F439674

General Info

Members Datasets Scaffolds Average Seq Length
420 242 417 442

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100287431|Ga0070683_1002874311
Length 471
Sequence MLDVLRKNRSSEAEKADEELAGLIGSAAHVLTGAQSDYDPLIDLVGDSHFVLIGEASYGTQEFYQQRAEITKRLVTEKGFTAVAVEADWPDAYRINRYVRGVGDGDSALDALSGFERFPTWMWRNTVVLDFIRWLRAHNDSLGRGSSNTSSGDAMQKVGFYGLDLYSLYTSIQTVLTYLDKVDPEAAKRARYRYSCLEHFGEDTQAYGYTASFGLTKPCEEDVIGQLQDLQSKATDYSQRDGKVAEDEYFFAEQNARLVKNAEEYYRTMFGGRVSSWNLRDRHMVDTLDSLVTHLNRRGARTKAVVWAHNSHLGDARATYMGEQGEWNIGQLVRERHGRDATLLGFTTYAGTVTAASDWGEPAERKRVRPGLAGSYEALFHNASLASHKPNFLLPLRGSSIADSLRDERLERAIGVIYRPESERLSHYFEASLADQFDAIMHFDETQALQPLERTPRWETGEVPETYPTSL

Samples

Sample ID Description Type Environment
1 2831426010 Nostoc sp. 106C Isolate Unclassified
2 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
3 2849660919 Nostoc sp. T09 Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
147 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
220 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
221 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
222 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
223 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
231 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 1.43
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.48
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001388 3300003203 Bacteria 11429
2 rootH1_10011618 3300003316 Bacteria 4391
3 rootH2_10045810 3300003320 Bacteria 41005
4 rootL2_10022609 3300003322 Bacteria 5941
5 rootL2_10068702 3300003322 Bacteria 15259
6 rootH1_10018536 3300003323 Bacteria 10229
7 Ga0007416J51690_1000778 3300003577 Bacteria 5413
8 Ga0070658_10009310 3300005327 Bacteria 7899
9 Ga0070676_10051739 3300005328 Bacteria 2412
10 Ga0070683_100287431 3300005329 Bacteria 1564
11 Ga0070682_100039556 3300005337 Bacteria 2898
12 Ga0068868_100007054 3300005338 Bacteria 7986
13 Ga0070660_100017149 3300005339 Bacteria 5273
14 Ga0070660_100040097 3300005339 Bacteria 3562
15 Ga0070689_100001063 3300005340 Bacteria 17230
16 Ga0070691_10033854 3300005341 Bacteria 2404
17 Ga0070714_100007270 3300005435 Bacteria 8607
18 Ga0070714_100019932 3300005435 Bacteria 5472
19 Ga0070714_100211430 3300005435 Bacteria 1778
20 Ga0070705_100095678 3300005440 Bacteria 1863
21 Ga0070700_100020785 3300005441 Bacteria 3809
22 Ga0070694_100046127 3300005444 Bacteria 2924
23 Ga0070708_100094627 3300005445 Bacteria 2726
24 Ga0070708_100149563 3300005445 Bacteria 2171
25 Ga0070678_100116057 3300005456 Bacteria 2103
26 Ga0070681_10007340 3300005458 Bacteria 10769
27 Ga0070681_10007341 3300005458 Bacteria 10768
28 Ga0070681_10013537 3300005458 Bacteria 8111
29 Ga0070681_10146525 3300005458 Bacteria 2290
30 Ga0068867_100067826 3300005459 Bacteria 2661
31 Ga0070706_100045800 3300005467 Bacteria 4038
32 Ga0070706_100078449 3300005467 Unclassified 3058
33 Ga0070707_100000156 3300005468 Bacteria 66058
34 Ga0070707_100012686 3300005468 Bacteria 7870
35 Ga0070707_100317308 3300005468 Bacteria 1514
36 Ga0070698_100320436 3300005471 Bacteria 1481
37 Ga0070699_100036469 3300005518 Unclassified 4254
38 Ga0070699_100126025 3300005518 Bacteria 2254
39 Ga0070679_100028943 3300005530 Bacteria 5464
40 Ga0070679_100051922 3300005530 Bacteria 4084
41 Ga0070679_100052500 3300005530 Bacteria 4059
42 Ga0070679_100159504 3300005530 Bacteria 2230
43 Ga0070697_100019620 3300005536 Bacteria 5341
44 Ga0068853_100115550 3300005539 Bacteria 2388
45 Ga0070672_100000717 3300005543 Bacteria 19644
46 Ga0070696_100090420 3300005546 Bacteria 2178
47 Ga0070704_100052863 3300005549 Bacteria 2868
48 Ga0068855_100003170 3300005563 Bacteria 20133
49 Ga0068855_100015240 3300005563 Bacteria 9255
50 Ga0068855_100032897 3300005563 Bacteria 6191
51 Ga0068855_100269684 3300005563 Bacteria 1893
52 Ga0068857_100187523 3300005577 Bacteria 1883
53 Ga0068854_100050275 3300005578 Bacteria 2982
54 Ga0068856_100113828 3300005614 Bacteria 2704
55 Ga0070702_100001732 3300005615 Bacteria 9067
56 Ga0068852_100007066 3300005616 Bacteria 8176
57 Ga0068852_100064520 3300005616 Unclassified 3193
58 Ga0068859_100053817 3300005617 Bacteria 4048
59 Ga0068864_100000081 3300005618 Bacteria 101891
60 Ga0068861_100084263 3300005719 Bacteria 2495
61 Ga0068861_100246488 3300005719 Bacteria 1522
62 Ga0068858_100001725 3300005842 Bacteria 22341
63 Ga0068858_100009947 3300005842 Bacteria 9035
64 Ga0068858_100017308 3300005842 Bacteria 6761
65 Ga0068860_100004719 3300005843 Bacteria 13904
66 Ga0068860_100140462 3300005843 Bacteria 2321
67 Ga0068860_100276233 3300005843 Bacteria 1641
68 Ga0068862_100037633 3300005844 Bacteria 4101
69 Ga0070717_10090957 3300006028 Bacteria 2576
70 Ga0070712_100038607 3300006175 Bacteria 3264
71 Ga0097621_100044181 3300006237 Bacteria 3595
72 Ga0068871_100023868 3300006358 Bacteria 4738
73 Ga0075428_100026351 3300006844 Bacteria 6435
74 Ga0075430_100060974 3300006846 Bacteria 3170
75 Ga0075430_100063070 3300006846 Bacteria 3113
76 Ga0075431_100074040 3300006847 Bacteria 3514
77 Ga0075431_100119501 3300006847 Unclassified 2719
78 Ga0075434_100121165 3300006871 Bacteria 2631
79 Ga0075429_100001305 3300006880 Bacteria 20315
80 Ga0075429_100037258 3300006880 Bacteria 4234
81 Ga0075429_100097590 3300006880 Bacteria 2563
82 Ga0097620_100053817 3300006931 Bacteria 4048
83 Ga0105240_10025561 3300009093 Bacteria 7756
84 Ga0105240_10028474 3300009093 Bacteria 7297
85 Ga0105240_10032295 3300009093 Bacteria 6780
86 Ga0105240_10032389 3300009093 Bacteria 6768
87 Ga0111539_10043159 3300009094 Bacteria 5407
88 Ga0111539_10043911 3300009094 Bacteria 5357
89 Ga0111539_10047748 3300009094 Bacteria 5116
90 Ga0111539_10123213 3300009094 Bacteria 3038
91 Ga0105245_10003183 3300009098 Bacteria 14676
92 Ga0105245_10006420 3300009098 Bacteria 10351
93 Ga0105245_10010890 3300009098 Bacteria 7909
94 Ga0114129_10020219 3300009147 Bacteria 9473
95 Ga0114129_10080354 3300009147 Bacteria 4532
96 Ga0114129_10135789 3300009147 Bacteria 3375
97 Ga0114129_10289058 3300009147 Bacteria 2188
98 Ga0114129_10466268 3300009147 Bacteria 1655
99 Ga0105243_10027364 3300009148 Bacteria 4369
100 Ga0105241_10010671 3300009174 Bacteria 6738
101 Ga0105241_10145112 3300009174 Bacteria 1936
102 Ga0105242_10004965 3300009176 Bacteria 10291
103 Ga0105248_10020053 3300009177 Bacteria 7404
104 Ga0105237_10060524 3300009545 Bacteria 3788
105 Ga0105237_10104628 3300009545 Bacteria 2822
106 Ga0105238_10047219 3300009551 Bacteria 4344
107 Ga0105238_10084873 3300009551 Bacteria 3156
108 Ga0105238_10131686 3300009551 Bacteria 2479
109 Ga0105239_10028472 3300010375 Bacteria 6145
110 Ga0105239_10335800 3300010375 Bacteria 1705
111 Ga0157371_10032481 3300013102 Bacteria 3755
112 Ga0157370_10032110 3300013104 Bacteria 5130
113 Ga0157369_10014054 3300013105 Bacteria 9043
114 Ga0157369_10136622 3300013105 Bacteria 2595
115 Ga0157369_10319951 3300013105 Bacteria 1613
116 Ga0157374_10000679 3300013296 Bacteria 29982
117 Ga0163162_10014034 3300013306 Bacteria 7829
118 Ga0157372_10017744 3300013307 Bacteria 7640
119 Ga0157372_10029385 3300013307 Bacteria 6001
120 Ga0157372_10041384 3300013307 Bacteria 5095
121 Ga0157375_10000002 3300013308 Bacteria 495826
122 Ga0163163_10015787 3300014325 Bacteria 6994
123 Ga0163163_10044029 3300014325 Bacteria 4377
124 Ga0157380_10050630 3300014326 Bacteria 3282
125 Ga0157376_10062274 3300014969 Bacteria 3139
126 Ga0197907_11392416 3300020069 Bacteria 1720
127 Ga0206349_1283322 3300020075 Bacteria 3787
128 Ga0206349_1674501 3300020075 Bacteria 1683
129 Ga0206350_10166461 3300020080 Bacteria 1780
130 Ga0213876_10000137 3300021384 Bacteria 79910
131 Ga0213876_10000385 3300021384 Bacteria 37341
132 Ga0213875_10000061 3300021388 Bacteria 133623
133 Ga0213875_10008018 3300021388 Bacteria 5425
134 Ga0224712_10015269 3300022467 Bacteria 2495
135 Ga0207645_10002564 3300025907 Bacteria 14183
136 Ga0207705_10074156 3300025909 Bacteria 2470
137 Ga0207684_10090806 3300025910 Bacteria 2603
138 Ga0207654_10000749 3300025911 Bacteria 17977
139 Ga0207654_10026973 3300025911 Bacteria 3117
140 Ga0207707_10002302 3300025912 Bacteria 17210
141 Ga0207707_10011065 3300025912 Bacteria 7847
142 Ga0207707_10084409 3300025912 Unclassified 2774
143 Ga0207695_10007802 3300025913 Bacteria 13545
144 Ga0207695_10011113 3300025913 Bacteria 10930
145 Ga0207671_10126806 3300025914 Bacteria 1956
146 Ga0207657_10001842 3300025919 Bacteria 22914
147 Ga0207657_10033948 3300025919 Bacteria 4594
148 Ga0207649_10051871 3300025920 Bacteria 2542
149 Ga0207652_10034802 3300025921 Bacteria 4247
150 Ga0207646_10000251 3300025922 Bacteria 72761
151 Ga0207646_10076850 3300025922 Bacteria 2984
152 Ga0207646_10090110 3300025922 Bacteria 2745
153 Ga0207694_10047209 3300025924 Bacteria 3331
154 Ga0207650_10078228 3300025925 Bacteria 2502
155 Ga0207650_10147007 3300025925 Bacteria 1857
156 Ga0207687_10001245 3300025927 Bacteria 17433
157 Ga0207687_10004269 3300025927 Bacteria 9557
158 Ga0207664_10181516 3300025929 Bacteria 1807
159 Ga0207706_10000583 3300025933 Bacteria 38862
160 Ga0207706_10057603 3300025933 Bacteria 3423
161 Ga0207670_10000212 3300025936 Bacteria 38054
162 Ga0207691_10000235 3300025940 Bacteria 54039
163 Ga0207691_10028720 3300025940 Bacteria 5205
164 Ga0207711_10004012 3300025941 Bacteria 12638
165 Ga0207711_10139423 3300025941 Bacteria 2181
166 Ga0207689_10276087 3300025942 Bacteria 1391
167 Ga0207679_10012380 3300025945 Bacteria 5563
168 Ga0207679_10062945 3300025945 Bacteria 2767
169 Ga0207667_10024376 3300025949 Bacteria 6643
170 Ga0207640_10118556 3300025981 Bacteria 1891
171 Ga0207677_10018977 3300026023 Bacteria 4142
172 Ga0207703_10000258 3300026035 Bacteria 59679
173 Ga0207639_10089128 3300026041 Bacteria 2464
174 Ga0207708_10002973 3300026075 Bacteria 12494
175 Ga0207702_10054134 3300026078 Bacteria 3399
176 Ga0207702_10119449 3300026078 Bacteria 2357
177 Ga0207648_10019664 3300026089 Bacteria 6095
178 Ga0207648_10077110 3300026089 Bacteria 2905
179 Ga0207676_10000020 3300026095 Bacteria 301541
180 Ga0207675_100011005 3300026118 Bacteria 8474
181 Ga0207698_10088165 3300026142 Bacteria 2530
182 Ga0207698_10093915 3300026142 Bacteria 2464
183 Ga0207428_10058080 3300027907 Bacteria 3071
184 Ga0268265_10096480 3300028380 Bacteria 2376
185 Ga0268264_10004805 3300028381 Bacteria 11460
186 Ga0268264_10244719 3300028381 Bacteria 1663
187 Ga0307513_10000010 3300031456 Bacteria 360812
188 Ga0307408_100023537 3300031548 Bacteria 4197
189 Ga0307408_100038265 3300031548 Bacteria 3383
190 Ga0265313_10008887 3300031595 Bacteria 6607
191 Ga0307405_10147912 3300031731 Bacteria 1648
192 Ga0307413_10004314 3300031824 Bacteria 6170
193 Ga0307413_10012030 3300031824 Bacteria 4288
194 Ga0307410_10000835 3300031852 Bacteria 13093
195 Ga0307410_10088487 3300031852 Bacteria 2193
196 Ga0307410_10089528 3300031852 Bacteria 2181
197 Ga0307410_10095192 3300031852 Bacteria 2123
198 Ga0307406_10031628 3300031901 Bacteria 3224
199 Ga0307406_10043321 3300031901 Bacteria 2814
200 Ga0307412_10029234 3300031911 Unclassified 3458
201 Ga0307409_100000085 3300031995 Bacteria 33599
202 Ga0307409_100110756 3300031995 Bacteria 2302
203 Ga0307409_100165076 3300031995 Bacteria 1942
204 Ga0307416_100001971 3300032002 Bacteria 11511
205 Ga0307416_100005196 3300032002 Bacteria 7958
206 Ga0307416_100021194 3300032002 Bacteria 4660
207 Ga0307416_100073712 3300032002 Bacteria 2848
208 Ga0307416_100107007 3300032002 Bacteria 2453
209 Ga0307416_100147352 3300032002 Bacteria 2152
210 Ga0307416_100281047 3300032002 Bacteria 1641
211 Ga0307416_100336270 3300032002 Bacteria 1520
212 Ga0307414_10017710 3300032004 Bacteria 4366
213 Ga0307414_10058165 3300032004 Bacteria 2722
214 Ga0307411_10016480 3300032005 Bacteria 4184
215 Ga0307411_10016876 3300032005 Bacteria 4142
216 Ga0307411_10217107 3300032005 Bacteria 1481
217 Ga0307415_100000604 3300032126 Bacteria 15695
218 Ga0307415_100005283 3300032126 Bacteria 6839
219 Ga0307415_100008344 3300032126 Bacteria 5732
220 Ga0307415_100017173 3300032126 Bacteria 4332
221 Ga0307415_100147970 3300032126 Bacteria 1804
222 Ga0373934_0004848 3300035086 Bacteria 4981
223 Ga0373956_0015225 3300035119 Unclassified 3218
224 Ga0373955_0001929 3300035172 Bacteria 8951
225 Ga0373955_0003138 3300035172 Bacteria 7231
226 Ga0373933_0000423 3300035724 Bacteria 26670
227 Ga0373937_0000125 3300036401 Bacteria 73819
228 Ga0373937_0018182 3300036401 Bacteria 6273
229 Ga0373925_0012906 3300037068 Bacteria 6050
230 Ga0395899_0000127 3300037312 Bacteria 119435
231 Ga0395899_0002226 3300037312 Bacteria 15895
232 Ga0395900_0008029 3300037418 Bacteria 10862
233 Ga0395900_0008408 3300037418 Bacteria 10619
234 Ga0395900_0023488 3300037418 Bacteria 6310
235 Ga0395900_0161625 3300037418 Bacteria 2284
236 Ga0395898_0033248 3300037466 Bacteria 5148
237 Ga0395898_0155808 3300037466 Bacteria 2185
238 Ga0395905_0000395 3300037471 Bacteria 61787
239 Ga0395905_0033456 3300037471 Unclassified 4829
240 Ga0395905_0092874 3300037471 Bacteria 2830
241 Ga0395905_0124974 3300037471 Bacteria 2419
242 Ga0395905_0293783 3300037471 Bacteria 1512
243 Ga0395905_0317983 3300037471 Bacteria 1446
244 Ga0436364_0490455 3300037853 Bacteria 45285
245 Ga0436364_1449597 3300037853 Bacteria 171227
246 Ga0395901_0001270 3300038443 Bacteria 26753
247 Ga0395901_0043924 3300038443 Bacteria 4635
248 Ga0395901_0045279 3300038443 Bacteria 4565
249 Ga0436365_0453322 3300039437 Bacteria 114543
250 Ga0436365_0928267 3300039437 Bacteria 13852
251 Ga0436365_1885657 3300039437 Bacteria 103056
252 Ga0450890_002579 3300042127 Bacteria 2476
253 Ga0450897_001191 3300042128 Bacteria 1711
254 Ga0439446_0011744 3300042156 Bacteria 2383
255 Ga0453683_0009739 3300044673 Bacteria 6405
256 Ga0466966_0038249 3300044684 Bacteria 3092
257 Ga0451576_0000109 3300045051 Bacteria 210549
258 Ga0451576_0002619 3300045051 Bacteria 26328
259 Ga0466967_0008906 3300045976 Bacteria 7405
260 Ga0495617_000052 3300046452 Bacteria 104195
261 Ga0495603_0001853 3300046455 Bacteria 12470
262 Ga0495590_0001174 3300046457 Bacteria 11467
263 Ga0495591_006691 3300046458 Bacteria 5035
264 Ga0495638_0002074 3300046460 Bacteria 17022
265 Ga0495651_0001221 3300046462 Bacteria 19849
266 Ga0495653_0019595 3300046463 Bacteria 5486
267 Ga0495580_0082404 3300046472 Bacteria 2242
268 Ga0495580_0163522 3300046472 Bacteria 1540
269 Ga0495582_0008994 3300046473 Bacteria 5512
270 Ga0495582_0038866 3300046473 Bacteria 2619
271 Ga0495584_0000021 3300046491 Bacteria 130377
272 Ga0495584_0000271 3300046491 Bacteria 36789
273 Ga0495584_0011951 3300046491 Bacteria 4439
274 Ga0495584_0017894 3300046491 Bacteria 3605
275 Ga0495585_0000005 3300046492 Bacteria 328103
276 Ga0495585_0000049 3300046492 Bacteria 119546
277 Ga0495585_0000465 3300046492 Bacteria 38766
278 Ga0495585_0000608 3300046492 Bacteria 33524
279 Ga0495585_0001368 3300046492 Bacteria 19305
280 Ga0495585_0006347 3300046492 Bacteria 7342
281 Ga0495585_0007535 3300046492 Bacteria 6657
282 Ga0495585_0010567 3300046492 Bacteria 5491
283 Ga0495585_0044380 3300046492 Bacteria 2483
284 Ga0495585_0095723 3300046492 Bacteria 1594
285 Ga0495594_0000622 3300046499 Bacteria 18245
286 Ga0495594_0027106 3300046499 Bacteria 3086
287 Ga0495594_0065722 3300046499 Bacteria 2011
288 Ga0495596_0000013 3300046500 Bacteria 125228
289 Ga0495583_0000189 3300046506 Bacteria 103518
290 Ga0495606_0002184 3300046507 Bacteria 23486
291 Ga0495616_0000646 3300046513 Bacteria 25901
292 Ga0495616_0012439 3300046513 Bacteria 4832
293 Ga0495616_0074174 3300046513 Bacteria 1640
294 Ga0495620_0001423 3300046515 Bacteria 14354
295 Ga0495630_0008312 3300046517 Bacteria 7451
296 Ga0495631_0011735 3300046518 Bacteria 4299
297 Ga0495643_0038358 3300046522 Bacteria 2624
298 Ga0495644_0042819 3300046523 Bacteria 1705
299 Ga0495648_0000033 3300046524 Bacteria 199184
300 Ga0495666_0003229 3300046526 Bacteria 8212
301 Ga0495666_0013468 3300046526 Bacteria 4079
302 Ga0495642_0002909 3300046528 Bacteria 6824
303 Ga0495642_0006722 3300046528 Bacteria 4408
304 Ga0495642_0012263 3300046528 Bacteria 3303
305 Ga0495652_0018624 3300046529 Bacteria 6187
306 Ga0495586_0056057 3300046535 Bacteria 2136
307 Ga0495587_0000691 3300046536 Bacteria 22630
308 Ga0495587_0069283 3300046536 Unclassified 2054
309 Ga0495609_0011762 3300046538 Bacteria 4161
310 Ga0495609_0018551 3300046538 Bacteria 3223
311 Ga0495621_0002362 3300046539 Bacteria 5075
312 Ga0495597_0000199 3300046542 Bacteria 55011
313 Ga0495597_0015635 3300046542 Bacteria 3591
314 Ga0495597_0062988 3300046542 Bacteria 1612
315 Ga0495622_0006305 3300046557 Bacteria 5508
316 Ga0495633_0000893 3300046558 Bacteria 25507
317 Ga0495633_0006093 3300046558 Bacteria 7223
318 Ga0495633_0006324 3300046558 Bacteria 7049
319 Ga0495633_0037026 3300046558 Bacteria 2336
320 Ga0495668_0001839 3300046616 Bacteria 19134
321 Ga0495634_0006587 3300046642 Bacteria 8809
322 Ga0495625_0035445 3300046660 Bacteria 3678
323 Ga0495661_0000430 3300046665 Bacteria 44306
324 Ga0495661_0006847 3300046665 Bacteria 7979
325 Ga0495661_0023314 3300046665 Bacteria 4018
326 Ga0495588_0006444 3300046674 Bacteria 5286
327 Ga0495623_0004800 3300046679 Bacteria 8878
328 Ga0495670_0000693 3300046691 Bacteria 16033
329 Ga0495670_0003319 3300046691 Bacteria 7933
330 Ga0495670_0003883 3300046691 Bacteria 7342
331 Ga0495670_0005862 3300046691 Bacteria 6022
332 Ga0495670_0028884 3300046691 Bacteria 2750
333 Ga0495670_0099834 3300046691 Bacteria 1494
334 Ga0495589_0000628 3300046794 Bacteria 23234
335 Ga0495660_0009570 3300046810 Bacteria 5650
336 Ga0495581_0028051 3300047315 Bacteria 3263
337 Ga0495581_0160862 3300047315 Bacteria 1312
338 Ga0495604_0008021 3300047317 Bacteria 8367
339 Ga0495604_0008511 3300047317 Bacteria 8101
340 Ga0495636_0000198 3300047318 Bacteria 23610
341 Ga0495676_0014446 3300047321 Bacteria 7064
342 Ga0495676_0026247 3300047321 Bacteria 5017
343 Ga0495676_0114977 3300047321 Bacteria 1968
344 Ga0495680_0135907 3300047322 Bacteria 1803
345 Ga0495683_0000072 3300047323 Bacteria 104027
346 Ga0495675_0000660 3300047444 Bacteria 21758
347 Ga0495675_0018142 3300047444 Bacteria 4463
348 Ga0495677_0002346 3300047445 Bacteria 7444
349 Ga0495677_0014391 3300047445 Bacteria 2880
350 Ga0495681_0006169 3300047470 Bacteria 7914
351 Ga0495681_0027674 3300047470 Bacteria 2928
352 Ga0495681_0029648 3300047470 Bacteria 2798
353 Ga0495593_0005307 3300047673 Bacteria 7615
354 Ga0495602_0000402 3300048088 Bacteria 40515
355 Ga0495602_0003261 3300048088 Bacteria 16756
356 Ga0495626_0000004 3300048091 Bacteria 356599
357 Ga0495626_0012156 3300048091 Bacteria 4526
358 Ga0495626_0032114 3300048091 Bacteria 2523
359 Ga0496115_0001043 3300048918 Bacteria 20116
360 Ga0496115_0017255 3300048918 Bacteria 5513
361 Ga0501292_005215 3300049515 Bacteria 1805
362 Ga0501031_0123015 3300049568 Bacteria 1694
363 Ga0501031_0224923 3300049568 Bacteria 1222
364 Ga0501034_0000245 3300049571 Bacteria 100221
365 Ga0501034_0000457 3300049571 Bacteria 67431
366 Ga0501037_0000669 3300049573 Bacteria 26272
367 Ga0501038_0000578 3300049574 Bacteria 32467
368 Ga0501038_0156227 3300049574 Bacteria 1857
369 Ga0501043_0000848 3300049579 Bacteria 27095
370 Ga0501043_0066226 3300049579 Bacteria 2837
371 Ga0501043_0191325 3300049579 Bacteria 1591
372 Ga0501046_0000130 3300049580 Bacteria 80649
373 Ga0501048_0002649 3300049582 Bacteria 13678
374 Ga0501067_0021666 3300049583 Bacteria 3556
375 Ga0501073_0097259 3300049589 Bacteria 2045
376 Ga0501075_0074305 3300049591 Bacteria 2571
377 Ga0501076_0110027 3300049592 Bacteria 2227
378 Ga0501202_008098 3300049652 Bacteria 1910
379 Ga0501233_012629 3300049668 Bacteria 1699
380 Ga0501235_019886 3300049669 Bacteria 1490
381 Ga0501239_002832 3300049672 Bacteria 1610
382 Ga0501247_001769 3300049677 Bacteria 2155
383 Ga0501249_002575 3300049679 Bacteria 3653
384 Ga0501257_006850 3300049686 Bacteria 2537
385 Ga0501257_010685 3300049686 Bacteria 2088
386 Ga0501225_0023511 3300049705 Bacteria 1698
387 Ga0501234_006474 3300049707 Bacteria 1832
388 Ga0501080_0023279 3300049742 Bacteria 5743
389 Ga0501083_0000030 3300049744 Bacteria 107273
390 Ga0501262_003400 3300049759 Bacteria 1823
391 Ga0501268_000251 3300049765 Bacteria 5419
392 Ga0501268_006629 3300049765 Bacteria 1707
393 Ga0501035_0108309 3300049822 Bacteria 2436
394 Ga0501035_0169741 3300049822 Bacteria 1885
395 Ga0501044_0013043 3300049823 Bacteria 8992
396 Ga0501044_0032410 3300049823 Bacteria 5494
397 Ga0501044_0044689 3300049823 Bacteria 4595
398 nmdc:mga05p37_1001_c1 3300050507 Bacteria 32203
399 nmdc:mga05p37_41299_c1 3300050507 Bacteria 5663
400 nmdc:mga05p37_94792_c1 3300050507 Bacteria 3677
401 nmdc:mga09592_208209_c1 3300050508 Bacteria 1694
402 nmdc:mga09592_27091_c1 3300050508 Bacteria 4754
403 nmdc:mga09592_6097_c1 3300050508 Bacteria 9821
404 nmdc:mga09592_90211_c1 3300050508 Bacteria 2618
405 nmdc:mga0qj67_1415_c1 3300050509 Bacteria 16784
406 nmdc:mga0qj67_74859_c1 3300050509 Bacteria 2705
407 nmdc:mga06r32_24527_c1 3300050510 Bacteria 5600
408 nmdc:mga08y16_50438_c1 3300050511 Bacteria 4355
409 nmdc:mga08y16_52235_c1 3300050511 Bacteria 4276
410 nmdc:mga08y16_75220_c1 3300050511 Bacteria 3521
411 nmdc:mga08y16_80675_c1 3300050511 Bacteria 3392
412 nmdc:mga0a205_52421_c1 3300050515 Bacteria 3937
413 Ga0500645_006689 3300053730 Bacteria 4088
414 Ga0501084_0072091 3300054114 Bacteria 2893
415 Ga0590071_000827 3300059421 Bacteria 8634
416 Ga0590071_003563 3300059421 Bacteria 3825
417 Ga0590071_009059 3300059421 Bacteria 2340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10078228 Ga0207650_100782281 342
2 3300003322 rootL2_10022609 rootL2_100226095 351
3 3300006846 Ga0075430_100060974 Ga0075430_1000609742 357
4 3300006847 Ga0075431_100119501 Ga0075431_1001195012 357
5 3300025941 Ga0207711_10139423 Ga0207711_101394232 372
6 3300006844 Ga0075428_100026351 Ga0075428_1000263516 373
7 3300006846 Ga0075430_100063070 Ga0075430_1000630704 373
8 3300006847 Ga0075431_100074040 Ga0075431_1000740403 373
9 3300006880 Ga0075429_100001305 Ga0075429_10000130517 373
10 3300050507 nmdc:mga05p37_41299_c1 nmdc:mga05p37_41299_c1_3379_4542 373
11 3300050508 nmdc:mga09592_6097_c1 nmdc:mga09592_6097_c1_1119_2282 373
12 3300050509 nmdc:mga0qj67_1415_c1 nmdc:mga0qj67_1415_c1_1935_3098 373
13 3300050510 nmdc:mga06r32_24527_c1 nmdc:mga06r32_24527_c1_3566_4729 373
14 3300049568 Ga0501031_0224923 Ga0501031_0224923_55_1206 375
15 3300025942 Ga0207689_10276087 Ga0207689_102760871 377
16 3300047315 Ga0495581_0160862 Ga0495581_0160862_72_1298 400
17 3300046472 Ga0495580_0082404 Ga0495580_0082404_932_2185 404
18 3300046513 Ga0495616_0012439 Ga0495616_0012439_1210_2448 405
19 3300025921 Ga0207652_10034802 Ga0207652_100348022 407
20 3300042128 Ga0450897_001191 Ga0450897_001191_42_1292 408
21 3300049592 Ga0501076_0110027 Ga0501076_0110027_121_1377 408
22 3300003316 rootH1_10011618 rootH1_100116185 409
23 3300005435 Ga0070714_100007270 Ga0070714_1000072704 409
24 3300005549 Ga0070704_100052863 Ga0070704_1000528633 409
25 3300005617 Ga0068859_100053817 Ga0068859_1000538173 409
26 3300005843 Ga0068860_100140462 Ga0068860_1001404622 409
27 3300006931 Ga0097620_100053817 Ga0097620_1000538173 409
28 3300028381 Ga0268264_10244719 Ga0268264_102447192 409
29 3300031995 Ga0307409_100165076 Ga0307409_1001650763 409
30 3300050507 nmdc:mga05p37_1001_c1 nmdc:mga05p37_1001_c1_25944_27197 409
31 3300010375 Ga0105239_10335800 Ga0105239_103358002 410
32 3300009093 Ga0105240_10032295 Ga0105240_100322957 411
33 3300005458 Ga0070681_10007340 Ga0070681_100073406 412
34 3300005616 Ga0068852_100064520 Ga0068852_1000645203 412
35 3300025911 Ga0207654_10026973 Ga0207654_100269732 412
36 3300025912 Ga0207707_10002302 Ga0207707_100023022 412
37 3300026142 Ga0207698_10093915 Ga0207698_100939151 412
38 3300003323 rootH1_10018536 rootH1_100185366 413
39 3300005842 Ga0068858_100017308 Ga0068858_1000173082 413
40 3300048091 Ga0495626_0000004 Ga0495626_0000004_76277_77644 414
41 3300046691 Ga0495670_0099834 Ga0495670_0099834_95_1387 419
42 3300003320 rootH2_10045810 rootH2_100458105 420
43 3300003322 rootL2_10068702 rootL2_1006870212 420
44 3300037068 Ga0373925_0012906 Ga0373925_0012906_3837_5147 420
45 3300046463 Ga0495653_0019595 Ga0495653_0019595_1053_2378 421
46 3300046473 Ga0495582_0008994 Ga0495582_0008994_2917_4242 421
47 3300046499 Ga0495594_0065722 Ga0495594_0065722_613_1938 421
48 3300046517 Ga0495630_0008312 Ga0495630_0008312_5735_7060 421
49 3300046526 Ga0495666_0003229 Ga0495666_0003229_6247_7572 421
50 3300046529 Ga0495652_0018624 Ga0495652_0018624_781_2106 421
51 3300046642 Ga0495634_0006587 Ga0495634_0006587_5344_6669 421
52 3300046679 Ga0495623_0004800 Ga0495623_0004800_1716_3041 421
53 3300047317 Ga0495604_0008511 Ga0495604_0008511_3861_5186 421
54 3300047322 Ga0495680_0135907 Ga0495680_0135907_148_1473 421
55 3300047444 Ga0495675_0018142 Ga0495675_0018142_834_2159 421
56 3300020080 Ga0206350_10166461 Ga0206350_101664611 422
57 3300037471 Ga0395905_0317983 Ga0395905_0317983_33_1367 422
58 3300046539 Ga0495621_0002362 Ga0495621_0002362_3371_4663 422
59 3300048088 Ga0495602_0003261 Ga0495602_0003261_4593_5927 422
60 3300049759 Ga0501262_003400 Ga0501262_003400_173_1480 422
61 3300032126 Ga0307415_100147970 Ga0307415_1001479702 424
62 3300021384 Ga0213876_10000385 Ga0213876_1000038518 425
63 3300025945 Ga0207679_10012380 Ga0207679_100123802 425
64 3300039437 Ga0436365_1885657 Ga0436365_1885657_58744_60096 425
65 3300048918 Ga0496115_0017255 Ga0496115_0017255_2532_3872 425
66 3300037418 Ga0395900_0008408 Ga0395900_0008408_1161_2483 426
67 3300037466 Ga0395898_0155808 Ga0395898_0155808_241_1563 426
68 3300037471 Ga0395905_0293783 Ga0395905_0293783_118_1440 426
69 3300038443 Ga0395901_0001270 Ga0395901_0001270_24043_25365 426
70 3300005467 Ga0070706_100078449 Ga0070706_1000784493 427
71 3300005536 Ga0070697_100019620 Ga0070697_1000196204 427
72 3300006871 Ga0075434_100121165 Ga0075434_1001211653 427
73 3300009147 Ga0114129_10020219 Ga0114129_100202195 427
74 3300025910 Ga0207684_10090806 Ga0207684_100908063 427
75 3300049579 Ga0501043_0000848 Ga0501043_0000848_4178_5548 427
76 3300049580 Ga0501046_0000130 Ga0501046_0000130_506_1876 427
77 3300049582 Ga0501048_0002649 Ga0501048_0002649_10700_12070 427
78 3300049744 Ga0501083_0000030 Ga0501083_0000030_9071_10441 427
79 3300049823 Ga0501044_0013043 Ga0501044_0013043_2095_3465 427
80 3300050507 nmdc:mga05p37_94792_c1 nmdc:mga05p37_94792_c1_1156_2463 427
81 3300050515 nmdc:mga0a205_52421_c1 nmdc:mga0a205_52421_c1_1355_2662 427
82 3300054114 Ga0501084_0072091 Ga0501084_0072091_962_2332 427
83 3300005435 Ga0070714_100211430 Ga0070714_1002114301 428
84 3300005719 Ga0068861_100246488 Ga0068861_1002464882 428
85 3300006028 Ga0070717_10090957 Ga0070717_100909572 428
86 3300025929 Ga0207664_10181516 Ga0207664_101815162 428
87 3300025933 Ga0207706_10000583 Ga0207706_1000058329 428
88 3300026089 Ga0207648_10077110 Ga0207648_100771102 428
89 3300046535 Ga0495586_0056057 Ga0495586_0056057_568_1911 428
90 3300046558 Ga0495633_0006324 Ga0495633_0006324_3165_4487 428
91 3300046665 Ga0495661_0000430 Ga0495661_0000430_18269_19591 428
92 3300046691 Ga0495670_0003883 Ga0495670_0003883_2829_4151 428
93 3300047315 Ga0495581_0028051 Ga0495581_0028051_1871_3214 428
94 3300047445 Ga0495677_0002346 Ga0495677_0002346_3578_4900 428
95 3300047470 Ga0495681_0006169 Ga0495681_0006169_2539_3861 428
96 3300005340 Ga0070689_100001063 Ga0070689_1000010633 429
97 3300005467 Ga0070706_100045800 Ga0070706_1000458005 429
98 3300005468 Ga0070707_100012686 Ga0070707_1000126865 429
99 3300005543 Ga0070672_100000717 Ga0070672_1000007179 429
100 3300005618 Ga0068864_100000081 Ga0068864_1000000812 429
101 3300005842 Ga0068858_100001725 Ga0068858_10000172520 429
102 3300009098 Ga0105245_10003183 Ga0105245_100031837 429
103 3300013308 Ga0157375_10000002 Ga0157375_10000002175 429
104 3300014326 Ga0157380_10050630 Ga0157380_100506303 429
105 3300025922 Ga0207646_10090110 Ga0207646_100901102 429
106 3300025927 Ga0207687_10001245 Ga0207687_100012459 429
107 3300025936 Ga0207670_10000212 Ga0207670_1000021216 429
108 3300025940 Ga0207691_10000235 Ga0207691_1000023533 429
109 3300026035 Ga0207703_10000258 Ga0207703_1000025839 429
110 3300026095 Ga0207676_10000020 Ga0207676_100000202 429
111 3300003577 Ga0007416J51690_1000778 Ga0007416J51690_10007785 430
112 3300009147 Ga0114129_10080354 Ga0114129_100803543 430
113 3300021388 Ga0213875_10008018 Ga0213875_100080182 430
114 3300022467 Ga0224712_10015269 Ga0224712_100152693 430
115 3300035119 Ga0373956_0015225 Ga0373956_0015225_1202_2533 430
116 3300035172 Ga0373955_0003138 Ga0373955_0003138_2674_4005 430
117 3300035724 Ga0373933_0000423 Ga0373933_0000423_20575_21906 430
118 3300036401 Ga0373937_0000125 Ga0373937_0000125_43858_45189 430
119 3300037471 Ga0395905_0124974 Ga0395905_0124974_889_2217 430
120 3300037853 Ga0436364_0490455 Ga0436364_0490455_40090_41421 430
121 3300039437 Ga0436365_0928267 Ga0436365_0928267_1054_2388 430
122 3300042127 Ga0450890_002579 Ga0450890_002579_20_1336 430
123 3300046462 Ga0495651_0001221 Ga0495651_0001221_13768_15099 430
124 3300046536 Ga0495587_0000691 Ga0495587_0000691_5028_6359 430
125 3300046536 Ga0495587_0069283 Ga0495587_0069283_567_1898 430
126 3300047317 Ga0495604_0008021 Ga0495604_0008021_4986_6317 430
127 3300047444 Ga0495675_0000660 Ga0495675_0000660_14397_15728 430
128 3300048088 Ga0495602_0000402 Ga0495602_0000402_33777_35108 430
129 3300049571 Ga0501034_0000245 Ga0501034_0000245_27922_29277 430
130 3300049823 Ga0501044_0032410 Ga0501044_0032410_15_1388 430
131 3300049823 Ga0501044_0044689 Ga0501044_0044689_3081_4451 430
132 3300059421 Ga0590071_003563 Ga0590071_003563_787_2118 430
133 3300005539 Ga0068853_100115550 Ga0068853_1001155502 431
134 3300006880 Ga0075429_100037258 Ga0075429_1000372582 431
135 3300009545 Ga0105237_10104628 Ga0105237_101046282 431
136 3300031824 Ga0307413_10004314 Ga0307413_100043144 431
137 3300046457 Ga0495590_0001174 Ga0495590_0001174_2651_3994 431
138 3300046458 Ga0495591_006691 Ga0495591_006691_3157_4485 431
139 3300046542 Ga0495597_0000199 Ga0495597_0000199_14024_15355 431
140 3300046660 Ga0495625_0035445 Ga0495625_0035445_474_1802 431
141 3300046674 Ga0495588_0006444 Ga0495588_0006444_491_1831 431
142 3300046794 Ga0495589_0000628 Ga0495589_0000628_4252_5583 431
143 3300046810 Ga0495660_0009570 Ga0495660_0009570_2402_3730 431
144 3300050508 nmdc:mga09592_208209_c1 nmdc:mga09592_208209_c1_215_1552 431
145 3300059421 Ga0590071_000827 Ga0590071_000827_7243_8574 431
146 3300005337 Ga0070682_100039556 Ga0070682_1000395562 432
147 3300005338 Ga0068868_100007054 Ga0068868_1000070544 432
148 3300005563 Ga0068855_100003170 Ga0068855_10000317020 432
149 3300005614 Ga0068856_100113828 Ga0068856_1001138283 432
150 3300009093 Ga0105240_10025561 Ga0105240_100255614 432
151 3300009098 Ga0105245_10010890 Ga0105245_100108904 432
152 3300009174 Ga0105241_10010671 Ga0105241_100106712 432
153 3300009177 Ga0105248_10020053 Ga0105248_100200533 432
154 3300009551 Ga0105238_10131686 Ga0105238_101316862 432
155 3300010375 Ga0105239_10028472 Ga0105239_100284722 432
156 3300013105 Ga0157369_10136622 Ga0157369_101366221 432
157 3300013296 Ga0157374_10000679 Ga0157374_1000067922 432
158 3300013307 Ga0157372_10017744 Ga0157372_100177444 432
159 3300013307 Ga0157372_10041384 Ga0157372_100413843 432
160 3300025911 Ga0207654_10000749 Ga0207654_1000074911 432
161 3300025913 Ga0207695_10011113 Ga0207695_100111134 432
162 3300025927 Ga0207687_10004269 Ga0207687_100042695 432
163 3300025933 Ga0207706_10057603 Ga0207706_100576033 432
164 3300025941 Ga0207711_10004012 Ga0207711_1000401211 432
165 3300025945 Ga0207679_10062945 Ga0207679_100629451 432
166 3300025949 Ga0207667_10024376 Ga0207667_100243762 432
167 3300026023 Ga0207677_10018977 Ga0207677_100189774 432
168 3300026041 Ga0207639_10089128 Ga0207639_100891282 432
169 3300026078 Ga0207702_10119449 Ga0207702_101194492 432
170 3300031852 Ga0307410_10000835 Ga0307410_100008355 432
171 3300031995 Ga0307409_100000085 Ga0307409_10000008529 432
172 3300032002 Ga0307416_100001971 Ga0307416_1000019713 432
173 3300032004 Ga0307414_10017710 Ga0307414_100177103 432
174 3300032005 Ga0307411_10016876 Ga0307411_100168764 432
175 3300032126 Ga0307415_100000604 Ga0307415_10000060413 432
176 3300037312 Ga0395899_0002226 Ga0395899_0002226_6716_8101 432
177 3300037418 Ga0395900_0008029 Ga0395900_0008029_1871_3205 432
178 3300037418 Ga0395900_0023488 Ga0395900_0023488_1228_2613 432
179 3300037418 Ga0395900_0161625 Ga0395900_0161625_551_1885 432
180 3300037466 Ga0395898_0033248 Ga0395898_0033248_2879_4213 432
181 3300037471 Ga0395905_0000395 Ga0395905_0000395_17667_19019 432
182 3300037471 Ga0395905_0092874 Ga0395905_0092874_1283_2617 432
183 3300038443 Ga0395901_0043924 Ga0395901_0043924_1283_2617 432
184 3300038443 Ga0395901_0045279 Ga0395901_0045279_1080_2414 432
185 3300044684 Ga0466966_0038249 Ga0466966_0038249_1217_2551 432
186 3300049765 Ga0501268_006629 Ga0501268_006629_328_1653 432
187 iso_pu_bacteria 2849660919 2849667926 432
188 3300005445 Ga0070708_100094627 Ga0070708_1000946272 433
189 3300005468 Ga0070707_100000156 Ga0070707_1000001566 433
190 3300005518 Ga0070699_100126025 Ga0070699_1001260251 433
191 3300006880 Ga0075429_100097590 Ga0075429_1000975902 433
192 3300009147 Ga0114129_10289058 Ga0114129_102890582 433
193 3300009147 Ga0114129_10466268 Ga0114129_104662682 433
194 3300025922 Ga0207646_10000251 Ga0207646_100002519 433
195 3300037312 Ga0395899_0000127 Ga0395899_0000127_77659_78996 433
196 3300046452 Ga0495617_000052 Ga0495617_000052_5650_6984 433
197 3300046460 Ga0495638_0002074 Ga0495638_0002074_7795_9129 433
198 3300046491 Ga0495584_0000021 Ga0495584_0000021_38357_39691 433
199 3300046491 Ga0495584_0000271 Ga0495584_0000271_24642_25976 433
200 3300046491 Ga0495584_0017894 Ga0495584_0017894_2242_3576 433
201 3300046492 Ga0495585_0000005 Ga0495585_0000005_207421_208755 433
202 3300046492 Ga0495585_0000049 Ga0495585_0000049_88944_90278 433
203 3300046492 Ga0495585_0000465 Ga0495585_0000465_14102_15436 433
204 3300046492 Ga0495585_0001368 Ga0495585_0001368_12769_14103 433
205 3300046492 Ga0495585_0007535 Ga0495585_0007535_418_1752 433
206 3300046492 Ga0495585_0010567 Ga0495585_0010567_1852_3186 433
207 3300046492 Ga0495585_0044380 Ga0495585_0044380_759_2093 433
208 3300046500 Ga0495596_0000013 Ga0495596_0000013_63021_64355 433
209 3300046506 Ga0495583_0000189 Ga0495583_0000189_79910_81244 433
210 3300046513 Ga0495616_0000646 Ga0495616_0000646_14789_16123 433
211 3300046513 Ga0495616_0074174 Ga0495616_0074174_243_1577 433
212 3300046515 Ga0495620_0001423 Ga0495620_0001423_6336_7670 433
213 3300046523 Ga0495644_0042819 Ga0495644_0042819_147_1481 433
214 3300046524 Ga0495648_0000033 Ga0495648_0000033_78506_79840 433
215 3300046528 Ga0495642_0002909 Ga0495642_0002909_4170_5504 433
216 3300046538 Ga0495609_0011762 Ga0495609_0011762_746_2080 433
217 3300046538 Ga0495609_0018551 Ga0495609_0018551_1645_2979 433
218 3300046558 Ga0495633_0000893 Ga0495633_0000893_4325_5659 433
219 3300046558 Ga0495633_0006093 Ga0495633_0006093_1652_2986 433
220 3300046616 Ga0495668_0001839 Ga0495668_0001839_9250_10584 433
221 3300046665 Ga0495661_0006847 Ga0495661_0006847_251_1585 433
222 3300046691 Ga0495670_0000693 Ga0495670_0000693_10176_11510 433
223 3300046691 Ga0495670_0003319 Ga0495670_0003319_790_2124 433
224 3300046691 Ga0495670_0005862 Ga0495670_0005862_558_1892 433
225 3300046691 Ga0495670_0028884 Ga0495670_0028884_356_1690 433
226 3300047323 Ga0495683_0000072 Ga0495683_0000072_13846_15180 433
227 3300047445 Ga0495677_0014391 Ga0495677_0014391_1374_2708 433
228 3300047470 Ga0495681_0027674 Ga0495681_0027674_222_1556 433
229 3300047470 Ga0495681_0029648 Ga0495681_0029648_418_1752 433
230 3300049571 Ga0501034_0000457 Ga0501034_0000457_31097_32455 433
231 3300049573 Ga0501037_0000669 Ga0501037_0000669_5330_6688 433
232 3300049574 Ga0501038_0000578 Ga0501038_0000578_2752_4110 433
233 3300049574 Ga0501038_0156227 Ga0501038_0156227_181_1530 433
234 3300049579 Ga0501043_0066226 Ga0501043_0066226_1005_2363 433
235 3300049579 Ga0501043_0191325 Ga0501043_0191325_64_1413 433
236 3300049742 Ga0501080_0023279 Ga0501080_0023279_1152_2501 433
237 3300049822 Ga0501035_0108309 Ga0501035_0108309_743_2092 433
238 3300050508 nmdc:mga09592_27091_c1 nmdc:mga09592_27091_c1_2740_4077 433
239 3300005445 Ga0070708_100149563 Ga0070708_1001495632 434
240 3300005458 Ga0070681_10007341 Ga0070681_100073412 434
241 3300005468 Ga0070707_100317308 Ga0070707_1003173081 434
242 3300009094 Ga0111539_10043911 Ga0111539_100439114 434
243 3300021388 Ga0213875_10000061 Ga0213875_1000006182 434
244 3300031456 Ga0307513_10000010 Ga0307513_10000010195 434
245 3300031548 Ga0307408_100023537 Ga0307408_1000235373 434
246 3300031824 Ga0307413_10012030 Ga0307413_100120306 434
247 3300031901 Ga0307406_10031628 Ga0307406_100316284 434
248 3300032002 Ga0307416_100005196 Ga0307416_1000051967 434
249 3300032002 Ga0307416_100021194 Ga0307416_1000211944 434
250 3300032002 Ga0307416_100073712 Ga0307416_1000737122 434
251 3300032002 Ga0307416_100281047 Ga0307416_1002810472 434
252 3300032004 Ga0307414_10058165 Ga0307414_100581652 434
253 3300032126 Ga0307415_100008344 Ga0307415_1000083443 434
254 3300032126 Ga0307415_100017173 Ga0307415_1000171731 434
255 3300037853 Ga0436364_1449597 Ga0436364_1449597_63997_65391 434
256 3300044673 Ga0453683_0009739 Ga0453683_0009739_3416_4759 434
257 3300045051 Ga0451576_0000109 Ga0451576_0000109_197101_198444 434
258 3300045051 Ga0451576_0002619 Ga0451576_0002619_12869_14212 434
259 3300045976 Ga0466967_0008906 Ga0466967_0008906_2464_3813 434
260 3300046455 Ga0495603_0001853 Ga0495603_0001853_5492_6832 434
261 3300046472 Ga0495580_0163522 Ga0495580_0163522_142_1485 434
262 3300046473 Ga0495582_0038866 Ga0495582_0038866_1113_2453 434
263 3300046491 Ga0495584_0011951 Ga0495584_0011951_270_1610 434
264 3300046492 Ga0495585_0000608 Ga0495585_0000608_17956_19293 434
265 3300046492 Ga0495585_0006347 Ga0495585_0006347_2982_4322 434
266 3300046492 Ga0495585_0095723 Ga0495585_0095723_29_1366 434
267 3300046499 Ga0495594_0000622 Ga0495594_0000622_5818_7158 434
268 3300046499 Ga0495594_0027106 Ga0495594_0027106_405_1745 434
269 3300046518 Ga0495631_0011735 Ga0495631_0011735_2796_4133 434
270 3300046522 Ga0495643_0038358 Ga0495643_0038358_763_2100 434
271 3300046526 Ga0495666_0013468 Ga0495666_0013468_1055_2395 434
272 3300046542 Ga0495597_0015635 Ga0495597_0015635_1109_2449 434
273 3300046542 Ga0495597_0062988 Ga0495597_0062988_133_1473 434
274 3300046557 Ga0495622_0006305 Ga0495622_0006305_1317_2657 434
275 3300046558 Ga0495633_0037026 Ga0495633_0037026_48_1388 434
276 3300047318 Ga0495636_0000198 Ga0495636_0000198_1385_2725 434
277 3300047321 Ga0495676_0014446 Ga0495676_0014446_5597_6934 434
278 3300047321 Ga0495676_0026247 Ga0495676_0026247_1000_2340 434
279 3300047321 Ga0495676_0114977 Ga0495676_0114977_414_1751 434
280 3300047673 Ga0495593_0005307 Ga0495593_0005307_1657_2997 434
281 3300048091 Ga0495626_0012156 Ga0495626_0012156_3127_4464 434
282 3300048091 Ga0495626_0032114 Ga0495626_0032114_1050_2390 434
283 3300049515 Ga0501292_005215 Ga0501292_005215_321_1664 434
284 3300049583 Ga0501067_0021666 Ga0501067_0021666_963_2306 434
285 3300049652 Ga0501202_008098 Ga0501202_008098_125_1495 434
286 3300049668 Ga0501233_012629 Ga0501233_012629_143_1486 434
287 3300049669 Ga0501235_019886 Ga0501235_019886_113_1456 434
288 3300049672 Ga0501239_002832 Ga0501239_002832_11_1354 434
289 3300049677 Ga0501247_001769 Ga0501247_001769_640_2010 434
290 3300049679 Ga0501249_002575 Ga0501249_002575_1121_2491 434
291 3300049686 Ga0501257_010685 Ga0501257_010685_543_1892 434
292 3300049705 Ga0501225_0023511 Ga0501225_0023511_97_1467 434
293 3300049707 Ga0501234_006474 Ga0501234_006474_472_1815 434
294 3300049765 Ga0501268_000251 Ga0501268_000251_2925_4268 434
295 3300049822 Ga0501035_0169741 Ga0501035_0169741_223_1572 434
296 3300050508 nmdc:mga09592_90211_c1 nmdc:mga09592_90211_c1_114_1460 434
297 3300050509 nmdc:mga0qj67_74859_c1 nmdc:mga0qj67_74859_c1_336_1682 434
298 3300050511 nmdc:mga08y16_80675_c1 nmdc:mga08y16_80675_c1_1729_3072 434
299 3300053730 Ga0500645_006689 Ga0500645_006689_1019_2374 434
300 iso_pu_bacteria 2831426010 2831426172 434
301 iso_pu_bacteria 2848694841 2848700897 434
302 3300005444 Ga0070694_100046127 Ga0070694_1000461272 435
303 3300005458 Ga0070681_10146525 Ga0070681_101465252 435
304 3300005530 Ga0070679_100051922 Ga0070679_1000519224 435
305 3300005563 Ga0068855_100015240 Ga0068855_1000152409 435
306 3300005563 Ga0068855_100032897 Ga0068855_1000328973 435
307 3300005842 Ga0068858_100009947 Ga0068858_1000099475 435
308 3300005843 Ga0068860_100004719 Ga0068860_1000047199 435
309 3300006237 Ga0097621_100044181 Ga0097621_1000441812 435
310 3300006358 Ga0068871_100023868 Ga0068871_1000238685 435
311 3300009093 Ga0105240_10028474 Ga0105240_100284744 435
312 3300009093 Ga0105240_10032389 Ga0105240_100323895 435
313 3300009098 Ga0105245_10006420 Ga0105245_100064204 435
314 3300009147 Ga0114129_10135789 Ga0114129_101357893 435
315 3300009174 Ga0105241_10145112 Ga0105241_101451121 435
316 3300009176 Ga0105242_10004965 Ga0105242_100049652 435
317 3300009545 Ga0105237_10060524 Ga0105237_100605244 435
318 3300009551 Ga0105238_10084873 Ga0105238_100848733 435
319 3300013104 Ga0157370_10032110 Ga0157370_100321102 435
320 3300013105 Ga0157369_10014054 Ga0157369_100140543 435
321 3300013306 Ga0163162_10014034 Ga0163162_100140343 435
322 3300013307 Ga0157372_10029385 Ga0157372_100293852 435
323 3300014325 Ga0163163_10015787 Ga0163163_100157872 435
324 3300014325 Ga0163163_10044029 Ga0163163_100440296 435
325 3300014969 Ga0157376_10062274 Ga0157376_100622741 435
326 3300021384 Ga0213876_10000137 Ga0213876_1000013746 435
327 3300025912 Ga0207707_10084409 Ga0207707_100844093 435
328 3300025913 Ga0207695_10007802 Ga0207695_1000780219 435
329 3300025914 Ga0207671_10126806 Ga0207671_101268062 435
330 3300025925 Ga0207650_10147007 Ga0207650_101470072 435
331 3300026078 Ga0207702_10054134 Ga0207702_100541341 435
332 3300028381 Ga0268264_10004805 Ga0268264_100048053 435
333 3300031595 Ga0265313_10008887 Ga0265313_100088872 435
334 3300031731 Ga0307405_10147912 Ga0307405_101479122 435
335 3300031852 Ga0307410_10095192 Ga0307410_100951922 435
336 3300031901 Ga0307406_10043321 Ga0307406_100433212 435
337 3300031911 Ga0307412_10029234 Ga0307412_100292344 435
338 3300031995 Ga0307409_100110756 Ga0307409_1001107562 435
339 3300032002 Ga0307416_100147352 Ga0307416_1001473521 435
340 3300032005 Ga0307411_10016480 Ga0307411_100164801 435
341 3300032005 Ga0307411_10217107 Ga0307411_102171071 435
342 3300032126 Ga0307415_100005283 Ga0307415_1000052832 435
343 3300035086 Ga0373934_0004848 Ga0373934_0004848_540_1886 435
344 3300035172 Ga0373955_0001929 Ga0373955_0001929_7132_8478 435
345 3300036401 Ga0373937_0018182 Ga0373937_0018182_2115_3461 435
346 3300037471 Ga0395905_0033456 Ga0395905_0033456_3088_4431 435
347 3300039437 Ga0436365_0453322 Ga0436365_0453322_63110_64462 435
348 3300046507 Ga0495606_0002184 Ga0495606_0002184_6421_7764 435
349 3300046528 Ga0495642_0006722 Ga0495642_0006722_2971_4314 435
350 3300046528 Ga0495642_0012263 Ga0495642_0012263_1106_2449 435
351 3300046665 Ga0495661_0023314 Ga0495661_0023314_122_1465 435
352 3300048918 Ga0496115_0001043 Ga0496115_0001043_3686_5029 435
353 3300049568 Ga0501031_0123015 Ga0501031_0123015_95_1459 435
354 3300049589 Ga0501073_0097259 Ga0501073_0097259_660_2018 435
355 3300049686 Ga0501257_006850 Ga0501257_006850_632_1972 435
356 3300059421 Ga0590071_009059 Ga0590071_009059_909_2273 435
357 3300005458 Ga0070681_10013537 Ga0070681_100135373 436
358 3300005518 Ga0070699_100036469 Ga0070699_1000364692 436
359 3300006175 Ga0070712_100038607 Ga0070712_1000386075 436
360 3300020075 Ga0206349_1283322 Ga0206349_12833224 436
361 3300025912 Ga0207707_10011065 Ga0207707_100110653 436
362 3300049591 Ga0501075_0074305 Ga0501075_0074305_962_2317 436
363 3300005329 Ga0070683_100287431 Ga0070683_1002874311 437
364 3300005339 Ga0070660_100040097 Ga0070660_1000400973 437
365 3300005435 Ga0070714_100019932 Ga0070714_1000199323 437
366 3300005530 Ga0070679_100028943 Ga0070679_1000289432 437
367 3300005530 Ga0070679_100159504 Ga0070679_1001595042 437
368 3300005563 Ga0068855_100269684 Ga0068855_1002696842 437
369 3300005577 Ga0068857_100187523 Ga0068857_1001875231 437
370 3300005616 Ga0068852_100007066 Ga0068852_1000070665 437
371 3300005844 Ga0068862_100037633 Ga0068862_1000376332 437
372 3300013102 Ga0157371_10032481 Ga0157371_100324813 437
373 3300013105 Ga0157369_10319951 Ga0157369_103199511 437
374 3300020069 Ga0197907_11392416 Ga0197907_113924162 437
375 3300020075 Ga0206349_1674501 Ga0206349_16745012 437
376 3300025919 Ga0207657_10033948 Ga0207657_100339483 437
377 3300025920 Ga0207649_10051871 Ga0207649_100518712 437
378 3300026142 Ga0207698_10088165 Ga0207698_100881652 437
379 3300028380 Ga0268265_10096480 Ga0268265_100964804 437
380 3300032002 Ga0307416_100336270 Ga0307416_1003362701 437
381 3300005456 Ga0070678_100116057 Ga0070678_1001160572 438
382 3300005459 Ga0068867_100067826 Ga0068867_1000678261 438
383 3300005843 Ga0068860_100276233 Ga0068860_1002762332 438
384 3300025940 Ga0207691_10028720 Ga0207691_100287205 438
385 3300005328 Ga0070676_10051739 Ga0070676_100517392 440
386 3300005341 Ga0070691_10033854 Ga0070691_100338542 440
387 3300005440 Ga0070705_100095678 Ga0070705_1000956782 440
388 3300005441 Ga0070700_100020785 Ga0070700_1000207852 440
389 3300005471 Ga0070698_100320436 Ga0070698_1003204361 440
390 3300005546 Ga0070696_100090420 Ga0070696_1000904202 440
391 3300005578 Ga0068854_100050275 Ga0068854_1000502752 440
392 3300005615 Ga0070702_100001732 Ga0070702_1000017325 440
393 3300005719 Ga0068861_100084263 Ga0068861_1000842632 440
394 3300009094 Ga0111539_10123213 Ga0111539_101232133 440
395 3300009148 Ga0105243_10027364 Ga0105243_100273643 440
396 3300025907 Ga0207645_10002564 Ga0207645_100025645 440
397 3300025922 Ga0207646_10076850 Ga0207646_100768502 440
398 3300025981 Ga0207640_10118556 Ga0207640_101185561 440
399 3300026075 Ga0207708_10002973 Ga0207708_100029737 440
400 3300026089 Ga0207648_10019664 Ga0207648_100196642 440
401 3300026118 Ga0207675_100011005 Ga0207675_1000110055 440
402 3300027907 Ga0207428_10058080 Ga0207428_100580803 440
403 3300031548 Ga0307408_100038265 Ga0307408_1000382652 440
404 3300031852 Ga0307410_10089528 Ga0307410_100895282 440
405 3300042156 Ga0439446_0011744 Ga0439446_0011744_452_1777 440
406 3300050511 nmdc:mga08y16_75220_c1 nmdc:mga08y16_75220_c1_662_1987 440
407 3300003203 JGI25406J46586_10001388 JGI25406J46586_100013887 441
408 3300005327 Ga0070658_10009310 Ga0070658_100093104 441
409 3300005339 Ga0070660_100017149 Ga0070660_1000171496 441
410 3300005530 Ga0070679_100052500 Ga0070679_1000525005 441
411 3300009094 Ga0111539_10043159 Ga0111539_100431592 441
412 3300009094 Ga0111539_10047748 Ga0111539_100477483 441
413 3300009551 Ga0105238_10047219 Ga0105238_100472193 441
414 3300025909 Ga0207705_10074156 Ga0207705_100741561 441
415 3300025919 Ga0207657_10001842 Ga0207657_1000184215 441
416 3300025924 Ga0207694_10047209 Ga0207694_100472093 441
417 3300031852 Ga0307410_10088487 Ga0307410_100884872 441
418 3300032002 Ga0307416_100107007 Ga0307416_1001070071 441
419 3300050511 nmdc:mga08y16_50438_c1 nmdc:mga08y16_50438_c1_1805_3133 441
420 3300050511 nmdc:mga08y16_52235_c1 nmdc:mga08y16_52235_c1_2578_3903 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05139

Erythro_esteras

Erythromycin esterase

75

446

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgm-assembly1.cif.gz_A crystal structure of succinoglycan biosynthesis protein at the resolution 1.7 a. northeast structural genomics consortium target bcr136. 0.872 1 420
2qgm-assembly1.cif.gz_A crystal structure of succinoglycan biosynthesis protein at the resolution 1.7 a. northeast structural genomics consortium target bcr136. 0.8575 1 420
2rad-assembly2.cif.gz_B crystal structure of the succinoglycan biosynthesis protein. northeast structural genomics consortium target bcr135 0.845 1 420
2rad-assembly2.cif.gz_B crystal structure of the succinoglycan biosynthesis protein. northeast structural genomics consortium target bcr135 0.8392 1 420
6xcq-assembly1.cif.gz_A erythromycin esterase erec, mutant h289n in its closed conformation 0.7159 14 416
ID Description Score Start End Superfamily
2radA01 Alpha Beta;3-Layer(aba) Sandwich;EreA/ChaN-like;EreA-like (biosynthetic domain) 0.7728 257 423 3.40.1660.10
2qgmA01 Alpha Beta;3-Layer(aba) Sandwich;EreA/ChaN-like;EreA-like (biosynthetic domain) 0.7584 258 418 3.40.1660.10
af_O43760_20_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6255 141 243 1.20.140.150
af_O55101_20_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6083 138 243 1.20.140.150
af_O54980_20_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6073 138 243 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A4Q5Z908-F1-model_v4 deleted 0.9851 3 327
AF-A0A431L0Y4-F1-model_v4 Erythromycin esterase family protein 0.9828 1 427 GO:0046677
AF-A0A6M3HUX6-F1-model_v4 Erythromycin esterase family protein 0.9804 2 424 GO:0046677
AF-A0A7W1LDD5-F1-model_v4 Erythromycin esterase family protein 0.978 3 241 GO:0046677
AF-A0A2V5UG26-F1-model_v4 Erythromycin esterase 0.9776 5 395 GO:0046677

Feature Viewer

pLDDT pTM Quality
89.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map