F439911

General Info

Members Datasets Scaffolds Average Seq Length
421 275 416 423

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100000450|Ga0070680_1000004502
Length 462
Sequence MMARAEEGRGSWTSSPARRASLSPQRNPRAFGGSPIAPAAGSADVASSARKADASPRDWLVLFTLTFVYVLNFLDRQLLAILAKPIQDSLHVTDGQLGLIGGFYFALFYCFIAIPVGWFADRTNRVTVLSLACAIWSGATACCGLAASYPQLVAARMAVGFGEAGGVPPSYSIITDTFPPGRRGTALGLYNLGPPVGAADWRTAFVTIGLVGIVTAILVRIIVREPAKGALDPVARNAGEGRTSFLGTVGMFFANPVLMLAALGSGATQFITYGLGNFAVLFLMREKGMTLAQVAIYYALVVAVGMSAGMIVSGRVIDRFVRRSRRIYATAPAVSLAAALPLYLAFVWAPTWPLALVLLTLVMFLNYFYLSSSVALVQEEVRPDQRVLSAALLLLVMNFIGLGLGPTYVGAASDAFAARHIAHPLQIALYTLSPFYVIAIILFWRLSRILGAETSPSQRLPS

Samples

Sample ID Description Type Environment
1 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
2 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
3 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
4 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
5 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
263 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.24
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.29
Nodule 0.24
Rhizoplane 4.04
Rhizosphere 68.17
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019889 3300001989 Bacteria 2401
2 JGI25150J39212_1000218 3300002774 Bacteria 31294
3 JGI25165J46597_1000041 3300003214 Bacteria 272566
4 JGI25153J46596_10000093 3300003215 Bacteria 103442
5 JGI25153J46596_10000112 3300003215 Bacteria 92578
6 Ga0055525_1000070 3300003759 Bacteria 183047
7 Ga0055542_1000402 3300003762 Bacteria 42527
8 Ga0055529_1000439 3300003763 Bacteria 41829
9 Ga0055526_1002171 3300003771 Bacteria 13457
10 Ga0055537_1000547 3300003773 Bacteria 21565
11 Ga0055537_1003930 3300003773 Bacteria 4416
12 Ga0055537_1010589 3300003773 Bacteria 1935
13 Ga0055536_1008759 3300003781 Bacteria 4292
14 Ga0055528_1009621 3300003790 Bacteria 4022
15 Ga0055540_1001661 3300003792 Bacteria 12891
16 Ga0065165_1002982 3300005262 Bacteria 12841
17 Ga0065715_10094690 3300005293 Bacteria 4267
18 Ga0065707_10109403 3300005295 Bacteria 2471
19 Ga0070658_10005982 3300005327 Bacteria 9861
20 Ga0070658_10007077 3300005327 Bacteria 9052
21 Ga0070658_10008162 3300005327 Bacteria 8419
22 Ga0070683_100001582 3300005329 Bacteria 17608
23 Ga0070680_100000450 3300005336 Bacteria 28021
24 Ga0070660_100003015 3300005339 Bacteria 11596
25 Ga0070660_100010988 3300005339 Bacteria 6415
26 Ga0070660_100063756 3300005339 Bacteria 2865
27 Ga0070660_100067473 3300005339 Bacteria 2787
28 Ga0070691_10006192 3300005341 Bacteria 5460
29 Ga0070661_100000001 3300005344 Bacteria 424830
30 Ga0070661_100006146 3300005344 Bacteria 8272
31 Ga0070661_100234604 3300005344 Bacteria 1411
32 Ga0070668_100021227 3300005347 Bacteria 4909
33 Ga0070669_100097677 3300005353 Bacteria 2211
34 Ga0070671_100035458 3300005355 Bacteria 4133
35 Ga0070671_100157312 3300005355 Bacteria 1920
36 Ga0070674_100014066 3300005356 Bacteria 4966
37 Ga0070673_100121523 3300005364 Bacteria 2179
38 Ga0070659_100001785 3300005366 Bacteria 15473
39 Ga0070667_100052014 3300005367 Bacteria 3455
40 Ga0070709_10092368 3300005434 Bacteria 1999
41 Ga0070714_100015619 3300005435 Bacteria 6110
42 Ga0070713_100007150 3300005436 Bacteria 7808
43 Ga0070713_100008980 3300005436 Bacteria 7124
44 Ga0070700_100017359 3300005441 Bacteria 4114
45 Ga0070663_100107535 3300005455 Bacteria 2091
46 Ga0070678_100001978 3300005456 Bacteria 11077
47 Ga0070681_10093941 3300005458 Bacteria 2948
48 Ga0070685_10001691 3300005466 Bacteria 11601
49 Ga0070679_100000007 3300005530 Bacteria 195373
50 Ga0070679_100112405 3300005530 Bacteria 2710
51 Ga0068853_100069814 3300005539 Bacteria 3057
52 Ga0070672_100024769 3300005543 Bacteria 4441
53 Ga0070672_100024799 3300005543 Bacteria 4439
54 Ga0070665_100000105 3300005548 Bacteria 157734
55 Ga0070665_100000514 3300005548 Bacteria 55345
56 Ga0070665_100035073 3300005548 Bacteria 5045
57 Ga0070704_100028204 3300005549 Bacteria 3732
58 Ga0068855_100000157 3300005563 Bacteria 86631
59 Ga0068855_100017422 3300005563 Bacteria 8642
60 Ga0068857_100013457 3300005577 Bacteria 7126
61 Ga0068857_100105709 3300005577 Bacteria 2527
62 Ga0068859_100040436 3300005617 Bacteria 4681
63 Ga0068859_100368421 3300005617 Bacteria 1532
64 Ga0068861_100120468 3300005719 Bacteria 2116
65 Ga0068870_10033611 3300005840 Bacteria 2618
66 Ga0068863_100040342 3300005841 Bacteria 4439
67 Ga0068858_100001099 3300005842 Bacteria 27967
68 Ga0068860_100086344 3300005843 Bacteria 2986
69 Ga0068862_100008144 3300005844 Bacteria 8665
70 Ga0068862_100025637 3300005844 Bacteria 4951
71 Ga0070717_10012698 3300006028 Bacteria 6430
72 Ga0075364_10010144 3300006051 Bacteria 5680
73 Ga0075366_10030953 3300006195 Bacteria 3148
74 Ga0075370_10002085 3300006353 Bacteria 9107
75 Ga0068871_100007771 3300006358 Bacteria 7678
76 Ga0068865_100093947 3300006881 Bacteria 2182
77 Ga0068865_100196484 3300006881 Bacteria 1563
78 Ga0097620_100040436 3300006931 Bacteria 4681
79 Ga0097620_100368441 3300006931 Bacteria 1532
80 Ga0099826_10087279 3300006948 Bacteria 1920
81 Ga0105240_10002740 3300009093 Bacteria 27879
82 Ga0105240_10082466 3300009093 Bacteria 3949
83 Ga0111539_10017359 3300009094 Bacteria 8907
84 Ga0105245_10001154 3300009098 Bacteria 23876
85 Ga0105243_10001935 3300009148 Bacteria 17641
86 Ga0105243_10009372 3300009148 Bacteria 7459
87 Ga0105241_10047070 3300009174 Bacteria 3278
88 Ga0105242_10044126 3300009176 Bacteria 3609
89 Ga0105248_10046277 3300009177 Bacteria 4876
90 Ga0105248_10341514 3300009177 Bacteria 1686
91 Ga0105237_10000580 3300009545 Bacteria 51217
92 Ga0105238_10045067 3300009551 Bacteria 4456
93 Ga0105238_10075239 3300009551 Bacteria 3369
94 Ga0105249_10024945 3300009553 Bacteria 5379
95 Ga0105249_10112206 3300009553 Bacteria 2578
96 Ga0105239_10003181 3300010375 Bacteria 20325
97 Ga0105239_10016861 3300010375 Bacteria 8073
98 Ga0157371_10069082 3300013102 Bacteria 2501
99 Ga0157370_10006019 3300013104 Bacteria 13495
100 Ga0157369_10004603 3300013105 Bacteria 16206
101 Ga0157369_10034771 3300013105 Bacteria 5528
102 Ga0157378_10198066 3300013297 Bacteria 1898
103 Ga0163162_10024266 3300013306 Bacteria 5985
104 Ga0163162_10027339 3300013306 Bacteria 5641
105 Ga0157372_10010466 3300013307 Bacteria 9871
106 Ga0157375_10036744 3300013308 Bacteria 4688
107 Ga0163163_10064817 3300014325 Bacteria 3626
108 Ga0163161_10005209 3300017792 Bacteria 9044
109 Ga0163161_10032504 3300017792 Bacteria 3726
110 Ga0209563_100053 3300025230 Bacteria 332370
111 Ga0207425_1000072 3300025245 Bacteria 115017
112 Ga0209148_1000008 3300025254 Bacteria 1504371
113 Ga0209129_1002115 3300025258 Bacteria 10102
114 Ga0209233_1000104 3300025261 Bacteria 272675
115 Ga0209233_1010563 3300025261 Bacteria 2760
116 Ga0209565_1000177 3300025263 Bacteria 80620
117 Ga0209565_1000266 3300025263 Bacteria 54266
118 Ga0209565_1000297 3300025263 Bacteria 47258
119 Ga0209455_1000002 3300025272 Bacteria 1505459
120 Ga0209673_1001189 3300025273 Bacteria 27984
121 Ga0209673_1002204 3300025273 Bacteria 14253
122 Ga0209675_1011980 3300025291 Bacteria 2825
123 Ga0209676_1000678 3300025292 Bacteria 48300
124 Ga0209676_1002664 3300025292 Bacteria 12123
125 Ga0209025_1001194 3300025294 Bacteria 36680
126 Ga0209564_1002354 3300025295 Bacteria 15236
127 Ga0209564_1010617 3300025295 Bacteria 4217
128 Ga0209758_1000009 3300025297 Bacteria 1123483
129 Ga0209758_1000023 3300025297 Bacteria 612453
130 Ga0209758_1000785 3300025297 Bacteria 45459
131 Ga0209758_1000965 3300025297 Bacteria 38806
132 Ga0209050_1000005 3300025298 Bacteria 1557793
133 Ga0209050_1000195 3300025298 Bacteria 136316
134 Ga0209050_1013778 3300025298 Bacteria 3554
135 Ga0209256_1001568 3300025299 Bacteria 22481
136 Ga0209256_1003932 3300025299 Bacteria 9787
137 Ga0209256_1007700 3300025299 Bacteria 5225
138 Ga0207426_1018439 3300025302 Bacteria 2458
139 Ga0209051_1000414 3300025303 Bacteria 58981
140 Ga0209257_1007448 3300025304 Bacteria 6602
141 Ga0209257_1007449 3300025304 Bacteria 6601
142 Ga0207656_10023802 3300025321 Bacteria 2470
143 Ga0207642_10023331 3300025899 Bacteria 2470
144 Ga0207647_10018738 3300025904 Bacteria 4672
145 Ga0207643_10017741 3300025908 Bacteria 3896
146 Ga0207705_10000946 3300025909 Bacteria 23719
147 Ga0207705_10001231 3300025909 Bacteria 20618
148 Ga0207705_10008759 3300025909 Bacteria 7373
149 Ga0207705_10009340 3300025909 Bacteria 7132
150 Ga0207707_10001184 3300025912 Bacteria 24565
151 Ga0207707_10063431 3300025912 Bacteria 3216
152 Ga0207695_10000004 3300025913 Bacteria 1288665
153 Ga0207695_10007702 3300025913 Bacteria 13636
154 Ga0207671_10002351 3300025914 Bacteria 20357
155 Ga0207671_10002549 3300025914 Bacteria 19362
156 Ga0207660_10000575 3300025917 Bacteria 24705
157 Ga0207660_10000826 3300025917 Bacteria 20412
158 Ga0207662_10001052 3300025918 Bacteria 12941
159 Ga0207657_10000141 3300025919 Bacteria 72714
160 Ga0207649_10000011 3300025920 Bacteria 266219
161 Ga0207652_10000001 3300025921 Bacteria 1006643
162 Ga0207652_10000002 3300025921 Bacteria 878035
163 Ga0207652_10001119 3300025921 Bacteria 24156
164 Ga0207652_10037813 3300025921 Bacteria 4087
165 Ga0207694_10000015 3300025924 Bacteria 363898
166 Ga0207694_10016975 3300025924 Bacteria 5499
167 Ga0207694_10048121 3300025924 Bacteria 3299
168 Ga0207659_10017099 3300025926 Bacteria 4732
169 Ga0207687_10001989 3300025927 Bacteria 14047
170 Ga0207700_10002942 3300025928 Bacteria 9827
171 Ga0207700_10090005 3300025928 Bacteria 2420
172 Ga0207664_10030152 3300025929 Bacteria 4140
173 Ga0207686_10034863 3300025934 Bacteria 3016
174 Ga0207709_10000047 3300025935 Bacteria 238649
175 Ga0207709_10143161 3300025935 Bacteria 1646
176 Ga0207670_10004663 3300025936 Bacteria 7430
177 Ga0207669_10000038 3300025937 Bacteria 74003
178 Ga0207691_10055104 3300025940 Bacteria 3625
179 Ga0207691_10058376 3300025940 Bacteria 3510
180 Ga0207691_10110395 3300025940 Bacteria 2446
181 Ga0207691_10126765 3300025940 Bacteria 2258
182 Ga0207689_10151219 3300025942 Bacteria 1913
183 Ga0207667_10000160 3300025949 Bacteria 99695
184 Ga0207651_10006137 3300025960 Bacteria 6248
185 Ga0207668_10041897 3300025972 Bacteria 3097
186 Ga0207703_10000958 3300026035 Bacteria 27893
187 Ga0207641_10048084 3300026088 Bacteria 3599
188 Ga0207674_10004125 3300026116 Bacteria 17573
189 Ga0207674_10057962 3300026116 Bacteria 3925
190 Ga0207675_100174121 3300026118 Bacteria 2058
191 Ga0207683_10000100 3300026121 Bacteria 71364
192 Ga0207683_10194430 3300026121 Bacteria 1843
193 Ga0207698_10005527 3300026142 Bacteria 7821
194 Ga0207698_10053724 3300026142 Bacteria 3095
195 Ga0268266_10001778 3300028379 Bacteria 24452
196 Ga0268266_10011637 3300028379 Bacteria 7638
197 Ga0268266_10018163 3300028379 Bacteria 5995
198 Ga0268265_10032983 3300028380 Bacteria 3760
199 Ga0268264_10071050 3300028381 Bacteria 2948
200 Ga0265334_10016622 3300028573 Bacteria 3042
201 Ga0265338_10076550 3300028800 Bacteria 2833
202 Ga0265338_10087298 3300028800 Bacteria 2592
203 Ga0265762_1002060 3300030760 Bacteria 3663
204 Ga0265325_10001546 3300031241 Bacteria 16055
205 Ga0265340_10000051 3300031247 Bacteria 54481
206 Ga0265340_10011404 3300031247 Bacteria 4721
207 Ga0265340_10018404 3300031247 Bacteria 3603
208 Ga0265331_10000003 3300031250 Bacteria 499358
209 Ga0265327_10000447 3300031251 Bacteria 74605
210 Ga0265316_10013291 3300031344 Bacteria 7321
211 Ga0265316_10177532 3300031344 Unclassified 1586
212 Ga0307513_10064491 3300031456 Bacteria 3860
213 Ga0307509_10000004 3300031507 Bacteria 535507
214 Ga0307509_10000019 3300031507 Bacteria 256151
215 Ga0265313_10006328 3300031595 Bacteria 8424
216 Ga0265314_10004844 3300031711 Bacteria 12308
217 Ga0265314_10074999 3300031711 Unclassified 2251
218 Ga0316576_10005436 3300031727 Bacteria 7784
219 Ga0316576_10126366 3300031727 Bacteria 1922
220 Ga0307405_10074909 3300031731 Bacteria 2190
221 Ga0307413_10056267 3300031824 Bacteria 2398
222 Ga0307410_10030122 3300031852 Bacteria 3464
223 Ga0307407_10051300 3300031903 Bacteria 2364
224 Ga0307412_10043255 3300031911 Bacteria 2932
225 Ga0307412_10064282 3300031911 Bacteria 2479
226 Ga0307412_10088241 3300031911 Bacteria 2163
227 Ga0307409_100160867 3300031995 Bacteria 1963
228 Ga0307416_100045926 3300032002 Bacteria 3443
229 Ga0307416_100127685 3300032002 Bacteria 2281
230 Ga0307414_10119828 3300032004 Bacteria 2021
231 Ga0307411_10003537 3300032005 Bacteria 7272
232 Ga0307415_100030235 3300032126 Bacteria 3473
233 Ga0307510_10000103 3300033180 Bacteria 66493
234 Ga0307510_10011071 3300033180 Bacteria 10720
235 Ga0373934_0000281 3300035086 Bacteria 18318
236 Ga0373923_0006447 3300035111 Bacteria 4059
237 Ga0373953_0088657 3300035117 Bacteria 1292
238 Ga0373933_0000440 3300035724 Bacteria 25968
239 Ga0373937_0001057 3300036401 Bacteria 23218
240 Ga0316584_0064239 3300036712 Bacteria 2749
241 Ga0395900_0029929 3300037418 Bacteria 5588
242 Ga0395900_0105687 3300037418 Bacteria 2892
243 Ga0395905_0006821 3300037471 Bacteria 11431
244 Ga0395905_0007316 3300037471 Bacteria 10999
245 Ga0395901_0017286 3300038443 Bacteria 7362
246 Ga0395901_0165665 3300038443 Bacteria 2321
247 Ga0395901_0230305 3300038443 Bacteria 1934
248 Ga0237819_00694 3300038705 Bacteria 10932
249 Ga0436365_0499883 3300039437 Bacteria 1566
250 Ga0436365_1887441 3300039437 Bacteria 2399
251 Ga0439449_0014221 3300042007 Bacteria 2992
252 Ga0451577_0274232 3300042876 Bacteria 1528
253 Ga0466957_0020241 3300044842 Bacteria 3915
254 Ga0495592_0018190 3300046454 Bacteria 5340
255 Ga0495638_0000548 3300046460 Bacteria 42967
256 Ga0495638_0001857 3300046460 Bacteria 18277
257 Ga0495638_0002338 3300046460 Bacteria 15575
258 Ga0495638_0052535 3300046460 Bacteria 2538
259 Ga0495651_0000375 3300046462 Bacteria 34541
260 Ga0495653_0000674 3300046463 Bacteria 26104
261 Ga0495650_0000017 3300046471 Bacteria 542552
262 Ga0495650_0000722 3300046471 Bacteria 41881
263 Ga0495650_0031571 3300046471 Bacteria 2381
264 Ga0495584_0048780 3300046491 Bacteria 2134
265 Ga0495585_0048953 3300046492 Bacteria 2349
266 Ga0495583_0000447 3300046506 Bacteria 61780
267 Ga0495583_0011856 3300046506 Bacteria 4978
268 Ga0495583_0018598 3300046506 Bacteria 3654
269 Ga0495583_0037764 3300046506 Bacteria 2287
270 Ga0495606_0000383 3300046507 Bacteria 75070
271 Ga0495606_0033704 3300046507 Bacteria 3528
272 Ga0495608_0000164 3300046511 Bacteria 47157
273 Ga0495610_0000058 3300046512 Bacteria 137991
274 Ga0495616_0070889 3300046513 Bacteria 1686
275 Ga0495618_0009400 3300046514 Bacteria 5902
276 Ga0495628_0008718 3300046516 Bacteria 8676
277 Ga0495630_0002248 3300046517 Bacteria 13441
278 Ga0495631_0078271 3300046518 Bacteria 1427
279 Ga0495632_0050885 3300046519 Bacteria 2041
280 Ga0495637_0002108 3300046520 Bacteria 11187
281 Ga0495643_0001677 3300046522 Bacteria 19378
282 Ga0495643_0101879 3300046522 Bacteria 1470
283 Ga0495648_0000113 3300046524 Bacteria 98919
284 Ga0495648_0000901 3300046524 Bacteria 31037
285 Ga0495663_0002840 3300046525 Bacteria 5121
286 Ga0495652_0031663 3300046529 Bacteria 4630
287 Ga0495654_0000012 3300046530 Bacteria 328997
288 Ga0495587_0002892 3300046536 Bacteria 11508
289 Ga0495587_0009298 3300046536 Bacteria 6305
290 Ga0495645_0000520 3300046543 Bacteria 26574
291 Ga0495622_0009137 3300046557 Bacteria 4589
292 Ga0495622_0032738 3300046557 Bacteria 2427
293 Ga0495667_0001755 3300046559 Bacteria 14390
294 Ga0495668_0000037 3300046616 Bacteria 233981
295 Ga0495625_0000060 3300046660 Bacteria 179425
296 Ga0495625_0001996 3300046660 Bacteria 23043
297 Ga0495625_0044054 3300046660 Bacteria 3232
298 Ga0495625_0055059 3300046660 Bacteria 2838
299 Ga0495625_0059435 3300046660 Bacteria 2712
300 Ga0495625_0117605 3300046660 Bacteria 1812
301 Ga0495635_0000328 3300046663 Bacteria 30368
302 Ga0495661_0044925 3300046665 Bacteria 2705
303 Ga0495657_0000858 3300046675 Bacteria 26800
304 Ga0495599_0000418 3300046678 Bacteria 24252
305 Ga0495623_0001187 3300046679 Bacteria 17670
306 Ga0495646_0009062 3300046680 Bacteria 6309
307 Ga0495670_0000036 3300046691 Bacteria 78512
308 Ga0495671_0037347 3300046692 Bacteria 2457
309 Ga0495649_0000092 3300046694 Bacteria 77734
310 Ga0495600_0000443 3300046809 Bacteria 21356
311 Ga0495600_0001782 3300046809 Bacteria 12036
312 Ga0495604_0001805 3300047317 Bacteria 17435
313 Ga0495674_0002919 3300047319 Bacteria 16639
314 Ga0495672_0001431 3300047320 Bacteria 23457
315 Ga0495683_0002703 3300047323 Bacteria 10584
316 Ga0495687_000082 3300047443 Bacteria 147137
317 Ga0495677_0001685 3300047445 Bacteria 8892
318 Ga0495673_0002140 3300047469 Bacteria 14343
319 Ga0495681_0002528 3300047470 Bacteria 13027
320 Ga0495684_0000730 3300047471 Bacteria 26490
321 Ga0495686_0000260 3300047472 Bacteria 94551
322 Ga0495686_0009138 3300047472 Bacteria 7179
323 Ga0495686_0020098 3300047472 Bacteria 4455
324 Ga0495686_0047492 3300047472 Bacteria 2710
325 Ga0495602_0014274 3300048088 Bacteria 8069
326 Ga0496100_0134196 3300048903 Bacteria 1747
327 Ga0496102_0000930 3300048905 Bacteria 27582
328 Ga0496102_0007236 3300048905 Bacteria 9473
329 Ga0496102_0016833 3300048905 Bacteria 6396
330 Ga0496103_0001181 3300048906 Bacteria 17921
331 Ga0496103_0043184 3300048906 Unclassified 2775
332 Ga0496104_0003538 3300048907 Bacteria 13471
333 Ga0496105_0001238 3300048908 Bacteria 17814
334 Ga0496110_0035991 3300048913 Bacteria 4298
335 Ga0496111_0005608 3300048914 Bacteria 8072
336 Ga0496113_0002671 3300048916 Bacteria 10452
337 Ga0496114_0015611 3300048917 Bacteria 6107
338 Ga0496114_0040000 3300048917 Bacteria 3880
339 Ga0496115_0000339 3300048918 Bacteria 39809
340 Ga0496115_0000538 3300048918 Bacteria 29463
341 Ga0496115_0065644 3300048918 Bacteria 2932
342 Ga0496115_0130469 3300048918 Bacteria 2071
343 Ga0496116_0004986 3300048919 Bacteria 12506
344 Ga0496116_0006574 3300048919 Bacteria 10525
345 Ga0496116_0016470 3300048919 Bacteria 5781
346 Ga0496117_0000125 3300048920 Bacteria 168885
347 Ga0496117_0000636 3300048920 Bacteria 56482
348 Ga0496117_0003623 3300048920 Bacteria 17798
349 Ga0496118_0000016 3300048921 Bacteria 549586
350 Ga0496118_0000665 3300048921 Bacteria 56145
351 Ga0496118_0002640 3300048921 Bacteria 23762
352 Ga0496119_0011123 3300048922 Bacteria 7494
353 Ga0496119_0019938 3300048922 Bacteria 4912
354 Ga0496120_0014307 3300048923 Bacteria 5296
355 Ga0496120_0014942 3300048923 Bacteria 5144
356 Ga0496120_0020600 3300048923 Bacteria 4184
357 Ga0496121_0004809 3300048924 Bacteria 17800
358 Ga0496121_0017679 3300048924 Bacteria 7258
359 Ga0496121_0028751 3300048924 Bacteria 5166
360 Ga0496121_0116247 3300048924 Bacteria 2029
361 Ga0496122_0013053 3300048925 Bacteria 8181
362 Ga0496123_0003619 3300048926 Bacteria 17115
363 Ga0496123_0008086 3300048926 Bacteria 9727
364 Ga0496124_0001474 3300048927 Bacteria 34588
365 Ga0496124_0034600 3300048927 Bacteria 4431
366 Ga0496124_0076975 3300048927 Unclassified 2752
367 Ga0496124_0169726 3300048927 Bacteria 1691
368 Ga0496125_0003826 3300048928 Bacteria 17869
369 Ga0496125_0004606 3300048928 Bacteria 15755
370 Ga0496125_0010351 3300048928 Bacteria 9435
371 Ga0496125_0036847 3300048928 Bacteria 4261
372 Ga0496126_0000467 3300048929 Bacteria 80295
373 Ga0501032_0000175 3300049569 Bacteria 52532
374 Ga0501037_0027178 3300049573 Bacteria 4227
375 Ga0501043_0012121 3300049579 Bacteria 6741
376 Ga0501047_0019271 3300049581 Bacteria 6546
377 Ga0501047_0052656 3300049581 Bacteria 3935
378 Ga0501047_0136536 3300049581 Bacteria 2333
379 Ga0501067_0000015 3300049583 Bacteria 108743
380 Ga0501068_0141479 3300049584 Bacteria 1508
381 Ga0501073_0000013 3300049589 Bacteria 160591
382 Ga0501077_0000009 3300049593 Bacteria 98991
383 Ga0501035_0012358 3300049822 Bacteria 7893
384 Ga0501044_0003048 3300049823 Bacteria 18959
385 Ga0501044_0008531 3300049823 Bacteria 11228
386 Ga0501044_0173797 3300049823 Bacteria 2124
387 nmdc:mga0k408_10209_c1 3300050493 Bacteria 5077
388 Ga0495601_0002628 3300053077 Bacteria 10191
389 Ga0495612_0000640 3300053078 Bacteria 14046
390 Ga0495619_0002216 3300053085 Bacteria 12869
391 Ga0500643_000324 3300053087 Bacteria 38444
392 Ga0500643_000929 3300053087 Bacteria 18385
393 Ga0500644_0000023 3300053088 Bacteria 97652
394 Ga0500646_0002742 3300053090 Bacteria 4541
395 Ga0500641_0029165 3300053096 Bacteria 2160
396 Ga0500556_0001646 3300053104 Bacteria 8728
397 Ga0500608_000056 3300053122 Bacteria 48877
398 Ga0500642_0000576 3300053130 Bacteria 11063
399 Ga0500658_0003163 3300053134 Bacteria 6279
400 Ga0500658_0024710 3300053134 Bacteria 2303
401 Ga0500559_0002876 3300053136 Bacteria 8694
402 Ga0500559_0071381 3300053136 Bacteria 1564
403 Ga0500564_001171 3300053138 Bacteria 8783
404 Ga0500568_0000454 3300053139 Bacteria 30746
405 Ga0500568_0004881 3300053139 Bacteria 7069
406 Ga0500568_0022501 3300053139 Bacteria 2694
407 Ga0500604_0000008 3300053151 Bacteria 114485
408 Ga0500616_0000016 3300053153 Bacteria 627087
409 Ga0500616_0000019 3300053153 Bacteria 549964
410 Ga0500616_0000198 3300053153 Bacteria 98023
411 Ga0500616_0020890 3300053153 Bacteria 3676
412 Ga0500622_0003348 3300053156 Bacteria 10800
413 Ga0500622_0008181 3300053156 Bacteria 5874
414 Ga0500645_000864 3300053730 Bacteria 17683
415 Ga0500645_000886 3300053730 Bacteria 17369
416 Ga0500645_003184 3300053730 Bacteria 6821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0088657 Ga0373953_0088657_11_1132 356
2 3300009098 Ga0105245_10001154 Ga0105245_100011546 365
3 3300009148 Ga0105243_10009372 Ga0105243_100093724 365
4 3300025927 Ga0207687_10001989 Ga0207687_100019898 365
5 3300025935 Ga0207709_10143161 Ga0207709_101431611 365
6 3300009174 Ga0105241_10047070 Ga0105241_100470702 370
7 3300013105 Ga0157369_10034771 Ga0157369_100347716 370
8 3300005344 Ga0070661_100234604 Ga0070661_1002346041 371
9 3300010375 Ga0105239_10003181 Ga0105239_1000318116 371
10 3300013105 Ga0157369_10004603 Ga0157369_1000460313 372
11 3300005842 Ga0068858_100001099 Ga0068858_10000109914 375
12 3300026035 Ga0207703_10000958 Ga0207703_1000095814 375
13 3300031911 Ga0307412_10064282 Ga0307412_100642822 380
14 3300047472 Ga0495686_0047492 Ga0495686_0047492_1059_2396 382
15 3300005436 Ga0070713_100007150 Ga0070713_1000071501 383
16 3300025914 Ga0207671_10002549 Ga0207671_100025494 384
17 3300046557 Ga0495622_0032738 Ga0495622_0032738_523_1854 384
18 3300009553 Ga0105249_10112206 Ga0105249_101122062 385
19 3300025913 Ga0207695_10000004 Ga0207695_1000000478 386
20 3300028800 Ga0265338_10076550 Ga0265338_100765502 386
21 3300053153 Ga0500616_0000019 Ga0500616_0000019_4359_5597 386
22 3300009551 Ga0105238_10075239 Ga0105238_100752392 387
23 3300025924 Ga0207694_10048121 Ga0207694_100481213 387
24 3300046524 Ga0495648_0000113 Ga0495648_0000113_19871_21103 387
25 3300047469 Ga0495673_0002140 Ga0495673_0002140_4914_6146 387
26 3300053088 Ga0500644_0000023 Ga0500644_0000023_92278_93510 387
27 3300053138 Ga0500564_001171 Ga0500564_001171_4144_5376 387
28 3300003214 JGI25165J46597_1000041 JGI25165J46597_1000041106 388
29 3300025261 Ga0209233_1000104 Ga0209233_1000104107 388
30 3300005455 Ga0070663_100107535 Ga0070663_1001075352 389
31 3300005530 Ga0070679_100112405 Ga0070679_1001124052 389
32 3300005548 Ga0070665_100035073 Ga0070665_1000350737 389
33 3300005844 Ga0068862_100008144 Ga0068862_1000081447 389
34 3300025909 Ga0207705_10008759 Ga0207705_100087596 389
35 3300025913 Ga0207695_10007702 Ga0207695_100077022 389
36 3300025921 Ga0207652_10037813 Ga0207652_100378133 389
37 3300028379 Ga0268266_10018163 Ga0268266_100181638 389
38 3300028380 Ga0268265_10032983 Ga0268265_100329835 389
39 3300005441 Ga0070700_100017359 Ga0070700_1000173592 390
40 3300005549 Ga0070704_100028204 Ga0070704_1000282042 390
41 3300005844 Ga0068862_100025637 Ga0068862_1000256373 390
42 3300047445 Ga0495677_0001685 Ga0495677_0001685_3339_4778 390
43 3300048925 Ga0496122_0013053 Ga0496122_0013053_5358_6680 390
44 3300048926 Ga0496123_0003619 Ga0496123_0003619_8926_10248 390
45 3300031247 Ga0265340_10000051 Ga0265340_1000005139 392
46 3300031344 Ga0265316_10177532 Ga0265316_101775322 392
47 3300009093 Ga0105240_10082466 Ga0105240_100824665 393
48 3300028573 Ga0265334_10016622 Ga0265334_100166221 393
49 3300049569 Ga0501032_0000175 Ga0501032_0000175_37031_38272 393
50 3300049573 Ga0501037_0027178 Ga0501037_0027178_80_1321 393
51 3300049579 Ga0501043_0012121 Ga0501043_0012121_125_1366 393
52 3300049583 Ga0501067_0000015 Ga0501067_0000015_2213_3454 393
53 3300049584 Ga0501068_0141479 Ga0501068_0141479_14_1255 393
54 3300049589 Ga0501073_0000013 Ga0501073_0000013_140003_141244 393
55 3300049593 Ga0501077_0000009 Ga0501077_0000009_54113_55354 393
56 3300049823 Ga0501044_0008531 Ga0501044_0008531_7277_8518 393
57 3300053730 Ga0500645_000864 Ga0500645_000864_9901_11202 393
58 3300006948 Ga0099826_10087279 Ga0099826_100872792 394
59 3300009553 Ga0105249_10024945 Ga0105249_100249452 395
60 3300030760 Ga0265762_1002060 Ga0265762_10020602 395
61 3300031507 Ga0307509_10000004 Ga0307509_10000004391 395
62 3300031731 Ga0307405_10074909 Ga0307405_100749092 395
63 3300031824 Ga0307413_10056267 Ga0307413_100562672 395
64 3300031852 Ga0307410_10030122 Ga0307410_100301222 395
65 3300031903 Ga0307407_10051300 Ga0307407_100513002 395
66 3300031911 Ga0307412_10043255 Ga0307412_100432552 395
67 3300031995 Ga0307409_100160867 Ga0307409_1001608672 395
68 3300032002 Ga0307416_100045926 Ga0307416_1000459262 395
69 3300032004 Ga0307414_10119828 Ga0307414_101198282 395
70 3300032005 Ga0307411_10003537 Ga0307411_100035376 395
71 3300032126 Ga0307415_100030235 Ga0307415_1000302352 395
72 3300048922 Ga0496119_0019938 Ga0496119_0019938_2799_4085 395
73 3300048923 Ga0496120_0020600 Ga0496120_0020600_227_1513 395
74 3300048928 Ga0496125_0010351 Ga0496125_0010351_7273_8559 395
75 3300009093 Ga0105240_10002740 Ga0105240_100027406 396
76 3300042007 Ga0439449_0014221 Ga0439449_0014221_900_2144 396
77 3300046513 Ga0495616_0070889 Ga0495616_0070889_32_1300 396
78 3300003773 Ga0055537_1000547 Ga0055537_10005472 397
79 3300003790 Ga0055528_1009621 Ga0055528_10096213 397
80 3300005364 Ga0070673_100121523 Ga0070673_1001215232 397
81 3300005617 Ga0068859_100040436 Ga0068859_1000404363 397
82 3300005840 Ga0068870_10033611 Ga0068870_100336112 397
83 3300006931 Ga0097620_100040436 Ga0097620_1000404363 397
84 3300014325 Ga0163163_10064817 Ga0163163_100648172 397
85 3300025263 Ga0209565_1000266 Ga0209565_10002668 397
86 3300025273 Ga0209673_1002204 Ga0209673_10022046 397
87 3300025295 Ga0209564_1010617 Ga0209564_10106172 397
88 3300025297 Ga0209758_1000785 Ga0209758_10007852 397
89 3300025299 Ga0209256_1003932 Ga0209256_10039323 397
90 3300025908 Ga0207643_10017741 Ga0207643_100177412 397
91 3300025918 Ga0207662_10001052 Ga0207662_100010525 397
92 3300025920 Ga0207649_10000011 Ga0207649_10000011180 397
93 3300025926 Ga0207659_10017099 Ga0207659_100170995 397
94 3300025936 Ga0207670_10004663 Ga0207670_100046632 397
95 3300025960 Ga0207651_10006137 Ga0207651_100061372 397
96 3300031247 Ga0265340_10011404 Ga0265340_100114042 397
97 3300046460 Ga0495638_0001857 Ga0495638_0001857_1262_2503 397
98 3300048916 Ga0496113_0002671 Ga0496113_0002671_4925_6226 397
99 3300003759 Ga0055525_1000070 Ga0055525_1000070191 398
100 3300003773 Ga0055537_1010589 Ga0055537_10105892 398
101 3300005577 Ga0068857_100105709 Ga0068857_1001057092 398
102 3300025230 Ga0209563_100053 Ga0209563_1000535 398
103 3300025263 Ga0209565_1000177 Ga0209565_100017723 398
104 3300025940 Ga0207691_10058376 Ga0207691_100583762 398
105 3300026116 Ga0207674_10057962 Ga0207674_100579622 398
106 3300053139 Ga0500568_0000454 Ga0500568_0000454_15710_17005 398
107 3300053153 Ga0500616_0000198 Ga0500616_0000198_18735_20030 398
108 3300053156 Ga0500622_0008181 Ga0500622_0008181_4103_5425 398
109 3300005355 Ga0070671_100035458 Ga0070671_1000354583 399
110 3300005543 Ga0070672_100024769 Ga0070672_1000247692 399
111 3300006881 Ga0068865_100196484 Ga0068865_1001964842 399
112 3300009176 Ga0105242_10044126 Ga0105242_100441262 399
113 3300013297 Ga0157378_10198066 Ga0157378_101980662 399
114 3300017792 Ga0163161_10005209 Ga0163161_100052094 399
115 3300025940 Ga0207691_10110395 Ga0207691_101103952 399
116 3300046471 Ga0495650_0031571 Ga0495650_0031571_964_2265 399
117 3300053122 Ga0500608_000056 Ga0500608_000056_38179_39489 399
118 3300053136 Ga0500559_0002876 Ga0500559_0002876_484_1794 399
119 3300053139 Ga0500568_0022501 Ga0500568_0022501_725_2026 399
120 3300005435 Ga0070714_100015619 Ga0070714_1000156191 400
121 3300005458 Ga0070681_10093941 Ga0070681_100939412 400
122 3300025912 Ga0207707_10063431 Ga0207707_100634312 400
123 3300025917 Ga0207660_10000575 Ga0207660_100005752 400
124 3300025921 Ga0207652_10000001 Ga0207652_10000001693 400
125 3300025921 Ga0207652_10000002 Ga0207652_1000000234 400
126 3300025929 Ga0207664_10030152 Ga0207664_100301524 400
127 3300031911 Ga0307412_10088241 Ga0307412_100882412 400
128 3300032002 Ga0307416_100127685 Ga0307416_1001276852 400
129 3300039437 Ga0436365_1887441 Ga0436365_1887441_55_1362 400
130 3300046522 Ga0495643_0001677 Ga0495643_0001677_3467_4765 400
131 3300046616 Ga0495668_0000037 Ga0495668_0000037_72171_73574 400
132 3300049581 Ga0501047_0136536 Ga0501047_0136536_1029_2261 400
133 3300005327 Ga0070658_10008162 Ga0070658_100081623 401
134 3300005329 Ga0070683_100001582 Ga0070683_1000015829 401
135 3300005339 Ga0070660_100063756 Ga0070660_1000637562 401
136 3300005339 Ga0070660_100067473 Ga0070660_1000674732 401
137 3300005344 Ga0070661_100006146 Ga0070661_1000061467 401
138 3300005434 Ga0070709_10092368 Ga0070709_100923682 401
139 3300005466 Ga0070685_10001691 Ga0070685_100016913 401
140 3300005563 Ga0068855_100000157 Ga0068855_10000015726 401
141 3300005577 Ga0068857_100013457 Ga0068857_1000134578 401
142 3300010375 Ga0105239_10016861 Ga0105239_100168616 401
143 3300025298 Ga0209050_1013778 Ga0209050_10137781 401
144 3300025302 Ga0207426_1018439 Ga0207426_10184392 401
145 3300025321 Ga0207656_10023802 Ga0207656_100238021 401
146 3300025909 Ga0207705_10009340 Ga0207705_100093405 401
147 3300025924 Ga0207694_10000015 Ga0207694_10000015284 401
148 3300025928 Ga0207700_10090005 Ga0207700_100900051 401
149 3300025949 Ga0207667_10000160 Ga0207667_1000016026 401
150 3300026116 Ga0207674_10004125 Ga0207674_1000412511 401
151 3300026142 Ga0207698_10005527 Ga0207698_100055273 401
152 3300031711 Ga0265314_10074999 Ga0265314_100749991 401
153 3300031727 Ga0316576_10005436 Ga0316576_100054362 401
154 3300033180 Ga0307510_10000103 Ga0307510_100001034 401
155 3300036712 Ga0316584_0064239 Ga0316584_0064239_114_1442 401
156 3300046691 Ga0495670_0000036 Ga0495670_0000036_29488_30720 401
157 3300048903 Ga0496100_0134196 Ga0496100_0134196_177_1469 401
158 3300049581 Ga0501047_0019271 Ga0501047_0019271_5153_6445 401
159 3300003771 Ga0055526_1002171 Ga0055526_10021714 402
160 3300013306 Ga0163162_10027339 Ga0163162_100273392 402
161 3300025295 Ga0209564_1002354 Ga0209564_100235410 402
162 3300025940 Ga0207691_10126765 Ga0207691_101267652 402
163 3300037471 Ga0395905_0006821 Ga0395905_0006821_8489_9808 402
164 3300046460 Ga0495638_0000548 Ga0495638_0000548_24283_25587 402
165 3300048905 Ga0496102_0016833 Ga0496102_0016833_802_2088 402
166 3300048918 Ga0496115_0130469 Ga0496115_0130469_16_1233 402
167 3300048919 Ga0496116_0016470 Ga0496116_0016470_3083_4369 402
168 3300048920 Ga0496117_0000125 Ga0496117_0000125_61948_63234 402
169 3300048921 Ga0496118_0000016 Ga0496118_0000016_135317_136603 402
170 3300049822 Ga0501035_0012358 Ga0501035_0012358_684_2024 402
171 3300049823 Ga0501044_0003048 Ga0501044_0003048_9099_10439 402
172 3300053134 Ga0500658_0024710 Ga0500658_0024710_425_1729 402
173 3300035086 Ga0373934_0000281 Ga0373934_0000281_2781_4103 403
174 3300035111 Ga0373923_0006447 Ga0373923_0006447_782_2104 403
175 3300035724 Ga0373933_0000440 Ga0373933_0000440_14482_15804 403
176 3300036401 Ga0373937_0001057 Ga0373937_0001057_17735_19057 403
177 3300039437 Ga0436365_0499883 Ga0436365_0499883_219_1538 403
178 3300046454 Ga0495592_0018190 Ga0495592_0018190_1241_2563 403
179 3300046462 Ga0495651_0000375 Ga0495651_0000375_22472_23794 403
180 3300046463 Ga0495653_0000674 Ga0495653_0000674_15451_16773 403
181 3300046511 Ga0495608_0000164 Ga0495608_0000164_22028_23350 403
182 3300046514 Ga0495618_0009400 Ga0495618_0009400_1277_2599 403
183 3300046516 Ga0495628_0008718 Ga0495628_0008718_1133_2455 403
184 3300046517 Ga0495630_0002248 Ga0495630_0002248_7285_8607 403
185 3300046529 Ga0495652_0031663 Ga0495652_0031663_1241_2563 403
186 3300046536 Ga0495587_0002892 Ga0495587_0002892_9382_10704 403
187 3300046543 Ga0495645_0000520 Ga0495645_0000520_14950_16272 403
188 3300046559 Ga0495667_0001755 Ga0495667_0001755_2319_3641 403
189 3300046663 Ga0495635_0000328 Ga0495635_0000328_18299_19621 403
190 3300046675 Ga0495657_0000858 Ga0495657_0000858_19170_20492 403
191 3300046678 Ga0495599_0000418 Ga0495599_0000418_17818_19140 403
192 3300046679 Ga0495623_0001187 Ga0495623_0001187_9236_10558 403
193 3300046680 Ga0495646_0009062 Ga0495646_0009062_3927_5249 403
194 3300046809 Ga0495600_0000443 Ga0495600_0000443_4335_5657 403
195 3300047317 Ga0495604_0001805 Ga0495604_0001805_15315_16637 403
196 3300047319 Ga0495674_0002919 Ga0495674_0002919_7144_8466 403
197 3300047471 Ga0495684_0000730 Ga0495684_0000730_8047_9369 403
198 3300048088 Ga0495602_0014274 Ga0495602_0014274_3564_4886 403
199 3300053077 Ga0495601_0002628 Ga0495601_0002628_23_1345 403
200 3300053078 Ga0495612_0000640 Ga0495612_0000640_277_1599 403
201 3300053085 Ga0495619_0002216 Ga0495619_0002216_2923_4245 403
202 3300005327 Ga0070658_10007077 Ga0070658_100070775 404
203 3300005339 Ga0070660_100003015 Ga0070660_1000030152 404
204 3300005341 Ga0070691_10006192 Ga0070691_100061923 404
205 3300005344 Ga0070661_100000001 Ga0070661_100000001318 404
206 3300005366 Ga0070659_100001785 Ga0070659_10000178512 404
207 3300005539 Ga0068853_100069814 Ga0068853_1000698142 404
208 3300005563 Ga0068855_100017422 Ga0068855_1000174226 404
209 3300009551 Ga0105238_10045067 Ga0105238_100450675 404
210 3300013102 Ga0157371_10069082 Ga0157371_100690822 404
211 3300013104 Ga0157370_10006019 Ga0157370_100060196 404
212 3300013306 Ga0163162_10024266 Ga0163162_100242663 404
213 3300013307 Ga0157372_10010466 Ga0157372_100104665 404
214 3300025261 Ga0209233_1010563 Ga0209233_10105632 404
215 3300025909 Ga0207705_10001231 Ga0207705_1000123119 404
216 3300025912 Ga0207707_10001184 Ga0207707_1000118420 404
217 3300025917 Ga0207660_10000826 Ga0207660_1000082615 404
218 3300025919 Ga0207657_10000141 Ga0207657_1000014142 404
219 3300025921 Ga0207652_10001119 Ga0207652_100011195 404
220 3300025924 Ga0207694_10016975 Ga0207694_100169756 404
221 3300026142 Ga0207698_10053724 Ga0207698_100537243 404
222 3300028800 Ga0265338_10087298 Ga0265338_100872982 404
223 3300031241 Ga0265325_10001546 Ga0265325_100015464 404
224 3300031344 Ga0265316_10013291 Ga0265316_100132913 404
225 3300031595 Ga0265313_10006328 Ga0265313_100063282 404
226 3300037418 Ga0395900_0029929 Ga0395900_0029929_3912_5138 404
227 3300037418 Ga0395900_0105687 Ga0395900_0105687_606_1970 404
228 3300037471 Ga0395905_0007316 Ga0395905_0007316_9259_10623 404
229 3300038443 Ga0395901_0017286 Ga0395901_0017286_4454_5680 404
230 3300038443 Ga0395901_0230305 Ga0395901_0230305_378_1742 404
231 3300042876 Ga0451577_0274232 Ga0451577_0274232_27_1364 404
232 3300046491 Ga0495584_0048780 Ga0495584_0048780_187_1632 404
233 3300046507 Ga0495606_0033704 Ga0495606_0033704_588_2033 404
234 3300048917 Ga0496114_0040000 Ga0496114_0040000_1042_2358 404
235 3300031727 Ga0316576_10126366 Ga0316576_101263662 405
236 3300044842 Ga0466957_0020241 Ga0466957_0020241_2292_3656 405
237 3300005293 Ga0065715_10094690 Ga0065715_100946901 406
238 3300005295 Ga0065707_10109403 Ga0065707_101094032 406
239 3300005347 Ga0070668_100021227 Ga0070668_1000212272 406
240 3300005367 Ga0070667_100052014 Ga0070667_1000520142 406
241 3300005543 Ga0070672_100024799 Ga0070672_1000247992 406
242 3300005617 Ga0068859_100368421 Ga0068859_1003684212 406
243 3300005843 Ga0068860_100086344 Ga0068860_1000863442 406
244 3300006881 Ga0068865_100093947 Ga0068865_1000939472 406
245 3300006931 Ga0097620_100368441 Ga0097620_1003684412 406
246 3300009177 Ga0105248_10046277 Ga0105248_100462772 406
247 3300013308 Ga0157375_10036744 Ga0157375_100367442 406
248 3300025899 Ga0207642_10023331 Ga0207642_100233312 406
249 3300025934 Ga0207686_10034863 Ga0207686_100348632 406
250 3300025940 Ga0207691_10055104 Ga0207691_100551042 406
251 3300025972 Ga0207668_10041897 Ga0207668_100418972 406
252 3300028381 Ga0268264_10071050 Ga0268264_100710502 406
253 3300031456 Ga0307513_10064491 Ga0307513_100644912 406
254 3300031507 Ga0307509_10000019 Ga0307509_10000019133 406
255 3300047472 Ga0495686_0000260 Ga0495686_0000260_19918_21213 406
256 3300053139 Ga0500568_0004881 Ga0500568_0004881_1256_2569 406
257 3300005336 Ga0070680_100000450 Ga0070680_1000004502 407
258 3300005530 Ga0070679_100000007 Ga0070679_100000007107 407
259 3300025292 Ga0209676_1000678 Ga0209676_100067823 407
260 3300038443 Ga0395901_0165665 Ga0395901_0165665_891_2189 407
261 3300048927 Ga0496124_0034600 Ga0496124_0034600_1579_2865 407
262 3300005327 Ga0070658_10005982 Ga0070658_100059826 408
263 3300005339 Ga0070660_100010988 Ga0070660_1000109884 408
264 3300005719 Ga0068861_100120468 Ga0068861_1001204682 408
265 3300025909 Ga0207705_10000946 Ga0207705_100009466 408
266 3300026118 Ga0207675_100174121 Ga0207675_1001741212 408
267 3300031247 Ga0265340_10018404 Ga0265340_100184042 408
268 3300053096 Ga0500641_0029165 Ga0500641_0029165_791_2113 408
269 3300053104 Ga0500556_0001646 Ga0500556_0001646_7459_8703 408
270 3300053136 Ga0500559_0071381 Ga0500559_0071381_56_1351 408
271 3300053153 Ga0500616_0000016 Ga0500616_0000016_362323_363612 408
272 3300005548 Ga0070665_100000105 Ga0070665_100000105115 409
273 3300028379 Ga0268266_10001778 Ga0268266_1000177814 409
274 3300031250 Ga0265331_10000003 Ga0265331_10000003426 409
275 3300031251 Ga0265327_10000447 Ga0265327_1000044712 409
276 3300031711 Ga0265314_10004844 Ga0265314_100048443 409
277 3300033180 Ga0307510_10011071 Ga0307510_100110712 409
278 3300053087 Ga0500643_000324 Ga0500643_000324_21084_22415 409
279 3300053156 Ga0500622_0003348 Ga0500622_0003348_8776_10056 409
280 iso_pu_bacteria 2643221562 2643831093 409
281 3300003215 JGI25153J46596_10000112 JGI25153J46596_1000011246 410
282 3300003762 Ga0055542_1000402 Ga0055542_10004025 410
283 3300003763 Ga0055529_1000439 Ga0055529_10004395 410
284 3300005548 Ga0070665_100000514 Ga0070665_10000051453 410
285 3300006051 Ga0075364_10010144 Ga0075364_100101444 410
286 3300006195 Ga0075366_10030953 Ga0075366_100309534 410
287 3300006353 Ga0075370_10002085 Ga0075370_100020856 410
288 3300025254 Ga0209148_1000008 Ga0209148_10000081384 410
289 3300025272 Ga0209455_1000002 Ga0209455_100000242 410
290 3300025297 Ga0209758_1000023 Ga0209758_1000023326 410
291 3300028379 Ga0268266_10011637 Ga0268266_100116372 410
292 3300046522 Ga0495643_0101879 Ga0495643_0101879_203_1435 410
293 3300046660 Ga0495625_0117605 Ga0495625_0117605_563_1795 410
294 3300050493 nmdc:mga0k408_10209_c1 nmdc:mga0k408_10209_c1_3622_4962 410
295 iso_pu_bacteria 2884960567 2884965426 410
296 3300005353 Ga0070669_100097677 Ga0070669_1000976772 411
297 3300005356 Ga0070674_100014066 Ga0070674_1000140664 411
298 3300009177 Ga0105248_10341514 Ga0105248_103415141 411
299 3300025942 Ga0207689_10151219 Ga0207689_101512192 411
300 3300046506 Ga0495583_0011856 Ga0495583_0011856_3023_4258 411
301 3300046506 Ga0495583_0018598 Ga0495583_0018598_1017_2252 411
302 3300046518 Ga0495631_0078271 Ga0495631_0078271_102_1337 411
303 3300046525 Ga0495663_0002840 Ga0495663_0002840_1745_2980 411
304 3300046660 Ga0495625_0000060 Ga0495625_0000060_64768_66126 411
305 3300046660 Ga0495625_0055059 Ga0495625_0055059_810_2045 411
306 3300047323 Ga0495683_0002703 Ga0495683_0002703_4071_5306 411
307 3300048926 Ga0496123_0008086 Ga0496123_0008086_3673_4908 411
308 3300048928 Ga0496125_0004606 Ga0496125_0004606_8657_9892 411
309 3300049581 Ga0501047_0052656 Ga0501047_0052656_2510_3754 411
310 3300049823 Ga0501044_0173797 Ga0501044_0173797_694_1938 411
311 3300053130 Ga0500642_0000576 Ga0500642_0000576_7603_8838 411
312 3300005436 Ga0070713_100008980 Ga0070713_1000089807 412
313 3300006028 Ga0070717_10012698 Ga0070717_100126984 412
314 3300025928 Ga0207700_10002942 Ga0207700_100029426 412
315 3300046524 Ga0495648_0000901 Ga0495648_0000901_21570_22868 412
316 iso_pu_bacteria 2852653556 2852653753 412
317 3300009545 Ga0105237_10000580 Ga0105237_1000058010 413
318 3300025914 Ga0207671_10002351 Ga0207671_100023515 413
319 3300046694 Ga0495649_0000092 Ga0495649_0000092_58143_59423 413
320 3300053090 Ga0500646_0002742 Ga0500646_0002742_1942_3237 413
321 3300053151 Ga0500604_0000008 Ga0500604_0000008_56513_57808 413
322 iso_pu_bacteria 2830075706 2830077557 413
323 3300005355 Ga0070671_100157312 Ga0070671_1001573122 414
324 3300005841 Ga0068863_100040342 Ga0068863_1000403422 414
325 3300026088 Ga0207641_10048084 Ga0207641_100480842 414
326 3300003773 Ga0055537_1003930 Ga0055537_10039303 415
327 3300025263 Ga0209565_1000297 Ga0209565_100029743 415
328 3300025273 Ga0209673_1001189 Ga0209673_100118920 415
329 3300025291 Ga0209675_1011980 Ga0209675_10119802 415
330 3300025297 Ga0209758_1000965 Ga0209758_100096515 415
331 3300025299 Ga0209256_1007700 Ga0209256_10077003 415
332 3300046460 Ga0495638_0002338 Ga0495638_0002338_3540_4865 415
333 3300046471 Ga0495650_0000017 Ga0495650_0000017_401585_402913 415
334 3300046512 Ga0495610_0000058 Ga0495610_0000058_70024_71349 415
335 3300046519 Ga0495632_0050885 Ga0495632_0050885_219_1547 415
336 3300046520 Ga0495637_0002108 Ga0495637_0002108_8937_10262 415
337 3300046530 Ga0495654_0000012 Ga0495654_0000012_130761_132089 415
338 3300046660 Ga0495625_0001996 Ga0495625_0001996_11926_13251 415
339 3300046660 Ga0495625_0059435 Ga0495625_0059435_14_1339 415
340 3300046692 Ga0495671_0037347 Ga0495671_0037347_1043_2368 415
341 3300047320 Ga0495672_0001431 Ga0495672_0001431_2258_3583 415
342 3300047472 Ga0495686_0020098 Ga0495686_0020098_1324_2652 415
343 3300048918 Ga0496115_0065644 Ga0496115_0065644_207_1544 415
344 3300048927 Ga0496124_0169726 Ga0496124_0169726_12_1340 415
345 3300053134 Ga0500658_0003163 Ga0500658_0003163_1226_2551 415
346 3300053153 Ga0500616_0020890 Ga0500616_0020890_1493_2821 415
347 3300053730 Ga0500645_000886 Ga0500645_000886_15436_16761 415
348 3300038705 Ga0237819_00694 Ga0237819_00694_7024_8346 416
349 3300053730 Ga0500645_003184 Ga0500645_003184_1014_2342 416
350 iso_pu_bacteria 2885429604 2885431037 416
351 3300002774 JGI25150J39212_1000218 JGI25150J39212_100021813 417
352 3300003215 JGI25153J46596_10000093 JGI25153J46596_1000009341 417
353 3300003781 Ga0055536_1008759 Ga0055536_10087595 417
354 3300003792 Ga0055540_1001661 Ga0055540_10016613 417
355 3300025245 Ga0207425_1000072 Ga0207425_100007271 417
356 3300025258 Ga0209129_1002115 Ga0209129_10021153 417
357 3300025292 Ga0209676_1002664 Ga0209676_10026648 417
358 3300025294 Ga0209025_1001194 Ga0209025_100119430 417
359 3300025297 Ga0209758_1000009 Ga0209758_1000009707 417
360 3300025298 Ga0209050_1000005 Ga0209050_1000005461 417
361 3300025298 Ga0209050_1000195 Ga0209050_100019523 417
362 3300025299 Ga0209256_1001568 Ga0209256_10015687 417
363 3300025303 Ga0209051_1000414 Ga0209051_100041422 417
364 3300025304 Ga0209257_1007448 Ga0209257_10074483 417
365 3300025304 Ga0209257_1007449 Ga0209257_10074493 417
366 3300048918 Ga0496115_0000538 Ga0496115_0000538_5384_6661 417
367 3300047470 Ga0495681_0002528 Ga0495681_0002528_3634_4932 418
368 3300048905 Ga0496102_0007236 Ga0496102_0007236_5529_6872 418
369 3300048906 Ga0496103_0043184 Ga0496103_0043184_193_1536 418
370 3300048919 Ga0496116_0004986 Ga0496116_0004986_10059_11402 418
371 3300048920 Ga0496117_0000636 Ga0496117_0000636_41253_42596 418
372 3300048921 Ga0496118_0000665 Ga0496118_0000665_40916_42259 418
373 3300048922 Ga0496119_0011123 Ga0496119_0011123_2785_4128 418
374 3300048923 Ga0496120_0014942 Ga0496120_0014942_975_2318 418
375 3300048924 Ga0496121_0028751 Ga0496121_0028751_1768_3111 418
376 3300048924 Ga0496121_0116247 Ga0496121_0116247_664_1986 418
377 3300048927 Ga0496124_0076975 Ga0496124_0076975_1157_2500 418
378 3300048928 Ga0496125_0003826 Ga0496125_0003826_12088_13431 418
379 3300048928 Ga0496125_0036847 Ga0496125_0036847_153_1496 418
380 3300005262 Ga0065165_1002982 Ga0065165_10029822 419
381 3300009094 Ga0111539_10017359 Ga0111539_100173595 419
382 3300046460 Ga0495638_0052535 Ga0495638_0052535_720_2015 419
383 3300046471 Ga0495650_0000722 Ga0495650_0000722_32635_33933 419
384 3300046506 Ga0495583_0000447 Ga0495583_0000447_27867_29165 419
385 3300046506 Ga0495583_0037764 Ga0495583_0037764_873_2168 419
386 3300046507 Ga0495606_0000383 Ga0495606_0000383_8657_9952 419
387 3300046536 Ga0495587_0009298 Ga0495587_0009298_2574_3872 419
388 3300046557 Ga0495622_0009137 Ga0495622_0009137_3183_4481 419
389 3300046660 Ga0495625_0044054 Ga0495625_0044054_1044_2339 419
390 3300046665 Ga0495661_0044925 Ga0495661_0044925_594_1892 419
391 3300046809 Ga0495600_0001782 Ga0495600_0001782_7862_9160 419
392 3300047472 Ga0495686_0009138 Ga0495686_0009138_3603_4916 419
393 3300048905 Ga0496102_0000930 Ga0496102_0000930_11914_13323 419
394 3300048906 Ga0496103_0001181 Ga0496103_0001181_6211_7620 419
395 3300048907 Ga0496104_0003538 Ga0496104_0003538_3430_4839 419
396 3300048908 Ga0496105_0001238 Ga0496105_0001238_5990_7399 419
397 3300048913 Ga0496110_0035991 Ga0496110_0035991_78_1487 419
398 3300048917 Ga0496114_0015611 Ga0496114_0015611_2265_3674 419
399 3300048918 Ga0496115_0000339 Ga0496115_0000339_28077_29486 419
400 3300048919 Ga0496116_0006574 Ga0496116_0006574_2256_3665 419
401 3300048920 Ga0496117_0003623 Ga0496117_0003623_5976_7385 419
402 3300048921 Ga0496118_0002640 Ga0496118_0002640_11944_13353 419
403 3300048923 Ga0496120_0014307 Ga0496120_0014307_117_1526 419
404 3300048924 Ga0496121_0004809 Ga0496121_0004809_5997_7406 419
405 3300048924 Ga0496121_0017679 Ga0496121_0017679_3050_4360 419
406 3300048927 Ga0496124_0001474 Ga0496124_0001474_22763_24172 419
407 3300048929 Ga0496126_0000467 Ga0496126_0000467_66961_68370 419
408 3300053087 Ga0500643_000929 Ga0500643_000929_14703_15998 419
409 3300001989 JGI24739J22299_10019889 JGI24739J22299_100198892 420
410 3300005456 Ga0070678_100001978 Ga0070678_1000019785 420
411 3300006358 Ga0068871_100007771 Ga0068871_1000077713 420
412 3300009148 Ga0105243_10001935 Ga0105243_1000193510 420
413 3300017792 Ga0163161_10032504 Ga0163161_100325042 420
414 3300025904 Ga0207647_10018738 Ga0207647_100187383 420
415 3300025935 Ga0207709_10000047 Ga0207709_10000047236 420
416 3300025937 Ga0207669_10000038 Ga0207669_1000003881 420
417 3300026121 Ga0207683_10000100 Ga0207683_1000010076 420
418 3300026121 Ga0207683_10194430 Ga0207683_101944302 420
419 3300046492 Ga0495585_0048953 Ga0495585_0048953_114_1412 420
420 3300047443 Ga0495687_000082 Ga0495687_000082_15664_16962 420
421 3300048914 Ga0496111_0005608 Ga0496111_0005608_13_1311 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

65

406

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8763 7 404
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8638 8 409
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.855 8 409
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8511 6 409
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8493 8 420
ID Description Score Start End Superfamily
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9281 7 187 1.20.1250.20
af_A0A1L1SUI3_3_201_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9221 3 188 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.917 6 189 1.20.1250.20
af_Q4DUI2_4_205_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9154 11 188 1.20.1250.20
af_Q54UX4_30_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.915 6 189 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A318B1P7-F1-model_v4 MFS transporter 0.9436 6 198 GO:0016020
GO:0022857
AF-A0A2D7FPD3-F1-model_v4 MFS transporter 0.9372 7 287 GO:0016020
GO:0022857
AF-A0A352CDG6-F1-model_v4 MFS transporter 0.9325 7 328 GO:0016020
GO:0022857
AF-A0A7W0VHU2-F1-model_v4 MFS transporter 0.9294 6 291 GO:0016020
GO:0022857
AF-A0A354W1V1-F1-model_v4 deleted 0.9283 7 277

Feature Viewer

pLDDT pTM Quality
92.81 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map