_10891168 3300025914 Bacteria 704
136 Ga0207660_11513374 3300025917 Bacteria 542
137 Ga0207657_10068119 3300025919 Bacteria 3024
138 Ga0207649_10538475 3300025920 Bacteria 892
139 Ga0207652_11755851 3300025921 Bacteria 525
140 Ga0207694_10410307 3300025924 Bacteria 1127
141 Ga0207694_10820821 3300025924 Bacteria 786
142 Ga0207659_10504456 3300025926 Bacteria 1024
143 Ga0207687_10758405 3300025927 Bacteria 826
144 Ga0207687_11691959 3300025927 Bacteria 542
145 Ga0207664_10388511 3300025929 Bacteria 1240
146 Ga0207664_10868624 3300025929 Bacteria 810
147 Ga0207706_10402940 3300025933 Bacteria 1186
148 Ga0207686_11753482 3300025934 Bacteria 514
149 Ga0207711_10033538 3300025941 Bacteria 4345
150 Ga0207711_11472205 3300025941 Bacteria 624
151 Ga0207689_11158969 3300025942 Bacteria 651
152 Ga0207679_10192683 3300025945 Bacteria 1696
153 Ga0207667_10017286 3300025949 Bacteria 8124
154 Ga0207658_10059265 3300025986 Bacteria 2852
155 Ga0207677_11580817 3300026023 Bacteria 607
156 Ga0207703_10320800 3300026035 Bacteria 1419
157 Ga0207678_10140360 3300026067 Bacteria 2062
158 Ga0207678_10263410 3300026067 Bacteria 1478
159 Ga0207641_10506636 3300026088 Bacteria 1173
160 Ga0207676_10176035 3300026095 Bacteria 1869
161 Ga0207675_100679418 3300026118 Bacteria 1037
162 Ga0207675_102044229 3300026118 Bacteria 590
163 Ga0207683_10601287 3300026121 Bacteria 1018
164 Ga0207698_11987721 3300026142 Bacteria 596
165 Ga0209970_1001312 3300027614 Bacteria 4371
166 Ga0209983_1123195 3300027665 Bacteria 592
167 Ga0207428_10031642 3300027907 Bacteria 4362
168 Ga0207428_11210641 3300027907 Unclassified 525
169 Ga0268266_10065221 3300028379 Bacteria 3148
170 Ga0268266_10559477 3300028379 Bacteria 1096
171 Ga0268265_10087579 3300028380 Bacteria 2478
172 Ga0268265_10350057 3300028380 Bacteria 1349
173 Ga0268265_11758243 3300028380 Bacteria 626
174 Ga0268264_10015518 3300028381 Bacteria 6245
175 Ga0268264_10427446 3300028381 Bacteria 1279
176 Ga0265332_10000187 3300031238 Bacteria 50563
177 Ga0307513_10911982 3300031456 Bacteria 586
178 Ga0316578_10338659 3300031728 Bacteria 896
179 Ga0307516_10155668 3300031730 Bacteria 2041
180 Ga0307413_12072381 3300031824 Bacteria 514
181 Ga0307410_10435007 3300031852 Bacteria 1067
182 Ga0307410_12093374 3300031852 Bacteria 506
183 Ga0307409_100583694 3300031995 Bacteria 1102
184 Ga0307409_100789863 3300031995 Bacteria 956
185 Ga0307409_101968406 3300031995 Bacteria 614
186 Ga0307409_102029044 3300031995 Bacteria 605
187 Ga0307416_100806312 3300032002 Bacteria 1035
188 Ga0307416_100866080 3300032002 Bacteria 1002
189 Ga0307411_11075710 3300032005 Bacteria 724
190 Ga0307411_11115428 3300032005 Bacteria 712
191 Ga0307415_101514544 3300032126 Bacteria 642
192 Ga0373931_0174722 3300035691 Bacteria 1268
193 Ga0395899_0006993 3300037312 Bacteria 8739
194 Ga0395900_0282473 3300037418 Bacteria 1651
195 Ga0395900_0357274 3300037418 Bacteria 1433
196 Ga0395898_0563861 3300037466 Bacteria 1081
197 Ga0395905_0014117 3300037471 Bacteria 7636
198 Ga0395905_0138042 3300037471 Bacteria 2294
199 Ga0395905_0261300 3300037471 Bacteria 1616
200 Ga0395905_1775028 3300037471 Bacteria 522
201 Ga0436364_0259513 3300037853 Unclassified 1282
202 Ga0395901_0049590 3300038443 Bacteria 4362
203 Ga0395901_0381639 3300038443 Bacteria 1450
204 Ga0436365_1107141 3300039437 Bacteria 977
205 Ga0436365_1403869 3300039437 Bacteria 674
206 Ga0436365_1589686 3300039437 Bacteria 5978
207 Ga0436361_0247001 3300039447 Bacteria 107036
208 Ga0436361_0538691 3300039447 Bacteria 705
209 Ga0436361_0841075 3300039447 Bacteria 63602
210 Ga0439465_0331872 3300041413 Bacteria 573
211 Ga0451795_0365438 3300041456 Bacteria 678
212 Ga0451807_1041869 3300041486 Bacteria 524
213 Ga0451833_1438757 3300041491 Bacteria 659
214 Ga0451855_0352680 3300041511 Bacteria 632
215 Ga0451853_3317805 3300041512 Bacteria 571
216 Ga0439462_0138346 3300042015 Bacteria 682
217 Ga0451577_0032453 3300042876 Bacteria 4704
218 Ga0466969_0432450 3300044656 Bacteria 598
219 Ga0453683_0015947 3300044673 Bacteria 4855
220 Ga0453683_0630771 3300044673 Bacteria 700
221 Ga0466965_0105701 3300044683 Bacteria 1443
222 Ga0466966_0833964 3300044684 Bacteria 556
223 Ga0453684_0002077 3300044712 Bacteria 50849
224 Ga0453684_0059811 3300044712 Bacteria 4907
225 Ga0466968_0391876 3300044735 Bacteria 680
226 Ga0451576_0003317 3300045051 Bacteria 22316
227 Ga0451576_0192600 3300045051 Bacteria 2130
228 Ga0451576_1100798 3300045051 Bacteria 831
229 Ga0451576_1447573 3300045051 Bacteria 714
230 Ga0466967_0735760 3300045976 Bacteria 978
231 Ga0466967_1057088 3300045976 Bacteria 809
232 Ga0495592_0252105 3300046454 Bacteria 1166
233 Ga0495592_0420823 3300046454 Bacteria 842
234 Ga0495603_0025666 3300046455 Bacteria 3563
235 Ga0495590_0067683 3300046457 Bacteria 1251
236 Ga0495590_0113534 3300046457 Bacteria 968
237 Ga0495590_0181096 3300046457 Bacteria 770
238 Ga0495591_025857 3300046458 Bacteria 1834
239 Ga0495629_0000132 3300046459 Bacteria 65175
240 Ga0495629_0073522 3300046459 Bacteria 2387
241 Ga0495638_0003106 3300046460 Bacteria 13159
242 Ga0495653_0174682 3300046463 Bacteria 1479
243 Ga0495653_0773935 3300046463 Bacteria 578
244 Ga0495650_0005950 3300046471 Bacteria 7737
245 Ga0495650_0071669 3300046471 Bacteria 1358
246 Ga0495650_0244516 3300046471 Bacteria 612
247 Ga0495580_0028431 3300046472 Bacteria 4063
248 Ga0495582_0177196 3300046473 Bacteria 1214
249 Ga0495605_0011877 3300046474 Bacteria 4844
250 Ga0495662_0038574 3300046476 Bacteria 2309
251 Ga0495664_0046112 3300046477 Bacteria 2586
252 Ga0495664_0464271 3300046477 Bacteria 757
253 Ga0495584_0032672 3300046491 Bacteria 2633
254 Ga0495584_0042318 3300046491 Bacteria 2299
255 Ga0495585_0012496 3300046492 Bacteria 5002
256 Ga0495585_0543456 3300046492 Bacteria 549
257 Ga0495596_0392911 3300046500 Bacteria 540
258 Ga0495596_0440088 3300046500 Bacteria 508
259 Ga0495607_0177240 3300046501 Bacteria 1071
260 Ga0495583_0098871 3300046506 Bacteria 1247
261 Ga0495606_0016116 3300046507 Bacteria 5718
262 Ga0495606_0073235 3300046507 Bacteria 2150
263 Ga0495616_0272019 3300046513 Bacteria 722
264 Ga0495620_0024669 3300046515 Bacteria 2856
265 Ga0495620_0405917 3300046515 Bacteria 516
266 Ga0495628_0007117 3300046516 Bacteria 9691
267 Ga0495628_0350499 3300046516 Bacteria 1085
268 Ga0495628_1022412 3300046516 Bacteria 568
269 Ga0495630_0143579 3300046517 Bacteria 1815
270 Ga0495630_0848648 3300046517 Bacteria 696
271 Ga0495631_0055393 3300046518 Bacteria 1728
272 Ga0495631_0374117 3300046518 Bacteria 606
273 Ga0495632_0140197 3300046519 Bacteria 1122
274 Ga0495632_0153924 3300046519 Bacteria 1062
275 Ga0495632_0160456 3300046519 Bacteria 1036
276 Ga0495644_0047367 3300046523 Bacteria 1615
277 Ga0495642_0052811 3300046528 Bacteria 1674
278 Ga0495642_0071210 3300046528 Bacteria 1454
279 Ga0495652_0105502 3300046529 Bacteria 2277
280 Ga0495652_0148247 3300046529 Bacteria 1836
281 Ga0495654_0072193 3300046530 Bacteria 1634
282 Ga0495654_0084566 3300046530 Bacteria 1482
283 Ga0495654_0256810 3300046530 Bacteria 726
284 Ga0495665_0005251 3300046531 Bacteria 6981
285 Ga0495665_0118547 3300046531 Bacteria 1386
286 Ga0495586_0124166 3300046535 Bacteria 1443
287 Ga0495586_0179656 3300046535 Bacteria 1197
288 Ga0495645_0000253 3300046543 Bacteria 39114
289 Ga0495645_0009429 3300046543 Bacteria 6818
290 Ga0495645_0184707 3300046543 Bacteria 1425
291 Ga0495645_0753639 3300046543 Bacteria 587
292 Ga0495668_0541492 3300046616 Bacteria 642
293 Ga0495634_0162121 3300046642 Bacteria 1409
294 Ga0495611_0268465 3300046648 Bacteria 789
295 Ga0495635_0208850 3300046663 Bacteria 1323
296 Ga0495588_0336154 3300046674 Bacteria 794
297 Ga0495588_0513055 3300046674 Bacteria 628
298 Ga0495588_0574163 3300046674 Bacteria 591
299 Ga0495623_0091672 3300046679 Bacteria 1864
300 Ga0495623_0242858 3300046679 Bacteria 1016
301 Ga0495646_0155982 3300046680 Bacteria 1267
302 Ga0495669_0006936 3300046684 Bacteria 4746
303 Ga0495669_0103130 3300046684 Bacteria 1326
304 Ga0495669_0201198 3300046684 Bacteria 952
305 Ga0495624_0175795 3300046690 Bacteria 1305
306 Ga0495624_0277433 3300046690 Bacteria 1012
307 Ga0495624_0497594 3300046690 Bacteria 729
308 Ga0495670_0011594 3300046691 Bacteria 4337
309 Ga0495671_0086860 3300046692 Bacteria 1532
310 Ga0495671_0146203 3300046692 Bacteria 1151
311 Ga0495649_0000331 3300046694 Bacteria 40946
312 Ga0495649_0073591 3300046694 Bacteria 1830
313 Ga0495589_0007096 3300046794 Bacteria 5872
314 Ga0495589_0072845 3300046794 Bacteria 1677
315 Ga0495589_0414890 3300046794 Bacteria 617
316 Ga0495600_0050863 3300046809 Bacteria 2704
317 Ga0495660_0145526 3300046810 Bacteria 1175
318 Ga0495581_0003777 3300047315 Bacteria 8712
319 Ga0495604_0067177 3300047317 Bacteria 2725
320 Ga0495604_0788079 3300047317 Bacteria 599
321 Ga0495674_0028396 3300047319 Bacteria 5100
322 Ga0495674_0309679 3300047319 Bacteria 1288
323 Ga0495672_0055783 3300047320 Bacteria 2303
324 Ga0495676_0830755 3300047321 Bacteria 594
325 Ga0495680_0029064 3300047322 Bacteria 4529
326 Ga0495680_0124112 3300047322 Bacteria 1904
327 Ga0495683_0002548 3300047323 Bacteria 10951
328 Ga0495683_0071902 3300047323 Bacteria 1697
329 Ga0495687_000053 3300047443 Bacteria 195897
330 Ga0495675_0172409 3300047444 Bacteria 1328
331 Ga0495675_0203333 3300047444 Bacteria 1205
332 Ga0495679_027320 3300047446 Bacteria 1885
333 Ga0495673_0096762 3300047469 Bacteria 1199
334 Ga0495673_0215947 3300047469 Bacteria 712
335 Ga0495681_0258099 3300047470 Bacteria 686
336 Ga0495686_0000067 3300047472 Bacteria 218601
337 Ga0495593_0041498 3300047673 Bacteria 2473
338 Ga0495593_0041628 3300047673 Bacteria 2469
339 Ga0495602_0023258 3300048088 Bacteria 6043
340 Ga0495602_0267492 3300048088 Bacteria 1265
341 Ga0495614_0024877 3300048089 Bacteria 2584
342 Ga0495626_0420252 3300048091 Bacteria 515
343 Ga0496100_0009512 3300048903 Bacteria 5462
344 Ga0496100_0016843 3300048903 Bacteria 4299
345 Ga0496100_0430116 3300048903 Bacteria 1009
346 Ga0496100_0475848 3300048903 Bacteria 960
347 Ga0496101_0003862 3300048904 Bacteria 9366
348 Ga0496101_0009823 3300048904 Bacteria 6303
349 Ga0496101_0017431 3300048904 Bacteria 4871
350 Ga0496102_0005489 3300048905 Bacteria 10761
351 Ga0496102_0048566 3300048905 Bacteria 3859
352 Ga0496102_0301504 3300048905 Bacteria 1510
353 Ga0496102_0394460 3300048905 Bacteria 1301
354 Ga0496103_0097413 3300048906 Bacteria 1859
355 Ga0496103_0120579 3300048906 Bacteria 1670
356 Ga0496103_0188540 3300048906 Bacteria 1326
357 Ga0496104_0108998 3300048907 Bacteria 2654
358 Ga0496104_0287323 3300048907 Bacteria 1557
359 Ga0496104_1377115 3300048907 Bacteria 608
360 Ga0496105_0018463 3300048908 Bacteria 5606
361 Ga0496105_0098933 3300048908 Bacteria 2408
362 Ga0496106_0034746 3300048909 Bacteria 3767
363 Ga0496106_0096535 3300048909 Bacteria 2287
364 Ga0496108_0355348 3300048911 Bacteria 1279
365 Ga0496109_0274976 3300048912 Bacteria 1587
366 Ga0496111_0074231 3300048914 Bacteria 2477
367 Ga0496112_0011833 3300048915 Bacteria 7989
368 Ga0496113_0047434 3300048916 Bacteria 3192
369 Ga0496114_0000996 3300048917 Bacteria 21220
370 Ga0496114_0157981 3300048917 Bacteria 1970
371 Ga0496115_0057366 3300048918 Bacteria 3132
372 Ga0496115_0245681 3300048918 Bacteria 1475
373 Ga0496116_0071852 3300048919 Bacteria 2189
374 Ga0496117_0004587 3300048920 Bacteria 15111
375 Ga0496117_0200770 3300048920 Bacteria 1127
376 Ga0496118_0008562 3300048921 Bacteria 10543
377 Ga0496118_0165542 3300048921 Bacteria 1359
378 Ga0496118_0212739 3300048921 Bacteria 1133
379 Ga0496119_0078502 3300048922 Bacteria 1909
380 Ga0496119_0407718 3300048922 Bacteria 647
381 Ga0496119_0540353 3300048922 Bacteria 537
382 Ga0496121_0010374 3300048924 Bacteria 10521
383 Ga0496122_0053129 3300048925 Bacteria 3057
384 Ga0496123_0012724 3300048926 Bacteria 7139
385 Ga0496124_0012907 3300048927 Bacteria 8198
386 Ga0496124_0273793 3300048927 Bacteria 1235
387 Ga0496125_0019251 3300048928 Bacteria 6447
388 Ga0496125_0075350 3300048928 Bacteria 2612
389 Ga0496126_0000038 3300048929 Bacteria 347738
390 Ga0496126_0316939 3300048929 Bacteria 1283
391 Ga0496126_1191088 3300048929 Bacteria 561
392 Ga0495678_136723 3300049459 Bacteria 806
393 Ga0501047_0774343 3300049581 Bacteria 775
394 Ga0501202_131933 3300049652 Bacteria 638
395 nmdc:mga0yw44_225154_c1 3300050492 Bacteria 1244
396 nmdc:mga0k408_750063_c1 3300050493 Bacteria 570
397 nmdc:mga05p37_5541_c1 3300050507 Bacteria 14832
398 nmdc:mga09592_31375_c1 3300050508 Bacteria 4428
399 nmdc:mga09592_71480_c1 3300050508 Bacteria 2945
400 nmdc:mga06r32_1032_c1 3300050510 Bacteria 25099
401 nmdc:mga08y16_2472_c1 3300050511 Bacteria 18971
402 nmdc:mga08y16_533027_c1 3300050511 Bacteria 1190
403 nmdc:mga08y16_588978_c1 3300050511 Unclassified 1122
404 nmdc:mga0a205_424711_c1 3300050515 Bacteria 1191
405 Ga0500646_0386664 3300053090 Bacteria 515
406 Ga0500583_0005805 3300053092 Bacteria 4177
407 Ga0500583_0035567 3300053092 Bacteria 2223
408 Ga0500583_0198428 3300053092 Bacteria 998
409 Ga0500641_0174800 3300053096 Bacteria 924
410 Ga0500641_0251388 3300053096 Unclassified 741
411 Ga0500554_013732 3300053102 Bacteria 2072
412 Ga0500593_189452 3300053117 Bacteria 755
413 Ga0500594_0117249 3300053118 Bacteria 833
414 Ga0500658_0130676 3300053134 Bacteria 1120
415 Ga0500568_0305225 3300053139 Bacteria 577
416 Ga0500604_0139638 3300053151 Bacteria 818
417 Ga0500616_0000299 3300053153 Bacteria 72074
418 Ga0500622_0003528 3300053156 Bacteria 10369
419 Ga0500622_0014314 3300053156 Bacteria 4260
420 Ga0500611_140917 3300053727 Bacteria 656
421 8007372653 8007371054 Bacteria 4849201
422 Ga0075428_101061381
423 MBSR1b_contig_13511962
424 JGI24739J22299_10037288
425 JGI24737J22298_10014298
426 JGI24737J22298_10105368
427 JGI24735J21928_10000925
428 JGI24735J21928_10025449
429 JGI25156J39149_1027353
430 JGI25160J50197_1062253
431 Ga0065712_10317415
432 Ga0065715_10297562
433 Ga0070658_10162714
434 Ga0070658_10819728
435 Ga0070658_11553104
436 Ga0070683_101709006
437 Ga0070677_10657405
438 Ga0068869_100780743
439 Ga0070666_10011694
440 Ga0070666_10116257
441 Ga0070682_100485422
442 Ga0068868_101380376
443 Ga0070660_100005575
444 Ga0070661_101285144
445 Ga0070661_101473029
446 Ga0070669_100954694
447 Ga0070669_101062099
448 Ga0070675_100656997
449 Ga0070671_100562659
450 Ga0070674_100481566
451 Ga0070659_100691703
452 Ga0070667_100035736
453 Ga0070667_100229756
454 Ga0070667_100568622
455 Ga0070667_100667710
456 Ga0070714_100922372
457 Ga0070714_101012088
458 Ga0070663_100062178
459 Ga0070663_100362193
460 Ga0070678_100131513
461 Ga0070678_100294629
462 Ga0070678_101952725
463 Ga0070662_100708600
464 Ga0070681_10050869
465 Ga0070707_101774107
466 Ga0070698_100266573
467 Ga0070699_100115638
468 Ga0070679_100554414
469 Ga0070672_101416295
470 Ga0070665_100395594
471 Ga0070665_102188830
472 Ga0068855_100452689
473 Ga0070664_100190176
474 Ga0068854_100379684
475 Ga0068852_100531615
476 Ga0068859_100090998
477 Ga0068864_100982476
478 Ga0068861_100599361
479 Ga0068861_101194162
480 Ga0068858_101313583
481 Ga0068860_100002910
482 Ga0068860_101598739
483 Ga0068860_102824392
484 Ga0068862_100215932
485 Ga0068862_100258019
486 Ga0068862_101485721
487 Ga0068862_101893186
488 Ga0081540_1045238
489 Ga0075365_10022403
490 Ga0075428_100005737
491 Ga0075428_100421157
492 Ga0075430_101744140
493 Ga0075431_100000953
494 Ga0075429_100002934
495 Ga0075429_100075287
496 Ga0075429_100823870
497 Ga0097620_100091000
498 Ga0105251_10005927
499 Ga0105251_10273300
500 Ga0105244_10052908
501 Ga0105244_10417165
502 Ga0105240_10012208
503 Ga0105240_11359641
504 Ga0111539_10004925
505 Ga0111539_10526227
506 Ga0111539_10593228
507 Ga0105245_11462111
508 Ga0105245_11885957
509 Ga0105247_10252825
510 Ga0114129_10013394
511 Ga0105243_11140305
512 Ga0105242_10662347
513 Ga0105242_11384692
514 Ga0105248_10035844
515 Ga0105248_11432621
516 Ga0105237_10368665
517 Ga0105238_10033821
518 Ga0105238_11542520
519 Ga0105249_13017658
520 Ga0105239_10368914
521 Ga0105239_10458284
522 Ga0105239_11430341
523 Ga0105246_10159880
524 Ga0105246_11385433
525 Ga0157369_10342677
526 Ga0157374_10019479
527 Ga0157374_11398519
528 Ga0163162_10005023
529 Ga0163162_10548155
530 Ga0163162_11189931
531 Ga0163162_11654551
532 Ga0157372_10946018
533 Ga0157375_10013696
534 Ga0157380_12434838
535 Ga0157377_11687302
536 Ga0157379_11175932
537 Ga0157376_10808982
538 Ga0157376_10967496
539 Ga0182007_10001737
540 Ga0163161_10504562
541 Ga0213872_10000080
542 Ga0213872_10003124
543 Ga0213876_10003414
544 Ga0213876_10120957
545 Ga0209759_1002720
546 Ga0207426_1004087
547 Ga0207713_1050363
548 Ga0207682_10472563
549 Ga0207680_10165135
550 Ga0207647_10022288
551 Ga0207705_10725762
552 Ga0207707_10050151
553 Ga0207695_10068407
554 Ga0207695_10214566
555 Ga0207671_10099042
556 Ga0207671_10891168
557 Ga0207660_11513374
558 Ga0207657_10068119
559 Ga0207649_10538475
560 Ga0207652_11755851
561 Ga0207694_10410307
562 Ga0207694_10820821
563 Ga0207659_10504456
564 Ga0207687_10758405
565 Ga0207687_11691959
566 Ga0207664_10388511
567 Ga0207664_10868624
568 Ga0207706_10402940
569 Ga0207686_11753482
570 Ga0207711_10033538
571 Ga0207711_11472205
572 Ga0207689_11158969
573 Ga0207679_10192683
574 Ga0207667_10017286
575 Ga0207658_10059265
576 Ga0207677_11580817
577 Ga0207703_10320800
578 Ga0207678_10140360
579 Ga0207678_10263410
580 Ga0207641_10506636
581 Ga0207676_10176035
582 Ga0207675_100679418
583 Ga0207675_102044229
584 Ga0207683_10601287
585 Ga0207698_11987721
586 Ga0209970_1001312
587 Ga0209983_1123195
588 Ga0207428_10031642
589 Ga0207428_11210641
590 Ga0268266_10065221
591 Ga0268266_10559477
592 Ga0268265_10087579
593 Ga0268265_10350057
594 Ga0268265_11758243
595 Ga0268264_10015518
596 Ga0268264_10427446
597 Ga0265332_10000187
598 Ga0307513_10911982
599 Ga0316578_10338659
600 Ga0307516_10155668
601 Ga0307413_12072381
602 Ga0307410_10435007
603 Ga0307410_12093374
604 Ga0307409_100583694
605 Ga0307409_100789863
606 Ga0307409_101968406
607 Ga0307409_102029044
608 Ga0307416_100806312
609 Ga0307416_100866080
610 Ga0307411_11075710
611 Ga0307411_11115428
612 Ga0307415_101514544
613 Ga0373931_0174722
614 Ga0395899_0006993
615 Ga0395900_0282473
616 Ga0395900_0357274
617 Ga0395898_0563861
618 Ga0395905_0014117
619 Ga0395905_0138042
620 Ga0395905_0261300
621 Ga0395905_1775028
622 Ga0436364_0259513
623 Ga0395901_0049590
624 Ga0395901_0381639
625 Ga0436365_1107141
626 Ga0436365_1403869
627 Ga0436365_1589686
628 Ga0436361_0247001
629 Ga0436361_0538691
630 Ga0436361_0841075
631 Ga0439465_0331872
632 Ga0451795_0365438
633 Ga0451807_1041869
634 Ga0451833_1438757
635 Ga0451855_0352680
636 Ga0451853_3317805
637 Ga0439462_0138346
638 Ga0451577_0032453
639 Ga0466969_0432450
640 Ga0453683_0015947
641 Ga0453683_0630771
642 Ga0466965_0105701
643 Ga0466966_0833964
644 Ga0453684_0002077
645 Ga0453684_0059811
646 Ga0466968_0391876
647 Ga0451576_0003317
648 Ga0451576_0192600
649 Ga0451576_1100798
650 Ga0451576_1447573
651 Ga0466967_0735760
652 Ga0466967_1057088
653 Ga0495592_0252105
654 Ga0495592_0420823
655 Ga0495603_0025666
656 Ga0495590_0067683
657 Ga0495590_0113534
658 Ga0495590_0181096
659 Ga0495591_025857
660 Ga0495629_0000132
661 Ga0495629_0073522
662 Ga0495638_0003106
663 Ga0495653_0174682
664 Ga0495653_0773935
665 Ga0495650_0005950
666 Ga0495650_0071669
667 Ga0495650_0244516
668 Ga0495580_0028431
669 Ga0495582_0177196
670 Ga0495605_0011877
671 Ga0495662_0038574
672 Ga0495664_0046112
673 Ga0495664_0464271
674 Ga0495584_0032672
675 Ga0495584_0042318
676 Ga0495585_0012496
677 Ga0495585_0543456
678 Ga0495596_0392911
679 Ga0495596_0440088
680 Ga0495607_0177240
681 Ga0495583_0098871
682 Ga0495606_0016116
683 Ga0495606_0073235
684 Ga0495616_0272019
685 Ga0495620_0024669
686 Ga0495620_0405917
687 Ga0495628_0007117
688 Ga0495628_0350499
689 Ga0495628_1022412
690 Ga0495630_0143579
691 Ga0495630_0848648
692 Ga0495631_0055393
693 Ga0495631_0374117
694 Ga0495632_0140197
695 Ga0495632_0153924
696 Ga0495632_0160456
697 Ga0495644_0047367
698 Ga0495642_0052811
699 Ga0495642_0071210
700 Ga0495652_0105502
701 Ga0495652_0148247
702 Ga0495654_0072193
703 Ga0495654_0084566
704 Ga0495654_0256810
705 Ga0495665_0005251
706 Ga0495665_0118547
707 Ga0495586_0124166
708 Ga0495586_0179656
709 Ga0495645_0000253
710 Ga0495645_0009429
711 Ga0495645_0184707
712 Ga0495645_0753639
713 Ga0495668_0541492
714 Ga0495634_0162121
715 Ga0495611_0268465
716 Ga0495635_0208850
717 Ga0495588_0336154
718 Ga0495588_0513055
719 Ga0495588_0574163
720 Ga0495623_0091672
721 Ga0495623_0242858
722 Ga0495646_0155982
723 Ga0495669_0006936
724 Ga0495669_0103130
725 Ga0495669_0201198
726 Ga0495624_0175795
727 Ga0495624_0277433
728 Ga0495624_0497594
729 Ga0495670_0011594
730 Ga0495671_0086860
731 Ga0495671_0146203
732 Ga0495649_0000331
733 Ga0495649_0073591
734 Ga0495589_0007096
735 Ga0495589_0072845
736 Ga0495589_0414890
737 Ga0495600_0050863
738 Ga0495660_0145526
739 Ga0495581_0003777
740 Ga0495604_0067177
741 Ga0495604_0788079
742 Ga0495674_0028396
743 Ga0495674_0309679
744 Ga0495672_0055783
745 Ga0495676_0830755
746 Ga0495680_0029064
747 Ga0495680_0124112
748 Ga0495683_0002548
749 Ga0495683_0071902
750 Ga0495687_000053
751 Ga0495675_0172409
752 Ga0495675_0203333
753 Ga0495679_027320
754 Ga0495673_0096762
755 Ga0495673_0215947
756 Ga0495681_0258099
757 Ga0495686_0000067
758 Ga0495593_0041498
759 Ga0495593_0041628
760 Ga0495602_0023258
761 Ga0495602_0267492
762 Ga0495614_0024877
763 Ga0495626_0420252
764 Ga0496100_0009512
765 Ga0496100_0016843
766 Ga0496100_0430116
767 Ga0496100_0475848
768 Ga0496101_0003862
769 Ga0496101_0009823
770 Ga0496101_0017431
771 Ga0496102_0005489
772 Ga0496102_0048566
773 Ga0496102_0301504
774 Ga0496102_0394460
775 Ga0496103_0097413
776 Ga0496103_0120579
777 Ga0496103_0188540
778 Ga0496104_0108998
779 Ga0496104_0287323
780 Ga0496104_1377115
781 Ga0496105_0018463
782 Ga0496105_0098933
783 Ga0496106_0034746
784 Ga0496106_0096535
785 Ga0496108_0355348
786 Ga0496109_0274976
787 Ga0496111_0074231
788 Ga0496112_0011833
789 Ga0496113_0047434
790 Ga0496114_0000996
791 Ga0496114_0157981
792 Ga0496115_0057366
793 Ga0496115_0245681
794 Ga0496116_0071852
795 Ga0496117_0004587
796 Ga0496117_0200770
797 Ga0496118_0008562
798 Ga0496118_0165542
799 Ga0496118_0212739
800 Ga0496119_0078502
801 Ga0496119_0407718
802 Ga0496119_0540353
803 Ga0496121_0010374
804 Ga0496122_0053129
805 Ga0496123_0012724
806 Ga0496124_0012907
807 Ga0496124_0273793
808 Ga0496125_0019251
809 Ga0496125_0075350
810 Ga0496126_0000038
811 Ga0496126_0316939
812 Ga0496126_1191088
813 Ga0495678_136723
814 Ga0501047_0774343
815 Ga0501202_131933
816 nmdc:mga0yw44_225154_c1
817 nmdc:mga0k408_750063_c1
818 nmdc:mga05p37_5541_c1
819 nmdc:mga09592_31375_c1
820 nmdc:mga09592_71480_c1
821 nmdc:mga06r32_1032_c1
822 nmdc:mga08y16_2472_c1
823 nmdc:mga08y16_533027_c1
824 nmdc:mga08y16_588978_c1
825 nmdc:mga0a205_424711_c1
826 Ga0500646_0386664
827 Ga0500583_0005805
828 Ga0500583_0035567
829 Ga0500583_0198428
830 Ga0500641_0174800
831 Ga0500641_0251388
832 Ga0500554_013732
833 Ga0500593_189452
834 Ga0500594_0117249
835 Ga0500658_0130676
836 Ga0500568_0305225
837 Ga0500604_0139638
838 Ga0500616_0000299
839 Ga0500622_0003528
840 Ga0500622_0014314
841 Ga0500611_140917
842 8007372653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

8

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8axk-assembly1.cif.gz_G type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri 0.9479 5 84
6r6b-assembly1.cif.gz_H structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). 0.9473 3 84
6pep-assembly1.cif.gz_8 focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex 0.94 3 85
6pep-assembly1.cif.gz_8 focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex 0.9191 3 85
7ahi-assembly1.cif.gz_1I substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 2 0.9117 3 83
ID Description Score Start End Superfamily
af_A0A1D6PCH9_40_269_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5881 11 76 1.50.40.10
af_H9G2R4_232_350_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5809 9 83 1.10.287.70
af_A0A1D8PIH9_68_353_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5607 9 72 1.50.40.10
af_Q5EB62_233_413_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5495 6 67 1.50.40.10
af_G5EDJ9_43_194_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5316 8 67 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A0R2D0F7-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9811 11 84 GO:0005886
GO:0009306
GO:0009425
GO:0044780
AF-A0A562NSK2-F1-model_v4 Type III secretion protein S 0.9758 5 84 GO:0005886
GO:0009306
AF-A0A351NMM5-F1-model_v4 deleted 0.9754 10 83
AF-A0A074TVX4-F1-model_v4 deleted 0.9744 12 86
AF-A0A7Y3RNP9-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9736 1 84 GO:0005886
GO:0009306

Map