F439638

General Info

Members Datasets Scaffolds Average Seq Length
419 275 838 120

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_013876|Ga0590075_013876_996_1391
Length 131
Sequence MKYMLLVYHNEQAFEALGEAVHAAMLKESIRLACDVASPGQYLAAPLQPTSSATCIRVRDEKPLVTDGPYAETHEQLAGYFLIEAKNLDEAISIAVRVPGARIGTIEIRPIRDVPGLPTASHDRVTAGISN

Samples

Sample ID Description Type Environment
1 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
181 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
182 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
183 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
184 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
185 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
188 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
189 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
190 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
191 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
206 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
209 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
210 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
211 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
218 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
219 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
220 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
221 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
224 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
225 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
226 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
227 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
228 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
229 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
230 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
233 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
237 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
240 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
241 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
242 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
243 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
244 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
245 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
246 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
247 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
248 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
249 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
250 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
255 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
256 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
257 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
272 2831426010 Nostoc sp. 106C Isolate Unclassified
273 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
274 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
275 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.18
Metatranscriptomes 1.91
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590075_013876 3300059424 Bacteria 1968
2 Ga0065715_10270471 3300005293 Bacteria 1112
3 Ga0065715_10371411 3300005293 Bacteria 914
4 Ga0065707_10123015 3300005295 Bacteria 2072
5 Ga0070683_100100763 3300005329 Bacteria 2719
6 Ga0070683_100288050 3300005329 Bacteria 1562
7 Ga0070683_102053660 3300005329 Bacteria 549
8 Ga0070670_100015188 3300005331 Bacteria 6610
9 Ga0068869_100119219 3300005334 Bacteria 2016
10 Ga0068869_101118549 3300005334 Bacteria 690
11 Ga0070666_10067559 3300005335 Bacteria 2427
12 Ga0070666_10705872 3300005335 Unclassified 740
13 Ga0070680_100229407 3300005336 Bacteria 1568
14 Ga0070689_100008072 3300005340 Bacteria 7394
15 Ga0070689_100036501 3300005340 Bacteria 3759
16 Ga0070689_100038614 3300005340 Bacteria 3654
17 Ga0070689_100391232 3300005340 Bacteria 1173
18 Ga0070687_100016220 3300005343 Bacteria 3391
19 Ga0070661_100367301 3300005344 Bacteria 1132
20 Ga0070692_10049751 3300005345 Bacteria 2175
21 Ga0070692_10157070 3300005345 Bacteria 1300
22 Ga0070669_100031286 3300005353 Bacteria 3845
23 Ga0070675_100000648 3300005354 Bacteria 24051
24 Ga0070675_101242019 3300005354 Bacteria 686
25 Ga0070671_100001320 3300005355 Bacteria 18645
26 Ga0070674_101867430 3300005356 Unclassified 545
27 Ga0070673_100102188 3300005364 Bacteria 2363
28 Ga0070688_100256301 3300005365 Unclassified 1248
29 Ga0070703_10095475 3300005406 Unclassified 1039
30 Ga0070713_101153096 3300005436 Bacteria 750
31 Ga0070701_10120498 3300005438 Bacteria 1478
32 Ga0070705_100044674 3300005440 Bacteria 2546
33 Ga0070705_100379644 3300005440 Unclassified 1040
34 Ga0070705_100383091 3300005440 Bacteria 1035
35 Ga0070700_100248287 3300005441 Bacteria 1275
36 Ga0070694_100297673 3300005444 Bacteria 1235
37 Ga0070694_100453928 3300005444 Bacteria 1012
38 Ga0070708_100080395 3300005445 Unclassified 2950
39 Ga0070708_101295933 3300005445 Unclassified 681
40 Ga0070662_101101526 3300005457 Unclassified 681
41 Ga0070662_101228459 3300005457 Unclassified 644
42 Ga0070681_10388248 3300005458 Bacteria 1307
43 Ga0070681_11019479 3300005458 Bacteria 748
44 Ga0070681_11208679 3300005458 Bacteria 678
45 Ga0070685_10132849 3300005466 Bacteria 1558
46 Ga0070706_100017949 3300005467 Bacteria 6528
47 Ga0070707_100555953 3300005468 Bacteria 1110
48 Ga0070707_100994332 3300005468 Bacteria 804
49 Ga0070698_100002121 3300005471 Bacteria 22039
50 Ga0070698_100033965 3300005471 Bacteria 5283
51 Ga0070698_100136843 3300005471 Bacteria 2403
52 Ga0070698_100493719 3300005471 Bacteria 1162
53 Ga0070699_100544925 3300005518 Unclassified 1056
54 Ga0070699_101257794 3300005518 Bacteria 679
55 Ga0070679_100633809 3300005530 Bacteria 1012
56 Ga0070684_100206036 3300005535 Bacteria 1792
57 Ga0070684_100610598 3300005535 Bacteria 1014
58 Ga0070684_100623476 3300005535 Bacteria 1003
59 Ga0070697_100000331 3300005536 Bacteria 37194
60 Ga0068853_100690637 3300005539 Bacteria 973
61 Ga0070672_100024691 3300005543 Bacteria 4446
62 Ga0070672_100689419 3300005543 Bacteria 894
63 Ga0070686_100002331 3300005544 Bacteria 10472
64 Ga0070686_100084195 3300005544 Bacteria 2112
65 Ga0070695_100121746 3300005545 Unclassified 1786
66 Ga0070696_100830058 3300005546 Unclassified 762
67 Ga0070704_100095807 3300005549 Bacteria 2223
68 Ga0070704_100100189 3300005549 Bacteria 2181
69 Ga0070704_100850422 3300005549 Unclassified 818
70 Ga0070704_100954363 3300005549 Unclassified 774
71 Ga0070664_100038990 3300005564 Bacteria 4001
72 Ga0070664_100884568 3300005564 Bacteria 837
73 Ga0070664_101874354 3300005564 Bacteria 569
74 Ga0068857_100107739 3300005577 Unclassified 2503
75 Ga0068859_100000439 3300005617 Bacteria 41794
76 Ga0068859_100024375 3300005617 Bacteria 6069
77 Ga0068859_100105617 3300005617 Unclassified 2875
78 Ga0068859_100304633 3300005617 Bacteria 1687
79 Ga0068859_101258854 3300005617 Bacteria 815
80 Ga0068864_100051895 3300005618 Unclassified 3534
81 Ga0068864_100069468 3300005618 Bacteria 3063
82 Ga0068864_100156785 3300005618 Bacteria 2067
83 Ga0068864_100169417 3300005618 Unclassified 1990
84 Ga0068864_100323396 3300005618 Bacteria 1449
85 Ga0068870_10556448 3300005840 Unclassified 773
86 Ga0068870_10972403 3300005840 Unclassified 604
87 Ga0068863_100242142 3300005841 Bacteria 1741
88 Ga0068863_100293149 3300005841 Bacteria 1577
89 Ga0068858_100041593 3300005842 Bacteria 4261
90 Ga0068858_100427466 3300005842 Bacteria 1274
91 Ga0068860_100418267 3300005843 Bacteria 1328
92 Ga0068860_100477607 3300005843 Bacteria 1242
93 Ga0068862_100247072 3300005844 Bacteria 1625
94 Ga0068862_100248835 3300005844 Bacteria 1619
95 Ga0068862_101115020 3300005844 Unclassified 785
96 Ga0081539_10262215 3300005985 Bacteria 761
97 Ga0070717_10202275 3300006028 Bacteria 1740
98 Ga0070717_11062820 3300006028 Unclassified 737
99 Ga0097621_100009709 3300006237 Bacteria 7000
100 Ga0075428_101026639 3300006844 Unclassified 872
101 Ga0075430_100099914 3300006846 Bacteria 2423
102 Ga0075431_100055181 3300006847 Bacteria 4098
103 Ga0075431_100103161 3300006847 Bacteria 2944
104 Ga0075431_100199992 3300006847 Bacteria 2044
105 Ga0075433_10078466 3300006852 Unclassified 2909
106 Ga0075433_10128703 3300006852 Bacteria 2249
107 Ga0075433_10268606 3300006852 Bacteria 1512
108 Ga0075434_100214212 3300006871 Bacteria 1946
109 Ga0075434_100234981 3300006871 Bacteria 1853
110 Ga0075434_100468278 3300006871 Unclassified 1281
111 Ga0075434_100785153 3300006871 Unclassified 969
112 Ga0075429_101101728 3300006880 Unclassified 693
113 Ga0075429_101342647 3300006880 Unclassified 623
114 Ga0097620_100000439 3300006931 Bacteria 41794
115 Ga0097620_100024374 3300006931 Bacteria 6069
116 Ga0097620_100105618 3300006931 Unclassified 2875
117 Ga0097620_100304654 3300006931 Bacteria 1687
118 Ga0097620_101258836 3300006931 Bacteria 815
119 Ga0075435_100204593 3300007076 Bacteria 1673
120 Ga0075435_101254796 3300007076 Unclassified 649
121 Ga0099794_10064117 3300007265 Bacteria 1790
122 Ga0105240_10110614 3300009093 Bacteria 3325
123 Ga0105240_12043806 3300009093 Bacteria 595
124 Ga0111539_10128293 3300009094 Bacteria 2971
125 Ga0111539_10538604 3300009094 Bacteria 1360
126 Ga0105245_10224271 3300009098 Bacteria 1815
127 Ga0105247_10029915 3300009101 Bacteria 3302
128 Ga0114129_10005584 3300009147 Bacteria 17793
129 Ga0114129_10098553 3300009147 Bacteria 4046
130 Ga0114129_10139879 3300009147 Bacteria 3319
131 Ga0114129_10199589 3300009147 Bacteria 2710
132 Ga0114129_11202148 3300009147 Unclassified 944
133 Ga0114129_11774753 3300009147 Bacteria 751
134 Ga0114129_12796854 3300009147 Bacteria 580
135 Ga0114129_13454095 3300009147 Bacteria 506
136 Ga0105243_10762427 3300009148 Bacteria 950
137 Ga0105243_11360927 3300009148 Bacteria 729
138 Ga0105241_10374994 3300009174 Unclassified 1242
139 Ga0105242_10754788 3300009176 Bacteria 958
140 Ga0105242_10924558 3300009176 Unclassified 874
141 Ga0105242_12886937 3300009176 Unclassified 531
142 Ga0105248_10159569 3300009177 Unclassified 2544
143 Ga0105237_10000005 3300009545 Bacteria 390765
144 Ga0105238_10558888 3300009551 Bacteria 1149
145 Ga0105238_11036447 3300009551 Unclassified 842
146 Ga0105249_10174940 3300009553 Bacteria 2084
147 Ga0105249_10724741 3300009553 Bacteria 1056
148 Ga0105249_10833668 3300009553 Bacteria 987
149 Ga0105239_10629642 3300010375 Bacteria 1224
150 Ga0157373_10506495 3300013100 Bacteria 872
151 Ga0157378_10740691 3300013297 Bacteria 1005
152 Ga0157378_11122118 3300013297 Unclassified 824
153 Ga0157375_10541620 3300013308 Bacteria 1326
154 Ga0163163_10002047 3300014325 Bacteria 17019
155 Ga0163163_10329664 3300014325 Bacteria 1581
156 Ga0163163_10379993 3300014325 Bacteria 1470
157 Ga0163163_10552405 3300014325 Bacteria 1214
158 Ga0163163_10692767 3300014325 Bacteria 1082
159 Ga0163163_13110442 3300014325 Unclassified 517
160 Ga0157377_10217198 3300014745 Bacteria 1222
161 Ga0157379_10281070 3300014968 Bacteria 1515
162 Ga0182005_1075346 3300015265 Unclassified 929
163 Ga0197907_10459753 3300020069 Bacteria 954
164 Ga0197907_10959956 3300020069 Bacteria 1320
165 Ga0206350_10404858 3300020080 Bacteria 2419
166 Ga0206350_11051144 3300020080 Bacteria 2787
167 Ga0213876_10116505 3300021384 Bacteria 1418
168 Ga0224712_10238495 3300022467 Bacteria 837
169 Ga0224712_10312538 3300022467 Bacteria 737
170 Ga0224712_10612851 3300022467 Bacteria 532
171 Ga0207697_10212403 3300025315 Bacteria 853
172 Ga0207653_10000197 3300025885 Bacteria 41065
173 Ga0207653_10068948 3300025885 Unclassified 1206
174 Ga0207653_10102008 3300025885 Bacteria 1016
175 Ga0207642_10939094 3300025899 Unclassified 555
176 Ga0207680_10128048 3300025903 Bacteria 1670
177 Ga0207643_10248818 3300025908 Bacteria 1094
178 Ga0207684_10010747 3300025910 Bacteria 8036
179 Ga0207654_10324538 3300025911 Bacteria 1053
180 Ga0207707_10091443 3300025912 Bacteria 2659
181 Ga0207671_10000004 3300025914 Bacteria 1022356
182 Ga0207660_10500839 3300025917 Bacteria 985
183 Ga0207662_10077219 3300025918 Bacteria 2025
184 Ga0207649_10354498 3300025920 Bacteria 1087
185 Ga0207646_10901159 3300025922 Unclassified 784
186 Ga0207681_10016567 3300025923 Bacteria 4612
187 Ga0207694_10834589 3300025924 Unclassified 779
188 Ga0207650_10000780 3300025925 Bacteria 24540
189 Ga0207650_10320419 3300025925 Unclassified 1269
190 Ga0207659_10006645 3300025926 Bacteria 7103
191 Ga0207706_10096131 3300025933 Bacteria 2605
192 Ga0207706_10918617 3300025933 Unclassified 739
193 Ga0207670_10374121 3300025936 Bacteria 1133
194 Ga0207670_10757135 3300025936 Bacteria 807
195 Ga0207691_10007979 3300025940 Bacteria 10185
196 Ga0207691_10577756 3300025940 Bacteria 952
197 Ga0207711_10262856 3300025941 Bacteria 1586
198 Ga0207689_10010960 3300025942 Bacteria 7793
199 Ga0207689_10480856 3300025942 Bacteria 1040
200 Ga0207689_11052657 3300025942 Unclassified 686
201 Ga0207661_10163772 3300025944 Bacteria 1931
202 Ga0207679_10017660 3300025945 Bacteria 4763
203 Ga0207679_10100973 3300025945 Bacteria 2256
204 Ga0207651_10072954 3300025960 Bacteria 2439
205 Ga0207651_10079654 3300025960 Bacteria 2354
206 Ga0207651_10240166 3300025960 Bacteria 1476
207 Ga0207640_11127751 3300025981 Bacteria 695
208 Ga0207658_10141441 3300025986 Bacteria 1948
209 Ga0207703_10213657 3300026035 Bacteria 1721
210 Ga0207703_10694936 3300026035 Bacteria 967
211 Ga0207708_10065592 3300026075 Bacteria 2775
212 Ga0207641_10113715 3300026088 Bacteria 2404
213 Ga0207641_10615217 3300026088 Unclassified 1065
214 Ga0207641_12041342 3300026088 Bacteria 574
215 Ga0207676_10067807 3300026095 Bacteria 2851
216 Ga0207676_10192030 3300026095 Bacteria 1798
217 Ga0207676_10396423 3300026095 Bacteria 1289
218 Ga0207676_10506129 3300026095 Bacteria 1147
219 Ga0207676_10544844 3300026095 Bacteria 1108
220 Ga0207674_10427047 3300026116 Bacteria 1281
221 Ga0207674_10564430 3300026116 Unclassified 1099
222 Ga0207674_11125181 3300026116 Bacteria 755
223 Ga0209967_1000707 3300027364 Bacteria 4306
224 Ga0209981_1010457 3300027378 Bacteria 1272
225 Ga0209995_1019871 3300027471 Bacteria 1110
226 Ga0209982_1031373 3300027552 Unclassified 836
227 Ga0209971_1098715 3300027682 Unclassified 714
228 Ga0209974_10000168 3300027876 Bacteria 20024
229 Ga0268265_10109709 3300028380 Bacteria 2250
230 Ga0268265_10753507 3300028380 Unclassified 945
231 Ga0268265_11851884 3300028380 Bacteria 610
232 Ga0268264_10387662 3300028381 Bacteria 1339
233 Ga0268264_10462294 3300028381 Bacteria 1231
234 Ga0307405_10023672 3300031731 Bacteria 3494
235 Ga0307413_10075999 3300031824 Bacteria 2133
236 Ga0307410_10447063 3300031852 Bacteria 1053
237 Ga0307406_10039052 3300031901 Bacteria 2942
238 Ga0307407_10008386 3300031903 Bacteria 4738
239 Ga0307412_10019557 3300031911 Bacteria 4104
240 Ga0307409_100733272 3300031995 Bacteria 990
241 Ga0307416_100187894 3300032002 Bacteria 1944
242 Ga0307411_10400482 3300032005 Bacteria 1134
243 Ga0307415_100006252 3300032126 Bacteria 6397
244 Ga0373923_0009407 3300035111 Bacteria 3527
245 Ga0373939_0081797 3300035114 Bacteria 1074
246 Ga0373945_0202835 3300035116 Bacteria 824
247 Ga0373954_0509674 3300035118 Bacteria 596
248 Ga0373954_0630673 3300035118 Bacteria 531
249 Ga0373946_0201682 3300035171 Bacteria 953
250 Ga0373955_0100068 3300035172 Bacteria 1663
251 Ga0373942_0006129 3300035207 Bacteria 2775
252 Ga0373961_0273111 3300035241 Unclassified 618
253 Ga0373935_1030579 3300035692 Bacteria 612
254 Ga0373937_0273958 3300036401 Bacteria 1593
255 Ga0373937_0425561 3300036401 Bacteria 1260
256 Ga0373925_0827803 3300037068 Bacteria 763
257 Ga0373925_1680855 3300037068 Bacteria 518
258 Ga0395899_0543125 3300037312 Bacteria 748
259 Ga0395899_0726185 3300037312 Unclassified 621
260 Ga0395900_0054370 3300037418 Bacteria 4123
261 Ga0395898_0108500 3300037466 Bacteria 2662
262 Ga0395898_0166268 3300037466 Bacteria 2110
263 Ga0395905_0310732 3300037471 Bacteria 1465
264 Ga0395901_0944727 3300038443 Unclassified 841
265 Ga0237819_06192 3300038705 Bacteria 1814
266 Ga0436365_0127363 3300039437 Bacteria 12288
267 Ga0436365_1068078 3300039437 Bacteria 1097
268 Ga0436365_1633701 3300039437 Bacteria 555
269 Ga0439438_048444 3300041405 Bacteria 1087
270 Ga0439439_0042468 3300041406 Bacteria 1181
271 Ga0439439_0246197 3300041406 Bacteria 529
272 Ga0439447_014475 3300041407 Bacteria 2211
273 Ga0439432_021174 3300042006 Bacteria 2158
274 Ga0439451_069030 3300042009 Unclassified 708
275 Ga0439452_006463 3300042010 Bacteria 3671
276 Ga0450921_011858 3300042123 Bacteria 749
277 Ga0450923_134536 3300042125 Bacteria 590
278 Ga0439446_0056327 3300042156 Unclassified 1181
279 Ga0439446_0137920 3300042156 Bacteria 795
280 Ga0439434_0014873 3300042435 Bacteria 2316
281 Ga0453683_0111602 3300044673 Bacteria 1719
282 Ga0466971_0449599 3300044719 Bacteria 632
283 Ga0451576_0367383 3300045051 Bacteria 1507
284 Ga0451576_2560012 3300045051 Bacteria 521
285 Ga0495608_0213416 3300046511 Bacteria 1213
286 Ga0495652_1039876 3300046529 Bacteria 534
287 Ga0495587_0463435 3300046536 Bacteria 702
288 Ga0495645_0382127 3300046543 Bacteria 901
289 Ga0495635_0227369 3300046663 Bacteria 1261
290 Ga0495599_0528068 3300046678 Bacteria 693
291 Ga0495613_0853322 3300046689 Bacteria 592
292 Ga0495636_0394721 3300047318 Unclassified 658
293 Ga0496104_0977968 3300048907 Bacteria 751
294 Ga0496106_0693626 3300048909 Bacteria 812
295 Ga0496109_0325517 3300048912 Bacteria 1451
296 Ga0501291_000266 3300049514 Bacteria 6458
297 Ga0501292_001088 3300049515 Bacteria 3327
298 Ga0501293_001210 3300049516 Bacteria 1940
299 Ga0501294_000272 3300049517 Bacteria 6349
300 Ga0501295_000355 3300049518 Bacteria 4318
301 Ga0501296_000249 3300049519 Bacteria 5586
302 Ga0501297_000119 3300049520 Bacteria 8363
303 Ga0501298_000404 3300049521 Bacteria 5862
304 Ga0501299_002574 3300049522 Bacteria 2523
305 Ga0501300_003802 3300049523 Bacteria 2246
306 Ga0501301_000072 3300049524 Bacteria 4635
307 Ga0501302_002959 3300049525 Bacteria 980
308 Ga0501303_000190 3300049526 Bacteria 5239
309 Ga0501033_0172776 3300049570 Bacteria 1551
310 Ga0501037_0994165 3300049573 Bacteria 547
311 Ga0501038_0034553 3300049574 Bacteria 4444
312 Ga0501039_1523597 3300049575 Bacteria 514
313 Ga0501040_0368587 3300049576 Bacteria 1030
314 Ga0501040_0965293 3300049576 Bacteria 618
315 Ga0501041_0112583 3300049577 Bacteria 1688
316 Ga0501042_0089300 3300049578 Bacteria 2211
317 Ga0501043_0866498 3300049579 Bacteria 650
318 Ga0501046_0211753 3300049580 Bacteria 1438
319 Ga0501073_0400613 3300049589 Bacteria 948
320 Ga0501075_0001123 3300049591 Bacteria 17237
321 Ga0501076_0001129 3300049592 Bacteria 17637
322 Ga0501076_0638044 3300049592 Bacteria 879
323 Ga0501077_0033738 3300049593 Bacteria 3257
324 Ga0501199_000780 3300049650 Bacteria 2817
325 Ga0501201_000863 3300049651 Bacteria 2838
326 Ga0501202_000219 3300049652 Bacteria 7484
327 Ga0501206_000236 3300049653 Bacteria 6504
328 Ga0501207_017248 3300049654 Bacteria 1125
329 Ga0501211_001629 3300049658 Bacteria 2404
330 Ga0501216_000021 3300049660 Bacteria 13034
331 Ga0501217_000668 3300049661 Bacteria 5822
332 Ga0501223_019515 3300049663 Bacteria 1332
333 Ga0501227_002567 3300049665 Bacteria 3991
334 Ga0501233_003822 3300049668 Bacteria 2728
335 Ga0501235_056185 3300049669 Bacteria 917
336 Ga0501236_000687 3300049670 Bacteria 3778
337 Ga0501239_004487 3300049672 Bacteria 1373
338 Ga0501243_000326 3300049675 Bacteria 6186
339 Ga0501247_003848 3300049677 Bacteria 1625
340 Ga0501248_004104 3300049678 Bacteria 1083
341 Ga0501249_002439 3300049679 Bacteria 3756
342 Ga0501253_000568 3300049683 Bacteria 3236
343 Ga0501256_004455 3300049685 Bacteria 1204
344 Ga0501257_022385 3300049686 Bacteria 1495
345 Ga0501258_007914 3300049687 Bacteria 1083
346 Ga0501260_000007 3300049689 Bacteria 14014
347 Ga0501261_000142 3300049690 Bacteria 10454
348 Ga0501219_000423 3300049703 Bacteria 6935
349 Ga0501221_001848 3300049704 Bacteria 3532
350 Ga0501225_0000580 3300049705 Bacteria 11434
351 Ga0501234_000680 3300049707 Bacteria 5253
352 Ga0501245_000494 3300049708 Bacteria 4784
353 Ga0501080_0107879 3300049742 Bacteria 2581
354 Ga0501081_0000912 3300049743 Bacteria 17516
355 Ga0501264_001257 3300049761 Bacteria 2859
356 Ga0501265_007660 3300049762 Bacteria 1275
357 Ga0501266_001050 3300049763 Bacteria 3568
358 Ga0501268_001513 3300049765 Bacteria 2910
359 Ga0501269_006189 3300049766 Bacteria 1441
360 Ga0501270_022560 3300049767 Bacteria 973
361 Ga0501271_000261 3300049768 Bacteria 4470
362 Ga0501272_000934 3300049769 Bacteria 2665
363 Ga0501273_005060 3300049770 Bacteria 1475
364 Ga0501275_000840 3300049772 Bacteria 3315
365 Ga0501276_000212 3300049773 Bacteria 3253
366 Ga0501279_000060 3300049775 Bacteria 19728
367 Ga0501280_002167 3300049776 Bacteria 3359
368 Ga0501281_01899 3300049777 Bacteria 1569
369 Ga0501282_003473 3300049778 Bacteria 1701
370 Ga0501283_001137 3300049779 Bacteria 3500
371 Ga0501044_1580236 3300049823 Bacteria 521
372 Ga0501045_0058220 3300049824 Bacteria 2829
373 Ga0501200_01026 3300049849 Bacteria 1027
374 Ga0501204_001071 3300049850 Bacteria 2590
375 Ga0501212_000132 3300049851 Bacteria 6028
376 Ga0501226_012355 3300049853 Bacteria 945
377 nmdc:mga05p37_1678511_c1 3300050507 Bacteria 621
378 nmdc:mga05p37_1883592_c1 3300050507 Bacteria 572
379 nmdc:mga05p37_52953_c1 3300050507 Bacteria 4992
380 nmdc:mga05p37_546822_c1 3300050507 Bacteria 1319
381 nmdc:mga05p37_550470_c1 3300050507 Bacteria 1313
382 nmdc:mga05p37_92648_c1 3300050507 Bacteria 3723
383 nmdc:mga09592_1197335_c1 3300050508 Unclassified 628
384 nmdc:mga09592_169748_c1 3300050508 Bacteria 1886
385 nmdc:mga09592_98500_c1 3300050508 Bacteria 2503
386 nmdc:mga0qj67_15936_c1 3300050509 Bacteria 5692
387 nmdc:mga06r32_12118_c1 3300050510 Bacteria 7777
388 nmdc:mga06r32_310254_c1 3300050510 Bacteria 1563
389 nmdc:mga06r32_452737_c1 3300050510 Bacteria 1263
390 nmdc:mga06r32_723533_c1 3300050510 Unclassified 960
391 nmdc:mga08y16_473831_c1 3300050511 Bacteria 1274
392 nmdc:mga0n895_228483_c1 3300050512 Bacteria 1889
393 nmdc:mga0n895_334117_c1 3300050512 Bacteria 1535
394 nmdc:mga0n895_433429_c1 3300050512 Unclassified 1328
395 nmdc:mga0n895_62498_c1 3300050512 Bacteria 3681
396 nmdc:mga0n895_721277_c1 3300050512 Unclassified 992
397 nmdc:mga0rr50_36907_c1 3300050513 Bacteria 3523
398 nmdc:mga0rr50_687079_c1 3300050513 Bacteria 873
399 nmdc:mga0a205_301000_c1 3300050515 Bacteria 1477
400 nmdc:mga0a205_58777_c1 3300050515 Bacteria 3714
401 nmdc:mga0a205_64591_c1 3300050515 Bacteria 3536
402 nmdc:mga0a205_75736_c1 3300050515 Bacteria 3251
403 Ga0501084_0009225 3300054114 Bacteria 8161
404 Ga0501084_0738333 3300054114 Bacteria 830
405 Ga0501084_1025634 3300054114 Bacteria 693
406 Ga0590075_190233 3300059424 Unclassified 543
407 Ga0590077_052831 3300059426 Unclassified 914
408 Ga0587081_00096 3300060246 Bacteria 3451
409 Ga0501082_0000138 3300060353 Bacteria 59990
410 Ga0501082_0001866 3300060353 Bacteria 18542
411 Ga0530510_0000066 3300061734 Bacteria 52227
412 2617918459 2617270889 Bacteria 9064343
413 2617918676 2617270889 Bacteria 9064343
414 2831429593 2831426010 Bacteria 8662725
415 2848698704 2848694841 Bacteria 9205737
416 2848702373 2848694841 Bacteria 9205737
417 2913847558 2913844669 Bacteria 8381711
418 642601297 642555144 Bacteria 9059191
419 642601460 642555144 Bacteria 9059191
420 Ga0590075_013876
421 Ga0065715_10270471
422 Ga0065715_10371411
423 Ga0065707_10123015
424 Ga0070683_100100763
425 Ga0070683_100288050
426 Ga0070683_102053660
427 Ga0070670_100015188
428 Ga0068869_100119219
429 Ga0068869_101118549
430 Ga0070666_10067559
431 Ga0070666_10705872
432 Ga0070680_100229407
433 Ga0070689_100008072
434 Ga0070689_100036501
435 Ga0070689_100038614
436 Ga0070689_100391232
437 Ga0070687_100016220
438 Ga0070661_100367301
439 Ga0070692_10049751
440 Ga0070692_10157070
441 Ga0070669_100031286
442 Ga0070675_100000648
443 Ga0070675_101242019
444 Ga0070671_100001320
445 Ga0070674_101867430
446 Ga0070673_100102188
447 Ga0070688_100256301
448 Ga0070703_10095475
449 Ga0070713_101153096
450 Ga0070701_10120498
451 Ga0070705_100044674
452 Ga0070705_100379644
453 Ga0070705_100383091
454 Ga0070700_100248287
455 Ga0070694_100297673
456 Ga0070694_100453928
457 Ga0070708_100080395
458 Ga0070708_101295933
459 Ga0070662_101101526
460 Ga0070662_101228459
461 Ga0070681_10388248
462 Ga0070681_11019479
463 Ga0070681_11208679
464 Ga0070685_10132849
465 Ga0070706_100017949
466 Ga0070707_100555953
467 Ga0070707_100994332
468 Ga0070698_100002121
469 Ga0070698_100033965
470 Ga0070698_100136843
471 Ga0070698_100493719
472 Ga0070699_100544925
473 Ga0070699_101257794
474 Ga0070679_100633809
475 Ga0070684_100206036
476 Ga0070684_100610598
477 Ga0070684_100623476
478 Ga0070697_100000331
479 Ga0068853_100690637
480 Ga0070672_100024691
481 Ga0070672_100689419
482 Ga0070686_100002331
483 Ga0070686_100084195
484 Ga0070695_100121746
485 Ga0070696_100830058
486 Ga0070704_100095807
487 Ga0070704_100100189
488 Ga0070704_100850422
489 Ga0070704_100954363
490 Ga0070664_100038990
491 Ga0070664_100884568
492 Ga0070664_101874354
493 Ga0068857_100107739
494 Ga0068859_100000439
495 Ga0068859_100024375
496 Ga0068859_100105617
497 Ga0068859_100304633
498 Ga0068859_101258854
499 Ga0068864_100051895
500 Ga0068864_100069468
501 Ga0068864_100156785
502 Ga0068864_100169417
503 Ga0068864_100323396
504 Ga0068870_10556448
505 Ga0068870_10972403
506 Ga0068863_100242142
507 Ga0068863_100293149
508 Ga0068858_100041593
509 Ga0068858_100427466
510 Ga0068860_100418267
511 Ga0068860_100477607
512 Ga0068862_100247072
513 Ga0068862_100248835
514 Ga0068862_101115020
515 Ga0081539_10262215
516 Ga0070717_10202275
517 Ga0070717_11062820
518 Ga0097621_100009709
519 Ga0075428_101026639
520 Ga0075430_100099914
521 Ga0075431_100055181
522 Ga0075431_100103161
523 Ga0075431_100199992
524 Ga0075433_10078466
525 Ga0075433_10128703
526 Ga0075433_10268606
527 Ga0075434_100214212
528 Ga0075434_100234981
529 Ga0075434_100468278
530 Ga0075434_100785153
531 Ga0075429_101101728
532 Ga0075429_101342647
533 Ga0097620_100000439
534 Ga0097620_100024374
535 Ga0097620_100105618
536 Ga0097620_100304654
537 Ga0097620_101258836
538 Ga0075435_100204593
539 Ga0075435_101254796
540 Ga0099794_10064117
541 Ga0105240_10110614
542 Ga0105240_12043806
543 Ga0111539_10128293
544 Ga0111539_10538604
545 Ga0105245_10224271
546 Ga0105247_10029915
547 Ga0114129_10005584
548 Ga0114129_10098553
549 Ga0114129_10139879
550 Ga0114129_10199589
551 Ga0114129_11202148
552 Ga0114129_11774753
553 Ga0114129_12796854
554 Ga0114129_13454095
555 Ga0105243_10762427
556 Ga0105243_11360927
557 Ga0105241_10374994
558 Ga0105242_10754788
559 Ga0105242_10924558
560 Ga0105242_12886937
561 Ga0105248_10159569
562 Ga0105237_10000005
563 Ga0105238_10558888
564 Ga0105238_11036447
565 Ga0105249_10174940
566 Ga0105249_10724741
567 Ga0105249_10833668
568 Ga0105239_10629642
569 Ga0157373_10506495
570 Ga0157378_10740691
571 Ga0157378_11122118
572 Ga0157375_10541620
573 Ga0163163_10002047
574 Ga0163163_10329664
575 Ga0163163_10379993
576 Ga0163163_10552405
577 Ga0163163_10692767
578 Ga0163163_13110442
579 Ga0157377_10217198
580 Ga0157379_10281070
581 Ga0182005_1075346
582 Ga0197907_10459753
583 Ga0197907_10959956
584 Ga0206350_10404858
585 Ga0206350_11051144
586 Ga0213876_10116505
587 Ga0224712_10238495
588 Ga0224712_10312538
589 Ga0224712_10612851
590 Ga0207697_10212403
591 Ga0207653_10000197
592 Ga0207653_10068948
593 Ga0207653_10102008
594 Ga0207642_10939094
595 Ga0207680_10128048
596 Ga0207643_10248818
597 Ga0207684_10010747
598 Ga0207654_10324538
599 Ga0207707_10091443
600 Ga0207671_10000004
601 Ga0207660_10500839
602 Ga0207662_10077219
603 Ga0207649_10354498
604 Ga0207646_10901159
605 Ga0207681_10016567
606 Ga0207694_10834589
607 Ga0207650_10000780
608 Ga0207650_10320419
609 Ga0207659_10006645
610 Ga0207706_10096131
611 Ga0207706_10918617
612 Ga0207670_10374121
613 Ga0207670_10757135
614 Ga0207691_10007979
615 Ga0207691_10577756
616 Ga0207711_10262856
617 Ga0207689_10010960
618 Ga0207689_10480856
619 Ga0207689_11052657
620 Ga0207661_10163772
621 Ga0207679_10017660
622 Ga0207679_10100973
623 Ga0207651_10072954
624 Ga0207651_10079654
625 Ga0207651_10240166
626 Ga0207640_11127751
627 Ga0207658_10141441
628 Ga0207703_10213657
629 Ga0207703_10694936
630 Ga0207708_10065592
631 Ga0207641_10113715
632 Ga0207641_10615217
633 Ga0207641_12041342
634 Ga0207676_10067807
635 Ga0207676_10192030
636 Ga0207676_10396423
637 Ga0207676_10506129
638 Ga0207676_10544844
639 Ga0207674_10427047
640 Ga0207674_10564430
641 Ga0207674_11125181
642 Ga0209967_1000707
643 Ga0209981_1010457
644 Ga0209995_1019871
645 Ga0209982_1031373
646 Ga0209971_1098715
647 Ga0209974_10000168
648 Ga0268265_10109709
649 Ga0268265_10753507
650 Ga0268265_11851884
651 Ga0268264_10387662
652 Ga0268264_10462294
653 Ga0307405_10023672
654 Ga0307413_10075999
655 Ga0307410_10447063
656 Ga0307406_10039052
657 Ga0307407_10008386
658 Ga0307412_10019557
659 Ga0307409_100733272
660 Ga0307416_100187894
661 Ga0307411_10400482
662 Ga0307415_100006252
663 Ga0373923_0009407
664 Ga0373939_0081797
665 Ga0373945_0202835
666 Ga0373954_0509674
667 Ga0373954_0630673
668 Ga0373946_0201682
669 Ga0373955_0100068
670 Ga0373942_0006129
671 Ga0373961_0273111
672 Ga0373935_1030579
673 Ga0373937_0273958
674 Ga0373937_0425561
675 Ga0373925_0827803
676 Ga0373925_1680855
677 Ga0395899_0543125
678 Ga0395899_0726185
679 Ga0395900_0054370
680 Ga0395898_0108500
681 Ga0395898_0166268
682 Ga0395905_0310732
683 Ga0395901_0944727
684 Ga0237819_06192
685 Ga0436365_0127363
686 Ga0436365_1068078
687 Ga0436365_1633701
688 Ga0439438_048444
689 Ga0439439_0042468
690 Ga0439439_0246197
691 Ga0439447_014475
692 Ga0439432_021174
693 Ga0439451_069030
694 Ga0439452_006463
695 Ga0450921_011858
696 Ga0450923_134536
697 Ga0439446_0056327
698 Ga0439446_0137920
699 Ga0439434_0014873
700 Ga0453683_0111602
701 Ga0466971_0449599
702 Ga0451576_0367383
703 Ga0451576_2560012
704 Ga0495608_0213416
705 Ga0495652_1039876
706 Ga0495587_0463435
707 Ga0495645_0382127
708 Ga0495635_0227369
709 Ga0495599_0528068
710 Ga0495613_0853322
711 Ga0495636_0394721
712 Ga0496104_0977968
713 Ga0496106_0693626
714 Ga0496109_0325517
715 Ga0501291_000266
716 Ga0501292_001088
717 Ga0501293_001210
718 Ga0501294_000272
719 Ga0501295_000355
720 Ga0501296_000249
721 Ga0501297_000119
722 Ga0501298_000404
723 Ga0501299_002574
724 Ga0501300_003802
725 Ga0501301_000072
726 Ga0501302_002959
727 Ga0501303_000190
728 Ga0501033_0172776
729 Ga0501037_0994165
730 Ga0501038_0034553
731 Ga0501039_1523597
732 Ga0501040_0368587
733 Ga0501040_0965293
734 Ga0501041_0112583
735 Ga0501042_0089300
736 Ga0501043_0866498
737 Ga0501046_0211753
738 Ga0501073_0400613
739 Ga0501075_0001123
740 Ga0501076_0001129
741 Ga0501076_0638044
742 Ga0501077_0033738
743 Ga0501199_000780
744 Ga0501201_000863
745 Ga0501202_000219
746 Ga0501206_000236
747 Ga0501207_017248
748 Ga0501211_001629
749 Ga0501216_000021
750 Ga0501217_000668
751 Ga0501223_019515
752 Ga0501227_002567
753 Ga0501233_003822
754 Ga0501235_056185
755 Ga0501236_000687
756 Ga0501239_004487
757 Ga0501243_000326
758 Ga0501247_003848
759 Ga0501248_004104
760 Ga0501249_002439
761 Ga0501253_000568
762 Ga0501256_004455
763 Ga0501257_022385
764 Ga0501258_007914
765 Ga0501260_000007
766 Ga0501261_000142
767 Ga0501219_000423
768 Ga0501221_001848
769 Ga0501225_0000580
770 Ga0501234_000680
771 Ga0501245_000494
772 Ga0501080_0107879
773 Ga0501081_0000912
774 Ga0501264_001257
775 Ga0501265_007660
776 Ga0501266_001050
777 Ga0501268_001513
778 Ga0501269_006189
779 Ga0501270_022560
780 Ga0501271_000261
781 Ga0501272_000934
782 Ga0501273_005060
783 Ga0501275_000840
784 Ga0501276_000212
785 Ga0501279_000060
786 Ga0501280_002167
787 Ga0501281_01899
788 Ga0501282_003473
789 Ga0501283_001137
790 Ga0501044_1580236
791 Ga0501045_0058220
792 Ga0501200_01026
793 Ga0501204_001071
794 Ga0501212_000132
795 Ga0501226_012355
796 nmdc:mga05p37_1678511_c1
797 nmdc:mga05p37_1883592_c1
798 nmdc:mga05p37_52953_c1
799 nmdc:mga05p37_546822_c1
800 nmdc:mga05p37_550470_c1
801 nmdc:mga05p37_92648_c1
802 nmdc:mga09592_1197335_c1
803 nmdc:mga09592_169748_c1
804 nmdc:mga09592_98500_c1
805 nmdc:mga0qj67_15936_c1
806 nmdc:mga06r32_12118_c1
807 nmdc:mga06r32_310254_c1
808 nmdc:mga06r32_452737_c1
809 nmdc:mga06r32_723533_c1
810 nmdc:mga08y16_473831_c1
811 nmdc:mga0n895_228483_c1
812 nmdc:mga0n895_334117_c1
813 nmdc:mga0n895_433429_c1
814 nmdc:mga0n895_62498_c1
815 nmdc:mga0n895_721277_c1
816 nmdc:mga0rr50_36907_c1
817 nmdc:mga0rr50_687079_c1
818 nmdc:mga0a205_301000_c1
819 nmdc:mga0a205_58777_c1
820 nmdc:mga0a205_64591_c1
821 nmdc:mga0a205_75736_c1
822 Ga0501084_0009225
823 Ga0501084_0738333
824 Ga0501084_1025634
825 Ga0590075_190233
826 Ga0590077_052831
827 Ga0587081_00096
828 Ga0501082_0000138
829 Ga0501082_0001866
830 Ga0530510_0000066
831 2617918459
832 2617918676
833 2831429593
834 2848698704
835 2848702373
836 2913847558
837 642601297
838 642601460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6583 1 113
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6515 1 117
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6225 1 117
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6115 1 113
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.607 1 117
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6583 1 113 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6277 1 118 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6115 1 113 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6114 1 118 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.5488 1 117 3.30.70.1060
ID Description Score Start End GO Terms
AF-L7U3K5-F1-model_v4 YCII-related domain-containing protein 0.8617 42 113
AF-A0A2W5U2H3-F1-model_v4 YCII-related domain-containing protein 0.8399 45 112
AF-A0A7Y6PKH6-F1-model_v4 YCII-related domain-containing protein 0.8303 45 114
AF-A0A7Y6UEB8-F1-model_v4 YCII-related domain-containing protein 0.8258 45 113
AF-A0A150P4K2-F1-model_v4 YCII-related domain-containing protein 0.7946 43 112

Map