F439722

General Info

Members Datasets Scaffolds Average Seq Length
420 226 418 109

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10239656|Ga0075365_102396562
Length 120
Sequence MLRTTEFDSVLRALADPTRRTLFERVATAKEITVGDLTAGSGVSQGAVSQHLKALKQAGLVAERPEGRKVFYRANPQGLEPMLEWMTRYAVFWSQRLDTLERLLREDDARKANSKDGGKK

Samples

Sample ID Description Type Environment
1 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
2 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.24
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 3.81
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002496 3300003320 Bacteria 1712
2 rootH1_10105012 3300003323 Bacteria 2118
3 Ga0055536_1002801 3300003781 Bacteria 9629
4 Ga0055536_1004868 3300003781 Bacteria 6703
5 Ga0055534_1039840 3300003784 Bacteria 694
6 Ga0055530_10000968 3300003791 Bacteria 23294
7 Ga0055531_10003625 3300003794 Bacteria 9747
8 Ga0055531_10042516 3300003794 Bacteria 1298
9 Ga0065165_1000891 3300005262 Bacteria 38572
10 Ga0070658_10468414 3300005327 Bacteria 1087
11 Ga0070690_100635583 3300005330 Bacteria 814
12 Ga0070677_10120770 3300005333 Bacteria 1183
13 Ga0070668_102079940 3300005347 Bacteria 524
14 Ga0070669_100129677 3300005353 Bacteria 1933
15 Ga0070675_100414071 3300005354 Bacteria 1204
16 Ga0070671_100085200 3300005355 Bacteria 2643
17 Ga0070671_100676986 3300005355 Bacteria 894
18 Ga0070671_101500304 3300005355 Bacteria 596
19 Ga0070673_102162953 3300005364 Bacteria 529
20 Ga0070673_102277925 3300005364 Bacteria 515
21 Ga0070714_101515396 3300005435 Bacteria 655
22 Ga0070713_100084238 3300005436 Bacteria 2720
23 Ga0070711_100011550 3300005439 Bacteria 5491
24 Ga0070711_100390717 3300005439 Bacteria 1127
25 Ga0070662_100252898 3300005457 Bacteria 1417
26 Ga0070662_101475623 3300005457 Unclassified 586
27 Ga0070684_100051034 3300005535 Bacteria 3593
28 Ga0070684_101602869 3300005535 Bacteria 614
29 Ga0070686_100666027 3300005544 Bacteria 827
30 Ga0070665_100524718 3300005548 Bacteria 1196
31 Ga0070664_100999983 3300005564 Bacteria 786
32 Ga0068854_101264051 3300005578 Bacteria 663
33 Ga0068856_100054027 3300005614 Bacteria 3961
34 Ga0068856_100411432 3300005614 Bacteria 1372
35 Ga0068852_100002290 3300005616 Bacteria 13168
36 Ga0068864_100386644 3300005618 Bacteria 1327
37 Ga0068863_100298426 3300005841 Bacteria 1563
38 Ga0068863_101667627 3300005841 Bacteria 647
39 Ga0075365_10060890 3300006038 Bacteria 2519
40 Ga0075365_10239656 3300006038 Bacteria 1274
41 Ga0075364_10665994 3300006051 Bacteria 711
42 Ga0070715_10008951 3300006163 Bacteria 3512
43 Ga0075362_10382314 3300006177 Bacteria 708
44 Ga0075367_10151620 3300006178 Bacteria 1439
45 Ga0075369_10122352 3300006186 Bacteria 1179
46 Ga0075370_10616175 3300006353 Bacteria 658
47 Ga0068871_100121011 3300006358 Bacteria 2211
48 Ga0075436_101198054 3300006914 Bacteria 573
49 Ga0105245_10332643 3300009098 Bacteria 1500
50 Ga0105245_11395193 3300009098 Bacteria 751
51 Ga0105241_10556816 3300009174 Bacteria 1030
52 Ga0105242_11528390 3300009176 Bacteria 699
53 Ga0105248_10834841 3300009177 Bacteria 1040
54 Ga0105248_11787096 3300009177 Bacteria 697
55 Ga0105248_12154013 3300009177 Bacteria 634
56 Ga0105237_10125638 3300009545 Bacteria 2559
57 Ga0105237_10407339 3300009545 Bacteria 1365
58 Ga0105237_12556965 3300009545 Bacteria 521
59 Ga0105238_10058531 3300009551 Bacteria 3862
60 Ga0105249_10169003 3300009553 Bacteria 2119
61 Ga0105239_10915988 3300010375 Bacteria 1006
62 Ga0157374_10263366 3300013296 Unclassified 1698
63 Ga0157372_10152414 3300013307 Bacteria 2669
64 Ga0157375_11812191 3300013308 Bacteria 724
65 Ga0163163_12030470 3300014325 Bacteria 635
66 Ga0157380_10017526 3300014326 Bacteria 5301
67 Ga0157380_10276158 3300014326 Bacteria 1535
68 Ga0157380_10389861 3300014326 Unclassified 1318
69 Ga0157377_10399669 3300014745 Bacteria 935
70 Ga0163161_10227070 3300017792 Bacteria 1448
71 Ga0163161_11765046 3300017792 Bacteria 549
72 Ga0163161_11940651 3300017792 Unclassified 524
73 Ga0206353_11071871 3300020082 Bacteria 544
74 Ga0213872_10041857 3300021361 Bacteria 2090
75 Ga0213876_10065467 3300021384 Bacteria 1918
76 Ga0213871_10237432 3300021441 Bacteria 576
77 Ga0209672_107490 3300025228 Bacteria 1679
78 Ga0209233_1004592 3300025261 Bacteria 4674
79 Ga0209675_1000272 3300025291 Bacteria 49613
80 Ga0209676_1000449 3300025292 Bacteria 69842
81 Ga0209676_1000859 3300025292 Bacteria 39183
82 Ga0209025_1048872 3300025294 Bacteria 1709
83 Ga0209050_1000067 3300025298 Bacteria 304206
84 Ga0209050_1018492 3300025298 Bacteria 2705
85 Ga0209257_1000986 3300025304 Bacteria 38597
86 Ga0209257_1001653 3300025304 Bacteria 25360
87 Ga0207697_10101477 3300025315 Bacteria 1226
88 Ga0207680_10428285 3300025903 Bacteria 937
89 Ga0207647_10299504 3300025904 Bacteria 916
90 Ga0207685_10010511 3300025905 Bacteria 2737
91 Ga0207705_10227322 3300025909 Bacteria 1418
92 Ga0207684_10515982 3300025910 Bacteria 1024
93 Ga0207684_11073931 3300025910 Bacteria 671
94 Ga0207671_10029165 3300025914 Bacteria 4122
95 Ga0207671_10106773 3300025914 Bacteria 2126
96 Ga0207663_10047375 3300025916 Bacteria 2653
97 Ga0207663_10956590 3300025916 Bacteria 686
98 Ga0207657_10417409 3300025919 Bacteria 1055
99 Ga0207657_11414068 3300025919 Unclassified 522
100 Ga0207646_10202942 3300025922 Bacteria 1791
101 Ga0207681_10131355 3300025923 Bacteria 1852
102 Ga0207681_10161848 3300025923 Unclassified 1688
103 Ga0207694_10022945 3300025924 Bacteria 4735
104 Ga0207700_10223188 3300025928 Bacteria 1598
105 Ga0207664_11099606 3300025929 Bacteria 711
106 Ga0207644_11201678 3300025931 Bacteria 637
107 Ga0207690_11003715 3300025932 Bacteria 694
108 Ga0207706_10683868 3300025933 Bacteria 877
109 Ga0207706_11248808 3300025933 Unclassified 616
110 Ga0207704_10454995 3300025938 Bacteria 1022
111 Ga0207711_10301569 3300025941 Bacteria 1478
112 Ga0207711_10780560 3300025941 Bacteria 890
113 Ga0207711_11597875 3300025941 Bacteria 595
114 Ga0207679_12034500 3300025945 Bacteria 522
115 Ga0207712_10000090 3300025961 Bacteria 104492
116 Ga0207640_10105754 3300025981 Bacteria 1984
117 Ga0207702_10068210 3300026078 Bacteria 3055
118 Ga0207702_10114977 3300026078 Bacteria 2399
119 Ga0207674_10368312 3300026116 Bacteria 1389
120 Ga0207698_10001101 3300026142 Bacteria 15747
121 Ga0209974_10173822 3300027876 Bacteria 786
122 Ga0268266_10466674 3300028379 Bacteria 1202
123 Ga0268265_10160076 3300028380 Bacteria 1911
124 Ga0265338_10000633 3300028800 Bacteria 61054
125 Ga0316182_1275177 3300030745 Bacteria 528
126 Ga0265328_10221020 3300031239 Bacteria 721
127 Ga0265320_10047277 3300031240 Bacteria 2105
128 Ga0265327_10000290 3300031251 Bacteria 98475
129 Ga0265316_10073623 3300031344 Unclassified 2631
130 Ga0307408_100673746 3300031548 Unclassified 927
131 Ga0307405_10164632 3300031731 Bacteria 1575
132 Ga0307405_11273324 3300031731 Bacteria 639
133 Ga0307413_10236805 3300031824 Bacteria 1345
134 Ga0307410_10147475 3300031852 Bacteria 1747
135 Ga0307410_10670247 3300031852 Bacteria 872
136 Ga0307410_11203990 3300031852 Bacteria 660
137 Ga0307410_11233730 3300031852 Unclassified 652
138 Ga0307407_10732075 3300031903 Bacteria 747
139 Ga0307412_10200475 3300031911 Bacteria 1515
140 Ga0307409_100061653 3300031995 Bacteria 2932
141 Ga0307409_100104306 3300031995 Unclassified 2361
142 Ga0307409_100908316 3300031995 Bacteria 895
143 Ga0307409_101609428 3300031995 Bacteria 678
144 Ga0307409_102240422 3300031995 Bacteria 576
145 Ga0307409_102781927 3300031995 Bacteria 517
146 Ga0307416_100698482 3300032002 Bacteria 1103
147 Ga0307416_101560854 3300032002 Bacteria 766
148 Ga0307414_10316684 3300032004 Bacteria 1326
149 Ga0307414_11414293 3300032004 Bacteria 646
150 Ga0307415_100419238 3300032126 Bacteria 1148
151 Ga0307415_100753897 3300032126 Bacteria 884
152 Ga0373930_0012940 3300034816 Bacteria 1530
153 Ga0373926_0350299 3300035083 Bacteria 580
154 Ga0373928_0221364 3300035084 Bacteria 554
155 Ga0373929_0113343 3300035085 Bacteria 696
156 Ga0373940_0006102 3300035088 Bacteria 2651
157 Ga0373931_0011760 3300035691 Bacteria 4230
158 Ga0373935_0563385 3300035692 Bacteria 831
159 Ga0373927_0297143 3300035695 Bacteria 1063
160 Ga0373927_0487001 3300035695 Bacteria 815
161 Ga0373947_0188575 3300035725 Bacteria 1345
162 Ga0373925_0380734 3300037068 Bacteria 1149
163 Ga0395900_0493340 3300037418 Bacteria 1176
164 Ga0395898_0741496 3300037466 Bacteria 924
165 Ga0395905_0184301 3300037471 Bacteria 1960
166 Ga0395905_0192819 3300037471 Bacteria 1911
167 Ga0436364_0312383 3300037853 Bacteria 2279
168 Ga0395901_0694582 3300038443 Bacteria 1016
169 Ga0436365_1344521 3300039437 Bacteria 5120
170 Ga0436360_1172930 3300039438 Bacteria 1115
171 Ga0436361_0074487 3300039447 Bacteria 2458
172 Ga0451853_2611840 3300041512 Bacteria 1055
173 Ga0439448_0019256 3300042005 Bacteria 2099
174 Ga0439455_0001267 3300042012 Bacteria 4144
175 Ga0439458_0000599 3300042157 Bacteria 9281
176 Ga0466972_0005090 3300044658 Bacteria 6589
177 Ga0466965_0095779 3300044683 Bacteria 1514
178 Ga0466961_0090771 3300044693 Bacteria 1929
179 Ga0466964_0262410 3300044706 Bacteria 856
180 Ga0466959_0141694 3300045049 Bacteria 1698
181 Ga0495617_000008 3300046452 Bacteria 340369
182 Ga0495617_040015 3300046452 Bacteria 1568
183 Ga0495627_000191 3300046453 Bacteria 67637
184 Ga0495627_009857 3300046453 Bacteria 3497
185 Ga0495590_0000017 3300046457 Bacteria 216944
186 Ga0495590_0012598 3300046457 Bacteria 3135
187 Ga0495591_000091 3300046458 Bacteria 101618
188 Ga0495591_004378 3300046458 Bacteria 6939
189 Ga0495591_058002 3300046458 Bacteria 1036
190 Ga0495638_0001065 3300046460 Bacteria 26779
191 Ga0495638_0068452 3300046460 Bacteria 2177
192 Ga0495638_0088952 3300046460 Bacteria 1863
193 Ga0495638_0345295 3300046460 Bacteria 787
194 Ga0495650_0106376 3300046471 Bacteria 1047
195 Ga0495605_0000559 3300046474 Bacteria 30395
196 Ga0495605_0004429 3300046474 Bacteria 8257
197 Ga0495605_0014773 3300046474 Bacteria 4264
198 Ga0495605_0039351 3300046474 Bacteria 2369
199 Ga0495662_0459432 3300046476 Bacteria 625
200 Ga0495584_0001217 3300046491 Bacteria 15721
201 Ga0495584_0087892 3300046491 Bacteria 1566
202 Ga0495585_0006675 3300046492 Bacteria 7128
203 Ga0495585_0011422 3300046492 Bacteria 5254
204 Ga0495585_0013692 3300046492 Bacteria 4740
205 Ga0495585_0065627 3300046492 Bacteria 1988
206 Ga0495585_0065985 3300046492 Bacteria 1982
207 Ga0495585_0097676 3300046492 Bacteria 1574
208 Ga0495585_0098895 3300046492 Bacteria 1562
209 Ga0495585_0225037 3300046492 Bacteria 945
210 Ga0495585_0522676 3300046492 Bacteria 562
211 Ga0495594_0002735 3300046499 Bacteria 9146
212 Ga0495596_0003495 3300046500 Bacteria 7926
213 Ga0495596_0011542 3300046500 Bacteria 3805
214 Ga0495596_0014417 3300046500 Bacteria 3331
215 Ga0495596_0023788 3300046500 Bacteria 2484
216 Ga0495596_0044970 3300046500 Bacteria 1736
217 Ga0495596_0278168 3300046500 Bacteria 650
218 Ga0495607_0004696 3300046501 Bacteria 9996
219 Ga0495607_0032829 3300046501 Bacteria 3164
220 Ga0495607_0128783 3300046501 Bacteria 1320
221 Ga0495607_0319130 3300046501 Bacteria 725
222 Ga0495583_0001871 3300046506 Bacteria 19588
223 Ga0495583_0003628 3300046506 Bacteria 11550
224 Ga0495583_0037224 3300046506 Bacteria 2308
225 Ga0495583_0050495 3300046506 Bacteria 1900
226 Ga0495606_0021322 3300046507 Bacteria 4747
227 Ga0495606_0335400 3300046507 Bacteria 807
228 Ga0495606_0435945 3300046507 Bacteria 674
229 Ga0495610_0023569 3300046512 Bacteria 3341
230 Ga0495616_0006834 3300046513 Bacteria 6871
231 Ga0495616_0009676 3300046513 Bacteria 5619
232 Ga0495616_0036379 3300046513 Bacteria 2540
233 Ga0495616_0065871 3300046513 Bacteria 1763
234 Ga0495616_0281880 3300046513 Bacteria 706
235 Ga0495620_0080128 3300046515 Bacteria 1322
236 Ga0495631_0000562 3300046518 Bacteria 24956
237 Ga0495631_0004969 3300046518 Bacteria 7007
238 Ga0495631_0009488 3300046518 Bacteria 4859
239 Ga0495631_0014596 3300046518 Bacteria 3785
240 Ga0495631_0034871 3300046518 Bacteria 2253
241 Ga0495631_0067513 3300046518 Bacteria 1547
242 Ga0495632_0026481 3300046519 Bacteria 3052
243 Ga0495632_0027540 3300046519 Bacteria 2976
244 Ga0495637_0000004 3300046520 Bacteria 589740
245 Ga0495637_0021740 3300046520 Bacteria 2937
246 Ga0495637_0048357 3300046520 Bacteria 1791
247 Ga0495643_0004608 3300046522 Bacteria 9597
248 Ga0495643_0007678 3300046522 Bacteria 6917
249 Ga0495643_0055130 3300046522 Bacteria 2125
250 Ga0495643_0217716 3300046522 Bacteria 907
251 Ga0495644_0002176 3300046523 Bacteria 7874
252 Ga0495644_0006276 3300046523 Bacteria 4616
253 Ga0495648_0001050 3300046524 Bacteria 28021
254 Ga0495648_0001311 3300046524 Bacteria 24643
255 Ga0495648_0004718 3300046524 Bacteria 11547
256 Ga0495648_0014544 3300046524 Bacteria 5756
257 Ga0495648_0220890 3300046524 Bacteria 934
258 Ga0495663_0003280 3300046525 Bacteria 4695
259 Ga0495642_0000617 3300046528 Bacteria 17917
260 Ga0495642_0005805 3300046528 Bacteria 4733
261 Ga0495642_0005858 3300046528 Bacteria 4716
262 Ga0495642_0024677 3300046528 Bacteria 2379
263 Ga0495642_0047458 3300046528 Bacteria 1759
264 Ga0495642_0171285 3300046528 Bacteria 943
265 Ga0495654_0015086 3300046530 Bacteria 4106
266 Ga0495654_0026683 3300046530 Bacteria 2967
267 Ga0495598_0022835 3300046537 Unclassified 1678
268 Ga0495598_0152644 3300046537 Bacteria 807
269 Ga0495609_0002370 3300046538 Bacteria 11617
270 Ga0495609_0040928 3300046538 Bacteria 2084
271 Ga0495609_0047109 3300046538 Bacteria 1929
272 Ga0495621_0000144 3300046539 Bacteria 15306
273 Ga0495621_0001623 3300046539 Bacteria 5877
274 Ga0495597_0000698 3300046542 Bacteria 26850
275 Ga0495597_0001066 3300046542 Bacteria 20915
276 Ga0495597_0003204 3300046542 Bacteria 9745
277 Ga0495633_0002747 3300046558 Bacteria 12167
278 Ga0495633_0265268 3300046558 Bacteria 782
279 Ga0495633_0265745 3300046558 Bacteria 781
280 Ga0495656_0012801 3300046615 Bacteria 3105
281 Ga0495668_0000392 3300046616 Bacteria 57835
282 Ga0495668_0001900 3300046616 Bacteria 18693
283 Ga0495668_0010923 3300046616 Bacteria 5468
284 Ga0495611_0000157 3300046648 Bacteria 48892
285 Ga0495611_0010918 3300046648 Bacteria 3847
286 Ga0495611_0100061 3300046648 Bacteria 1345
287 Ga0495611_0205706 3300046648 Bacteria 917
288 Ga0495611_0375820 3300046648 Bacteria 651
289 Ga0495625_0013337 3300046660 Bacteria 6607
290 Ga0495625_0020065 3300046660 Bacteria 5166
291 Ga0495625_0030150 3300046660 Bacteria 4050
292 Ga0495625_0236373 3300046660 Bacteria 1191
293 Ga0495625_0287401 3300046660 Bacteria 1056
294 Ga0495659_0067337 3300046664 Bacteria 1335
295 Ga0495659_0513747 3300046664 Bacteria 526
296 Ga0495661_0001268 3300046665 Bacteria 21721
297 Ga0495661_0004823 3300046665 Bacteria 9669
298 Ga0495661_0013825 3300046665 Bacteria 5415
299 Ga0495661_0070545 3300046665 Bacteria 2044
300 Ga0495661_0073867 3300046665 Bacteria 1985
301 Ga0495661_0131343 3300046665 Bacteria 1372
302 Ga0495661_0176134 3300046665 Bacteria 1136
303 Ga0495661_0333742 3300046665 Bacteria 750
304 Ga0495661_0536717 3300046665 Bacteria 554
305 Ga0495588_0012241 3300046674 Bacteria 4048
306 Ga0495588_0043710 3300046674 Bacteria 2293
307 Ga0495669_0001365 3300046684 Bacteria 10068
308 Ga0495669_0002151 3300046684 Bacteria 8092
309 Ga0495669_0011625 3300046684 Bacteria 3741
310 Ga0495669_0027397 3300046684 Bacteria 2493
311 Ga0495669_0055884 3300046684 Bacteria 1778
312 Ga0495669_0287105 3300046684 Bacteria 792
313 Ga0495670_0005238 3300046691 Bacteria 6381
314 Ga0495670_0008995 3300046691 Bacteria 4913
315 Ga0495671_0000228 3300046692 Bacteria 48268
316 Ga0495671_0016932 3300046692 Bacteria 3885
317 Ga0495671_0605009 3300046692 Bacteria 521
318 Ga0495649_0000326 3300046694 Bacteria 41384
319 Ga0495649_0037339 3300046694 Bacteria 2666
320 Ga0495649_0080501 3300046694 Bacteria 1742
321 Ga0495649_0229157 3300046694 Bacteria 959
322 Ga0495589_0034475 3300046794 Bacteria 2540
323 Ga0495589_0136361 3300046794 Bacteria 1176
324 Ga0495660_0010226 3300046810 Bacteria 5455
325 Ga0495660_0025605 3300046810 Bacteria 3349
326 Ga0495660_0066180 3300046810 Bacteria 1927
327 Ga0495660_0085684 3300046810 Bacteria 1645
328 Ga0495660_0097575 3300046810 Bacteria 1517
329 Ga0495660_0137477 3300046810 Bacteria 1219
330 Ga0495660_0317159 3300046810 Bacteria 701
331 Ga0495636_0155408 3300047318 Bacteria 1028
332 Ga0495672_0000098 3300047320 Bacteria 141277
333 Ga0495672_0061653 3300047320 Bacteria 2161
334 Ga0495683_0000247 3300047323 Bacteria 48691
335 Ga0495683_0046044 3300047323 Bacteria 2189
336 Ga0495687_080551 3300047443 Bacteria 1277
337 Ga0495677_0000268 3300047445 Bacteria 22890
338 Ga0495677_0001492 3300047445 Bacteria 9409
339 Ga0495677_0075870 3300047445 Bacteria 1256
340 Ga0495677_0104028 3300047445 Bacteria 1076
341 Ga0495677_0132591 3300047445 Bacteria 954
342 Ga0495677_0214986 3300047445 Bacteria 748
343 Ga0495679_000520 3300047446 Bacteria 27232
344 Ga0495679_007855 3300047446 Bacteria 4397
345 Ga0495679_063206 3300047446 Bacteria 1081
346 Ga0495679_111285 3300047446 Bacteria 753
347 Ga0495685_012776 3300047447 Bacteria 2844
348 Ga0495685_054939 3300047447 Bacteria 1347
349 Ga0495685_058342 3300047447 Bacteria 1303
350 Ga0495681_0016978 3300047470 Bacteria 4059
351 Ga0495681_0062414 3300047470 Bacteria 1713
352 Ga0495681_0103624 3300047470 Bacteria 1241
353 Ga0495681_0138067 3300047470 Bacteria 1032
354 Ga0495686_0000813 3300047472 Bacteria 40397
355 Ga0495686_0007060 3300047472 Bacteria 8471
356 Ga0495686_0017253 3300047472 Bacteria 4867
357 Ga0495686_0376139 3300047472 Bacteria 767
358 Ga0495686_0488353 3300047472 Bacteria 650
359 Ga0495626_0002730 3300048091 Bacteria 11895
360 Ga0495626_0003299 3300048091 Bacteria 10424
361 Ga0495626_0004535 3300048091 Bacteria 8489
362 Ga0495626_0019805 3300048091 Bacteria 3359
363 Ga0495626_0042991 3300048091 Bacteria 2121
364 Ga0495626_0061603 3300048091 Bacteria 1705
365 Ga0496100_0122606 3300048903 Bacteria 1820
366 Ga0496101_0002682 3300048904 Bacteria 10928
367 Ga0496101_0025630 3300048904 Bacteria 4092
368 Ga0496102_0000407 3300048905 Bacteria 49858
369 Ga0496102_0025490 3300048905 Bacteria 5265
370 Ga0496103_0122708 3300048906 Bacteria 1656
371 Ga0496105_0084597 3300048908 Bacteria 2620
372 Ga0496106_0039279 3300048909 Bacteria 3544
373 Ga0496109_0011263 3300048912 Bacteria 7680
374 Ga0496109_0252638 3300048912 Bacteria 1660
375 Ga0496110_0224486 3300048913 Bacteria 1708
376 Ga0496110_1214555 3300048913 Bacteria 663
377 Ga0496111_0072421 3300048914 Bacteria 2508
378 Ga0496112_0135663 3300048915 Bacteria 2431
379 Ga0496113_0012758 3300048916 Bacteria 5660
380 Ga0496113_0168967 3300048916 Bacteria 1731
381 Ga0496121_0462392 3300048924 Bacteria 815
382 Ga0496122_0000210 3300048925 Bacteria 130178
383 Ga0496122_0112042 3300048925 Bacteria 1788
384 Ga0496123_0000597 3300048926 Bacteria 61302
385 Ga0496123_0407392 3300048926 Bacteria 617
386 Ga0496124_0033985 3300048927 Bacteria 4481
387 Ga0496124_0217158 3300048927 Bacteria 1441
388 Ga0496124_0298430 3300048927 Bacteria 1165
389 Ga0496125_0000789 3300048928 Bacteria 51669
390 Ga0495678_000153 3300049459 Bacteria 83461
391 Ga0495678_000284 3300049459 Bacteria 55655
392 Ga0495678_020907 3300049459 Bacteria 2889
393 Ga0495682_0002286 3300049460 Bacteria 9162
394 Ga0495682_0007451 3300049460 Bacteria 4350
395 Ga0495682_0027231 3300049460 Bacteria 2120
396 Ga0495682_0034320 3300049460 Bacteria 1871
397 Ga0501033_0238880 3300049570 Bacteria 1289
398 Ga0501034_0009897 3300049571 Bacteria 9966
399 Ga0501034_0027307 3300049571 Bacteria 5807
400 Ga0501034_0968967 3300049571 Bacteria 736
401 Ga0501034_1324243 3300049571 Bacteria 597
402 Ga0501068_0007734 3300049584 Bacteria 5950
403 Ga0501069_0000197 3300049585 Bacteria 26672
404 Ga0501070_0000230 3300049586 Bacteria 52769
405 Ga0501073_1279491 3300049589 Bacteria 503
406 Ga0501074_0534359 3300049590 Bacteria 830
407 Ga0501080_0000606 3300049742 Bacteria 28368
408 Ga0501080_1045195 3300049742 Bacteria 707
409 Ga0501263_060746 3300049760 Bacteria 592
410 Ga0501044_0032280 3300049823 Bacteria 5506
411 nmdc:mga0yw44_348106_c1 3300050492 Bacteria 997
412 nmdc:mga0yw44_590020_c1 3300050492 Bacteria 755
413 nmdc:mga0k408_701182_c1 3300050493 Bacteria 593
414 Ga0495619_1186904 3300053085 Bacteria 506
415 Ga0500641_0012466 3300053096 Bacteria 3106
416 Ga0500650_0461163 3300053098 Bacteria 544
417 Ga0500658_0001552 3300053134 Bacteria 9181
418 Ga0590071_036866 3300059421 Bacteria 1173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059421 Ga0590071_036866 Ga0590071_036866_166_483 91
2 3300005333 Ga0070677_10120770 Ga0070677_101207702 93
3 3300005353 Ga0070669_100129677 Ga0070669_1001296772 93
4 3300005354 Ga0070675_100414071 Ga0070675_1004140712 93
5 3300005355 Ga0070671_100676986 Ga0070671_1006769862 93
6 3300005364 Ga0070673_102162953 Ga0070673_1021629531 93
7 3300005457 Ga0070662_100252898 Ga0070662_1002528983 93
8 3300005578 Ga0068854_101264051 Ga0068854_1012640511 93
9 3300005618 Ga0068864_100386644 Ga0068864_1003866442 93
10 3300009177 Ga0105248_12154013 Ga0105248_121540132 93
11 3300017792 Ga0163161_11765046 Ga0163161_117650461 93
12 3300025903 Ga0207680_10428285 Ga0207680_104282852 93
13 3300025923 Ga0207681_10131355 Ga0207681_101313553 93
14 3300025933 Ga0207706_10683868 Ga0207706_106838682 93
15 3300025941 Ga0207711_11597875 Ga0207711_115978752 93
16 3300025981 Ga0207640_10105754 Ga0207640_101057543 93
17 3300046684 Ga0495669_0027397 Ga0495669_0027397_42_404 93
18 3300037853 Ga0436364_0312383 Ga0436364_0312383_1490_1783 96
19 3300028800 Ga0265338_10000633 Ga0265338_1000063320 98
20 3300031344 Ga0265316_10073623 Ga0265316_100736232 98
21 3300050493 nmdc:mga0k408_701182_c1 nmdc:mga0k408_701182_c1_275_574 98
22 3300053098 Ga0500650_0461163 Ga0500650_0461163_18_314 98
23 3300049571 Ga0501034_0027307 Ga0501034_0027307_4695_4997 99
24 3300009098 Ga0105245_10332643 Ga0105245_103326432 100
25 3300046476 Ga0495662_0459432 Ga0495662_0459432_277_582 100
26 iso_pu_bacteria 2643221663 2644351658 102
27 iso_pu_bacteria 2854896431 2854901370 102
28 3300006914 Ga0075436_101198054 Ga0075436_1011980541 103
29 3300037418 Ga0395900_0493340 Ga0395900_0493340_374_691 104
30 3300046542 Ga0495597_0000698 Ga0495597_0000698_15336_15653 104
31 3300048091 Ga0495626_0002730 Ga0495626_0002730_2012_2329 104
32 3300048903 Ga0496100_0122606 Ga0496100_0122606_604_954 104
33 3300048912 Ga0496109_0011263 Ga0496109_0011263_6331_6672 104
34 3300048913 Ga0496110_1214555 Ga0496110_1214555_176_493 104
35 3300048916 Ga0496113_0168967 Ga0496113_0168967_23_364 104
36 3300048925 Ga0496122_0000210 Ga0496122_0000210_93876_94217 104
37 3300048926 Ga0496123_0000597 Ga0496123_0000597_33119_33460 104
38 3300048928 Ga0496125_0000789 Ga0496125_0000789_4056_4397 104
39 3300005327 Ga0070658_10468414 Ga0070658_104684142 105
40 3300005435 Ga0070714_101515396 Ga0070714_1015153961 105
41 3300021441 Ga0213871_10237432 Ga0213871_102374321 105
42 3300025909 Ga0207705_10227322 Ga0207705_102273221 105
43 3300025929 Ga0207664_11099606 Ga0207664_110996062 105
44 3300039438 Ga0436360_1172930 Ga0436360_1172930_403_732 105
45 3300049585 Ga0501069_0000197 Ga0501069_0000197_11011_11361 105
46 3300049586 Ga0501070_0000230 Ga0501070_0000230_37108_37458 105
47 3300049590 Ga0501074_0534359 Ga0501074_0534359_93_443 105
48 3300049742 Ga0501080_0000606 Ga0501080_0000606_17429_17779 105
49 3300003320 rootH2_10002496 rootH2_100024962 106
50 3300003323 rootH1_10105012 rootH1_101050126 106
51 3300003781 Ga0055536_1002801 Ga0055536_10028019 106
52 3300003781 Ga0055536_1004868 Ga0055536_10048684 106
53 3300003784 Ga0055534_1039840 Ga0055534_10398402 106
54 3300003791 Ga0055530_10000968 Ga0055530_1000096815 106
55 3300003794 Ga0055531_10003625 Ga0055531_100036259 106
56 3300003794 Ga0055531_10042516 Ga0055531_100425163 106
57 3300005262 Ga0065165_1000891 Ga0065165_100089120 106
58 3300005330 Ga0070690_100635583 Ga0070690_1006355831 106
59 3300005347 Ga0070668_102079940 Ga0070668_1020799402 106
60 3300005355 Ga0070671_100085200 Ga0070671_1000852001 106
61 3300005355 Ga0070671_101500304 Ga0070671_1015003041 106
62 3300005364 Ga0070673_102277925 Ga0070673_1022779251 106
63 3300005436 Ga0070713_100084238 Ga0070713_1000842381 106
64 3300005439 Ga0070711_100011550 Ga0070711_1000115507 106
65 3300005439 Ga0070711_100390717 Ga0070711_1003907173 106
66 3300005457 Ga0070662_101475623 Ga0070662_1014756231 106
67 3300005535 Ga0070684_100051034 Ga0070684_1000510346 106
68 3300005535 Ga0070684_101602869 Ga0070684_1016028691 106
69 3300005544 Ga0070686_100666027 Ga0070686_1006660271 106
70 3300005548 Ga0070665_100524718 Ga0070665_1005247182 106
71 3300005564 Ga0070664_100999983 Ga0070664_1009999832 106
72 3300005614 Ga0068856_100054027 Ga0068856_1000540272 106
73 3300005614 Ga0068856_100411432 Ga0068856_1004114322 106
74 3300005616 Ga0068852_100002290 Ga0068852_10000229014 106
75 3300005841 Ga0068863_100298426 Ga0068863_1002984261 106
76 3300005841 Ga0068863_101667627 Ga0068863_1016676271 106
77 3300006038 Ga0075365_10060890 Ga0075365_100608904 106
78 3300006038 Ga0075365_10239656 Ga0075365_102396562 106
79 3300006051 Ga0075364_10665994 Ga0075364_106659941 106
80 3300006163 Ga0070715_10008951 Ga0070715_100089513 106
81 3300006177 Ga0075362_10382314 Ga0075362_103823142 106
82 3300006178 Ga0075367_10151620 Ga0075367_101516202 106
83 3300006186 Ga0075369_10122352 Ga0075369_101223522 106
84 3300006353 Ga0075370_10616175 Ga0075370_106161752 106
85 3300006358 Ga0068871_100121011 Ga0068871_1001210111 106
86 3300009098 Ga0105245_11395193 Ga0105245_113951931 106
87 3300009174 Ga0105241_10556816 Ga0105241_105568161 106
88 3300009176 Ga0105242_11528390 Ga0105242_115283902 106
89 3300009177 Ga0105248_10834841 Ga0105248_108348412 106
90 3300009177 Ga0105248_11787096 Ga0105248_117870961 106
91 3300009545 Ga0105237_10125638 Ga0105237_101256382 106
92 3300009545 Ga0105237_10407339 Ga0105237_104073393 106
93 3300009545 Ga0105237_12556965 Ga0105237_125569652 106
94 3300009551 Ga0105238_10058531 Ga0105238_100585315 106
95 3300009553 Ga0105249_10169003 Ga0105249_101690032 106
96 3300010375 Ga0105239_10915988 Ga0105239_109159881 106
97 3300013296 Ga0157374_10263366 Ga0157374_102633662 106
98 3300013307 Ga0157372_10152414 Ga0157372_101524142 106
99 3300013308 Ga0157375_11812191 Ga0157375_118121911 106
100 3300014325 Ga0163163_12030470 Ga0163163_120304702 106
101 3300014326 Ga0157380_10017526 Ga0157380_100175266 106
102 3300014326 Ga0157380_10276158 Ga0157380_102761582 106
103 3300014326 Ga0157380_10389861 Ga0157380_103898611 106
104 3300014745 Ga0157377_10399669 Ga0157377_103996693 106
105 3300017792 Ga0163161_10227070 Ga0163161_102270702 106
106 3300017792 Ga0163161_11940651 Ga0163161_119406512 106
107 3300020082 Ga0206353_11071871 Ga0206353_110718712 106
108 3300021361 Ga0213872_10041857 Ga0213872_100418572 106
109 3300021384 Ga0213876_10065467 Ga0213876_100654671 106
110 3300025228 Ga0209672_107490 Ga0209672_1074901 106
111 3300025261 Ga0209233_1004592 Ga0209233_10045927 106
112 3300025291 Ga0209675_1000272 Ga0209675_100027244 106
113 3300025292 Ga0209676_1000449 Ga0209676_100044930 106
114 3300025292 Ga0209676_1000859 Ga0209676_100085923 106
115 3300025294 Ga0209025_1048872 Ga0209025_10488724 106
116 3300025298 Ga0209050_1000067 Ga0209050_1000067200 106
117 3300025298 Ga0209050_1018492 Ga0209050_10184923 106
118 3300025304 Ga0209257_1000986 Ga0209257_100098621 106
119 3300025304 Ga0209257_1001653 Ga0209257_100165315 106
120 3300025315 Ga0207697_10101477 Ga0207697_101014771 106
121 3300025904 Ga0207647_10299504 Ga0207647_102995042 106
122 3300025905 Ga0207685_10010511 Ga0207685_100105111 106
123 3300025910 Ga0207684_10515982 Ga0207684_105159823 106
124 3300025910 Ga0207684_11073931 Ga0207684_110739312 106
125 3300025914 Ga0207671_10029165 Ga0207671_100291657 106
126 3300025914 Ga0207671_10106773 Ga0207671_101067734 106
127 3300025916 Ga0207663_10047375 Ga0207663_100473753 106
128 3300025916 Ga0207663_10956590 Ga0207663_109565902 106
129 3300025919 Ga0207657_10417409 Ga0207657_104174093 106
130 3300025919 Ga0207657_11414068 Ga0207657_114140681 106
131 3300025922 Ga0207646_10202942 Ga0207646_102029422 106
132 3300025923 Ga0207681_10161848 Ga0207681_101618483 106
133 3300025924 Ga0207694_10022945 Ga0207694_100229456 106
134 3300025928 Ga0207700_10223188 Ga0207700_102231883 106
135 3300025931 Ga0207644_11201678 Ga0207644_112016782 106
136 3300025932 Ga0207690_11003715 Ga0207690_110037151 106
137 3300025933 Ga0207706_11248808 Ga0207706_112488081 106
138 3300025938 Ga0207704_10454995 Ga0207704_104549951 106
139 3300025941 Ga0207711_10301569 Ga0207711_103015691 106
140 3300025941 Ga0207711_10780560 Ga0207711_107805602 106
141 3300025945 Ga0207679_12034500 Ga0207679_120345001 106
142 3300025961 Ga0207712_10000090 Ga0207712_1000009069 106
143 3300026078 Ga0207702_10068210 Ga0207702_100682107 106
144 3300026078 Ga0207702_10114977 Ga0207702_101149774 106
145 3300026116 Ga0207674_10368312 Ga0207674_103683122 106
146 3300026142 Ga0207698_10001101 Ga0207698_1000110110 106
147 3300027876 Ga0209974_10173822 Ga0209974_101738222 106
148 3300028379 Ga0268266_10466674 Ga0268266_104666742 106
149 3300028380 Ga0268265_10160076 Ga0268265_101600762 106
150 3300030745 Ga0316182_1275177 Ga0316182_12751772 106
151 3300031239 Ga0265328_10221020 Ga0265328_102210201 106
152 3300031240 Ga0265320_10047277 Ga0265320_100472773 106
153 3300031251 Ga0265327_10000290 Ga0265327_1000029019 106
154 3300031548 Ga0307408_100673746 Ga0307408_1006737463 106
155 3300031731 Ga0307405_10164632 Ga0307405_101646321 106
156 3300031731 Ga0307405_11273324 Ga0307405_112733242 106
157 3300031824 Ga0307413_10236805 Ga0307413_102368054 106
158 3300031852 Ga0307410_10147475 Ga0307410_101474752 106
159 3300031852 Ga0307410_10670247 Ga0307410_106702472 106
160 3300031852 Ga0307410_11203990 Ga0307410_112039902 106
161 3300031852 Ga0307410_11233730 Ga0307410_112337302 106
162 3300031903 Ga0307407_10732075 Ga0307407_107320751 106
163 3300031911 Ga0307412_10200475 Ga0307412_102004751 106
164 3300031995 Ga0307409_100061653 Ga0307409_1000616534 106
165 3300031995 Ga0307409_100104306 Ga0307409_1001043062 106
166 3300031995 Ga0307409_100908316 Ga0307409_1009083162 106
167 3300031995 Ga0307409_101609428 Ga0307409_1016094282 106
168 3300031995 Ga0307409_102240422 Ga0307409_1022404221 106
169 3300031995 Ga0307409_102781927 Ga0307409_1027819272 106
170 3300032002 Ga0307416_100698482 Ga0307416_1006984822 106
171 3300032002 Ga0307416_101560854 Ga0307416_1015608542 106
172 3300032004 Ga0307414_10316684 Ga0307414_103166842 106
173 3300032004 Ga0307414_11414293 Ga0307414_114142932 106
174 3300032126 Ga0307415_100419238 Ga0307415_1004192381 106
175 3300032126 Ga0307415_100753897 Ga0307415_1007538972 106
176 3300034816 Ga0373930_0012940 Ga0373930_0012940_134_469 106
177 3300035083 Ga0373926_0350299 Ga0373926_0350299_145_480 106
178 3300035084 Ga0373928_0221364 Ga0373928_0221364_16_351 106
179 3300035085 Ga0373929_0113343 Ga0373929_0113343_30_365 106
180 3300035088 Ga0373940_0006102 Ga0373940_0006102_1717_2052 106
181 3300035691 Ga0373931_0011760 Ga0373931_0011760_3786_4121 106
182 3300035692 Ga0373935_0563385 Ga0373935_0563385_495_818 106
183 3300035695 Ga0373927_0297143 Ga0373927_0297143_645_968 106
184 3300035695 Ga0373927_0487001 Ga0373927_0487001_304_627 106
185 3300035725 Ga0373947_0188575 Ga0373947_0188575_641_964 106
186 3300037068 Ga0373925_0380734 Ga0373925_0380734_501_824 106
187 3300037466 Ga0395898_0741496 Ga0395898_0741496_170_493 106
188 3300037471 Ga0395905_0184301 Ga0395905_0184301_949_1311 106
189 3300037471 Ga0395905_0192819 Ga0395905_0192819_653_976 106
190 3300038443 Ga0395901_0694582 Ga0395901_0694582_662_991 106
191 3300039437 Ga0436365_1344521 Ga0436365_1344521_2849_3172 106
192 3300039447 Ga0436361_0074487 Ga0436361_0074487_638_967 106
193 3300041512 Ga0451853_2611840 Ga0451853_2611840_425_748 106
194 3300042005 Ga0439448_0019256 Ga0439448_0019256_1502_1831 106
195 3300042012 Ga0439455_0001267 Ga0439455_0001267_2776_3105 106
196 3300042157 Ga0439458_0000599 Ga0439458_0000599_5185_5514 106
197 3300044658 Ga0466972_0005090 Ga0466972_0005090_3567_3896 106
198 3300044683 Ga0466965_0095779 Ga0466965_0095779_962_1291 106
199 3300044693 Ga0466961_0090771 Ga0466961_0090771_466_795 106
200 3300044706 Ga0466964_0262410 Ga0466964_0262410_362_691 106
201 3300045049 Ga0466959_0141694 Ga0466959_0141694_1183_1512 106
202 3300046452 Ga0495617_000008 Ga0495617_000008_211521_211844 106
203 3300046452 Ga0495617_040015 Ga0495617_040015_1005_1328 106
204 3300046453 Ga0495627_000191 Ga0495627_000191_5888_6211 106
205 3300046453 Ga0495627_009857 Ga0495627_009857_2533_2856 106
206 3300046457 Ga0495590_0000017 Ga0495590_0000017_17249_17572 106
207 3300046457 Ga0495590_0012598 Ga0495590_0012598_798_1121 106
208 3300046458 Ga0495591_000091 Ga0495591_000091_84595_84918 106
209 3300046458 Ga0495591_004378 Ga0495591_004378_3583_3906 106
210 3300046458 Ga0495591_058002 Ga0495591_058002_627_950 106
211 3300046460 Ga0495638_0001065 Ga0495638_0001065_8221_8544 106
212 3300046460 Ga0495638_0068452 Ga0495638_0068452_440_763 106
213 3300046460 Ga0495638_0088952 Ga0495638_0088952_1106_1429 106
214 3300046460 Ga0495638_0345295 Ga0495638_0345295_63_386 106
215 3300046471 Ga0495650_0106376 Ga0495650_0106376_247_570 106
216 3300046474 Ga0495605_0000559 Ga0495605_0000559_13460_13783 106
217 3300046474 Ga0495605_0004429 Ga0495605_0004429_1448_1771 106
218 3300046474 Ga0495605_0014773 Ga0495605_0014773_375_698 106
219 3300046474 Ga0495605_0039351 Ga0495605_0039351_210_533 106
220 3300046491 Ga0495584_0001217 Ga0495584_0001217_8859_9182 106
221 3300046491 Ga0495584_0087892 Ga0495584_0087892_621_944 106
222 3300046492 Ga0495585_0006675 Ga0495585_0006675_6127_6450 106
223 3300046492 Ga0495585_0011422 Ga0495585_0011422_4647_4970 106
224 3300046492 Ga0495585_0013692 Ga0495585_0013692_106_429 106
225 3300046492 Ga0495585_0065627 Ga0495585_0065627_683_1006 106
226 3300046492 Ga0495585_0065985 Ga0495585_0065985_138_461 106
227 3300046492 Ga0495585_0097676 Ga0495585_0097676_991_1314 106
228 3300046492 Ga0495585_0098895 Ga0495585_0098895_437_760 106
229 3300046492 Ga0495585_0225037 Ga0495585_0225037_509_832 106
230 3300046492 Ga0495585_0522676 Ga0495585_0522676_47_370 106
231 3300046499 Ga0495594_0002735 Ga0495594_0002735_5432_5755 106
232 3300046500 Ga0495596_0003495 Ga0495596_0003495_4282_4605 106
233 3300046500 Ga0495596_0011542 Ga0495596_0011542_2201_2533 106
234 3300046500 Ga0495596_0014417 Ga0495596_0014417_837_1160 106
235 3300046500 Ga0495596_0023788 Ga0495596_0023788_307_630 106
236 3300046500 Ga0495596_0044970 Ga0495596_0044970_21_380 106
237 3300046500 Ga0495596_0278168 Ga0495596_0278168_229_552 106
238 3300046501 Ga0495607_0004696 Ga0495607_0004696_3628_3951 106
239 3300046501 Ga0495607_0032829 Ga0495607_0032829_1386_1709 106
240 3300046501 Ga0495607_0128783 Ga0495607_0128783_756_1079 106
241 3300046501 Ga0495607_0319130 Ga0495607_0319130_83_406 106
242 3300046506 Ga0495583_0001871 Ga0495583_0001871_8258_8581 106
243 3300046506 Ga0495583_0003628 Ga0495583_0003628_2882_3205 106
244 3300046506 Ga0495583_0037224 Ga0495583_0037224_1548_1871 106
245 3300046506 Ga0495583_0050495 Ga0495583_0050495_381_704 106
246 3300046507 Ga0495606_0021322 Ga0495606_0021322_1855_2178 106
247 3300046507 Ga0495606_0335400 Ga0495606_0335400_285_608 106
248 3300046507 Ga0495606_0435945 Ga0495606_0435945_341_664 106
249 3300046512 Ga0495610_0023569 Ga0495610_0023569_863_1186 106
250 3300046513 Ga0495616_0006834 Ga0495616_0006834_2398_2721 106
251 3300046513 Ga0495616_0009676 Ga0495616_0009676_1514_1837 106
252 3300046513 Ga0495616_0036379 Ga0495616_0036379_1582_1905 106
253 3300046513 Ga0495616_0065871 Ga0495616_0065871_1320_1643 106
254 3300046513 Ga0495616_0281880 Ga0495616_0281880_218_541 106
255 3300046515 Ga0495620_0080128 Ga0495620_0080128_638_961 106
256 3300046518 Ga0495631_0000562 Ga0495631_0000562_13048_13371 106
257 3300046518 Ga0495631_0004969 Ga0495631_0004969_5694_6017 106
258 3300046518 Ga0495631_0009488 Ga0495631_0009488_3756_4079 106
259 3300046518 Ga0495631_0014596 Ga0495631_0014596_3216_3539 106
260 3300046518 Ga0495631_0034871 Ga0495631_0034871_1414_1737 106
261 3300046518 Ga0495631_0067513 Ga0495631_0067513_1203_1535 106
262 3300046519 Ga0495632_0026481 Ga0495632_0026481_394_717 106
263 3300046519 Ga0495632_0027540 Ga0495632_0027540_634_957 106
264 3300046520 Ga0495637_0000004 Ga0495637_0000004_6742_7065 106
265 3300046520 Ga0495637_0021740 Ga0495637_0021740_1298_1621 106
266 3300046520 Ga0495637_0048357 Ga0495637_0048357_1404_1727 106
267 3300046522 Ga0495643_0004608 Ga0495643_0004608_9247_9570 106
268 3300046522 Ga0495643_0007678 Ga0495643_0007678_2730_3053 106
269 3300046522 Ga0495643_0055130 Ga0495643_0055130_1402_1725 106
270 3300046522 Ga0495643_0217716 Ga0495643_0217716_265_588 106
271 3300046523 Ga0495644_0002176 Ga0495644_0002176_6997_7320 106
272 3300046523 Ga0495644_0006276 Ga0495644_0006276_179_502 106
273 3300046524 Ga0495648_0001050 Ga0495648_0001050_5942_6265 106
274 3300046524 Ga0495648_0001311 Ga0495648_0001311_14787_15110 106
275 3300046524 Ga0495648_0004718 Ga0495648_0004718_6195_6518 106
276 3300046524 Ga0495648_0014544 Ga0495648_0014544_3683_4006 106
277 3300046524 Ga0495648_0220890 Ga0495648_0220890_220_543 106
278 3300046525 Ga0495663_0003280 Ga0495663_0003280_4186_4542 106
279 3300046528 Ga0495642_0000617 Ga0495642_0000617_14697_15020 106
280 3300046528 Ga0495642_0005805 Ga0495642_0005805_701_1024 106
281 3300046528 Ga0495642_0005858 Ga0495642_0005858_419_742 106
282 3300046528 Ga0495642_0024677 Ga0495642_0024677_250_573 106
283 3300046528 Ga0495642_0047458 Ga0495642_0047458_81_404 106
284 3300046528 Ga0495642_0171285 Ga0495642_0171285_369_692 106
285 3300046530 Ga0495654_0015086 Ga0495654_0015086_3324_3647 106
286 3300046530 Ga0495654_0026683 Ga0495654_0026683_58_381 106
287 3300046537 Ga0495598_0022835 Ga0495598_0022835_979_1338 106
288 3300046537 Ga0495598_0152644 Ga0495598_0152644_174_530 106
289 3300046538 Ga0495609_0002370 Ga0495609_0002370_3343_3666 106
290 3300046538 Ga0495609_0040928 Ga0495609_0040928_402_725 106
291 3300046538 Ga0495609_0047109 Ga0495609_0047109_1414_1737 106
292 3300046539 Ga0495621_0000144 Ga0495621_0000144_4260_4616 106
293 3300046539 Ga0495621_0001623 Ga0495621_0001623_2527_2886 106
294 3300046542 Ga0495597_0001066 Ga0495597_0001066_12452_12775 106
295 3300046542 Ga0495597_0003204 Ga0495597_0003204_153_476 106
296 3300046558 Ga0495633_0002747 Ga0495633_0002747_9665_9988 106
297 3300046558 Ga0495633_0265268 Ga0495633_0265268_93_416 106
298 3300046558 Ga0495633_0265745 Ga0495633_0265745_345_668 106
299 3300046615 Ga0495656_0012801 Ga0495656_0012801_2121_2444 106
300 3300046616 Ga0495668_0000392 Ga0495668_0000392_46336_46659 106
301 3300046616 Ga0495668_0001900 Ga0495668_0001900_6064_6387 106
302 3300046616 Ga0495668_0010923 Ga0495668_0010923_3944_4267 106
303 3300046648 Ga0495611_0000157 Ga0495611_0000157_39068_39391 106
304 3300046648 Ga0495611_0010918 Ga0495611_0010918_2029_2352 106
305 3300046648 Ga0495611_0100061 Ga0495611_0100061_193_516 106
306 3300046648 Ga0495611_0205706 Ga0495611_0205706_234_557 106
307 3300046648 Ga0495611_0375820 Ga0495611_0375820_31_354 106
308 3300046660 Ga0495625_0013337 Ga0495625_0013337_2998_3321 106
309 3300046660 Ga0495625_0020065 Ga0495625_0020065_3877_4200 106
310 3300046660 Ga0495625_0030150 Ga0495625_0030150_450_773 106
311 3300046660 Ga0495625_0236373 Ga0495625_0236373_406_729 106
312 3300046660 Ga0495625_0287401 Ga0495625_0287401_577_900 106
313 3300046664 Ga0495659_0067337 Ga0495659_0067337_631_990 106
314 3300046664 Ga0495659_0513747 Ga0495659_0513747_12_335 106
315 3300046665 Ga0495661_0001268 Ga0495661_0001268_13202_13534 106
316 3300046665 Ga0495661_0004823 Ga0495661_0004823_3763_4086 106
317 3300046665 Ga0495661_0013825 Ga0495661_0013825_4621_4944 106
318 3300046665 Ga0495661_0070545 Ga0495661_0070545_328_651 106
319 3300046665 Ga0495661_0073867 Ga0495661_0073867_990_1313 106
320 3300046665 Ga0495661_0131343 Ga0495661_0131343_271_594 106
321 3300046665 Ga0495661_0176134 Ga0495661_0176134_129_452 106
322 3300046665 Ga0495661_0333742 Ga0495661_0333742_228_551 106
323 3300046665 Ga0495661_0536717 Ga0495661_0536717_206_529 106
324 3300046674 Ga0495588_0012241 Ga0495588_0012241_3099_3422 106
325 3300046674 Ga0495588_0043710 Ga0495588_0043710_161_484 106
326 3300046684 Ga0495669_0001365 Ga0495669_0001365_8949_9272 106
327 3300046684 Ga0495669_0002151 Ga0495669_0002151_3202_3525 106
328 3300046684 Ga0495669_0011625 Ga0495669_0011625_2725_3048 106
329 3300046684 Ga0495669_0055884 Ga0495669_0055884_695_1018 106
330 3300046684 Ga0495669_0287105 Ga0495669_0287105_152_475 106
331 3300046691 Ga0495670_0005238 Ga0495670_0005238_4771_5094 106
332 3300046691 Ga0495670_0008995 Ga0495670_0008995_2012_2368 106
333 3300046692 Ga0495671_0000228 Ga0495671_0000228_14339_14662 106
334 3300046692 Ga0495671_0016932 Ga0495671_0016932_1775_2098 106
335 3300046692 Ga0495671_0605009 Ga0495671_0605009_83_406 106
336 3300046694 Ga0495649_0000326 Ga0495649_0000326_6434_6757 106
337 3300046694 Ga0495649_0037339 Ga0495649_0037339_1704_2027 106
338 3300046694 Ga0495649_0080501 Ga0495649_0080501_1161_1484 106
339 3300046694 Ga0495649_0229157 Ga0495649_0229157_24_347 106
340 3300046794 Ga0495589_0034475 Ga0495589_0034475_1504_1827 106
341 3300046794 Ga0495589_0136361 Ga0495589_0136361_145_468 106
342 3300046810 Ga0495660_0010226 Ga0495660_0010226_4117_4440 106
343 3300046810 Ga0495660_0025605 Ga0495660_0025605_2460_2783 106
344 3300046810 Ga0495660_0066180 Ga0495660_0066180_193_516 106
345 3300046810 Ga0495660_0085684 Ga0495660_0085684_122_445 106
346 3300046810 Ga0495660_0097575 Ga0495660_0097575_701_1033 106
347 3300046810 Ga0495660_0137477 Ga0495660_0137477_154_477 106
348 3300046810 Ga0495660_0317159 Ga0495660_0317159_210_533 106
349 3300047318 Ga0495636_0155408 Ga0495636_0155408_640_999 106
350 3300047320 Ga0495672_0000098 Ga0495672_0000098_98495_98818 106
351 3300047320 Ga0495672_0061653 Ga0495672_0061653_858_1181 106
352 3300047323 Ga0495683_0000247 Ga0495683_0000247_14740_15063 106
353 3300047323 Ga0495683_0046044 Ga0495683_0046044_402_725 106
354 3300047443 Ga0495687_080551 Ga0495687_080551_729_1052 106
355 3300047445 Ga0495677_0000268 Ga0495677_0000268_15104_15427 106
356 3300047445 Ga0495677_0001492 Ga0495677_0001492_3673_3996 106
357 3300047445 Ga0495677_0075870 Ga0495677_0075870_527_850 106
358 3300047445 Ga0495677_0104028 Ga0495677_0104028_124_447 106
359 3300047445 Ga0495677_0132591 Ga0495677_0132591_345_701 106
360 3300047445 Ga0495677_0214986 Ga0495677_0214986_193_516 106
361 3300047446 Ga0495679_000520 Ga0495679_000520_3431_3754 106
362 3300047446 Ga0495679_007855 Ga0495679_007855_3252_3575 106
363 3300047446 Ga0495679_063206 Ga0495679_063206_49_372 106
364 3300047446 Ga0495679_111285 Ga0495679_111285_273_596 106
365 3300047447 Ga0495685_012776 Ga0495685_012776_2157_2480 106
366 3300047447 Ga0495685_054939 Ga0495685_054939_990_1313 106
367 3300047447 Ga0495685_058342 Ga0495685_058342_460_783 106
368 3300047470 Ga0495681_0016978 Ga0495681_0016978_771_1094 106
369 3300047470 Ga0495681_0062414 Ga0495681_0062414_261_584 106
370 3300047470 Ga0495681_0103624 Ga0495681_0103624_518_841 106
371 3300047470 Ga0495681_0138067 Ga0495681_0138067_38_361 106
372 3300047472 Ga0495686_0000813 Ga0495686_0000813_8915_9238 106
373 3300047472 Ga0495686_0007060 Ga0495686_0007060_21_344 106
374 3300047472 Ga0495686_0017253 Ga0495686_0017253_831_1154 106
375 3300047472 Ga0495686_0376139 Ga0495686_0376139_154_477 106
376 3300047472 Ga0495686_0488353 Ga0495686_0488353_140_463 106
377 3300048091 Ga0495626_0003299 Ga0495626_0003299_2448_2771 106
378 3300048091 Ga0495626_0004535 Ga0495626_0004535_5999_6322 106
379 3300048091 Ga0495626_0019805 Ga0495626_0019805_1022_1345 106
380 3300048091 Ga0495626_0042991 Ga0495626_0042991_1474_1797 106
381 3300048091 Ga0495626_0061603 Ga0495626_0061603_932_1255 106
382 3300048904 Ga0496101_0002682 Ga0496101_0002682_6617_6952 106
383 3300048904 Ga0496101_0025630 Ga0496101_0025630_1086_1418 106
384 3300048905 Ga0496102_0000407 Ga0496102_0000407_31080_31403 106
385 3300048905 Ga0496102_0025490 Ga0496102_0025490_907_1242 106
386 3300048906 Ga0496103_0122708 Ga0496103_0122708_450_773 106
387 3300048908 Ga0496105_0084597 Ga0496105_0084597_1934_2257 106
388 3300048909 Ga0496106_0039279 Ga0496106_0039279_71_406 106
389 3300048912 Ga0496109_0252638 Ga0496109_0252638_134_469 106
390 3300048913 Ga0496110_0224486 Ga0496110_0224486_1262_1597 106
391 3300048914 Ga0496111_0072421 Ga0496111_0072421_93_428 106
392 3300048915 Ga0496112_0135663 Ga0496112_0135663_2022_2357 106
393 3300048916 Ga0496113_0012758 Ga0496113_0012758_3930_4265 106
394 3300048924 Ga0496121_0462392 Ga0496121_0462392_375_698 106
395 3300048925 Ga0496122_0112042 Ga0496122_0112042_917_1240 106
396 3300048926 Ga0496123_0407392 Ga0496123_0407392_55_378 106
397 3300048927 Ga0496124_0033985 Ga0496124_0033985_3293_3616 106
398 3300048927 Ga0496124_0217158 Ga0496124_0217158_821_1144 106
399 3300048927 Ga0496124_0298430 Ga0496124_0298430_17_340 106
400 3300049459 Ga0495678_000153 Ga0495678_000153_67354_67677 106
401 3300049459 Ga0495678_000284 Ga0495678_000284_46733_47056 106
402 3300049459 Ga0495678_020907 Ga0495678_020907_973_1296 106
403 3300049460 Ga0495682_0002286 Ga0495682_0002286_5809_6132 106
404 3300049460 Ga0495682_0007451 Ga0495682_0007451_3086_3409 106
405 3300049460 Ga0495682_0027231 Ga0495682_0027231_1084_1407 106
406 3300049460 Ga0495682_0034320 Ga0495682_0034320_412_735 106
407 3300049570 Ga0501033_0238880 Ga0501033_0238880_23_400 106
408 3300049571 Ga0501034_0009897 Ga0501034_0009897_4992_5315 106
409 3300049571 Ga0501034_0968967 Ga0501034_0968967_263_586 106
410 3300049571 Ga0501034_1324243 Ga0501034_1324243_28_357 106
411 3300049584 Ga0501068_0007734 Ga0501068_0007734_3475_3798 106
412 3300049589 Ga0501073_1279491 Ga0501073_1279491_77_400 106
413 3300049742 Ga0501080_1045195 Ga0501080_1045195_314_637 106
414 3300049760 Ga0501263_060746 Ga0501263_060746_24_347 106
415 3300049823 Ga0501044_0032280 Ga0501044_0032280_4972_5295 106
416 3300050492 nmdc:mga0yw44_348106_c1 nmdc:mga0yw44_348106_c1_79_441 106
417 3300050492 nmdc:mga0yw44_590020_c1 nmdc:mga0yw44_590020_c1_258_581 106
418 3300053085 Ga0495619_1186904 Ga0495619_1186904_30_353 106
419 3300053096 Ga0500641_0012466 Ga0500641_0012466_2062_2385 106
420 3300053134 Ga0500658_0001552 Ga0500658_0001552_2414_2737 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

14

64

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

16

63

0.94

PF12802

MarR_2

MarR family

17

69

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9588 17 73
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9572 5 78
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9324 6 92
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9292 17 72
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9275 6 93
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9705 14 71 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9594 5 79 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9588 17 73 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9528 10 72 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9471 5 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A196MV64-F1-model_v4 Transcriptional regulator 0.9813 6 101 GO:0003700
AF-A0A7C2FGD0-F1-model_v4 Transcriptional regulator 0.9813 5 87 GO:0003700
AF-A0A2Z3UHR9-F1-model_v4 Transcriptional regulator 0.981 5 103 GO:0003700
AF-A0A1G2IVA2-F1-model_v4 HTH arsR-type domain-containing protein 0.981 7 76 GO:0003700
AF-A0A1G7NPB0-F1-model_v4 Transcriptional regulator, ArsR family 0.9805 7 104 GO:0003700

Feature Viewer

pLDDT pTM Quality
92.2 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map