F439467

General Info

Members Datasets Scaffolds Average Seq Length
419 248 407 302

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000021|Ga0070703_1000002154
Length 345
Sequence MTTATPTQLGMVGLGRMGANIVRRLMRDGHPCVVHDLSSEAVAALASEGATGADTIEAFVAALNPPRAVWVMVPAGEPTEHAVGSLVGVLAPGDVVIDGGNTYYRDDLRRAKELAGRGIAYVDCGTSGGVFGLDRGFCLMVGCDDDAVWDRLEPIFRSLAPGVAAAPRTPGAPAEVTPQEQGYLRVGPVGAGHFVKMVHNGIEYALMEAYAEGINVLHHANIGGEAQAHDAETAPLGDPAFYRYDIDIAAVAELWRRGSVVASWLLDLAAAALHDSPTLDGFAGRVADSGEGRWTAIAAIEEGVPADILTAALSARFSSRGQAEMANRLLSAMRWRFGGHVEPPG

Samples

Sample ID Description Type Environment
1 2597490337 Halobacterium salinarum DSM 3754 Isolate Nodule
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
4 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
5 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
6 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
7 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
8 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
9 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
10 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
11 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
238 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0.72
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 0.24
Rhizoplane 1.91
Rhizosphere 83.29
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055532_1003448 3300003758 Bacteria 2707
2 Ga0070658_10000976 3300005327 Bacteria 24552
3 Ga0070658_10001447 3300005327 Bacteria 20259
4 Ga0070658_10011720 3300005327 Bacteria 7034
5 Ga0070658_10031132 3300005327 Bacteria 4284
6 Ga0070658_10041206 3300005327 Bacteria 3725
7 Ga0070666_10039751 3300005335 Bacteria 3136
8 Ga0068868_100036222 3300005338 Bacteria 3818
9 Ga0070660_100043651 3300005339 Bacteria 3427
10 Ga0070659_100003355 3300005366 Bacteria 11392
11 Ga0070667_100001084 3300005367 Bacteria 24909
12 Ga0070667_100039929 3300005367 Bacteria 3934
13 Ga0070667_100224780 3300005367 Bacteria 1672
14 Ga0070703_10000021 3300005406 Bacteria 75160
15 Ga0070714_100225695 3300005435 Bacteria 1724
16 Ga0070705_100008931 3300005440 Bacteria 4969
17 Ga0070694_100023703 3300005444 Bacteria 3951
18 Ga0070708_100008641 3300005445 Bacteria 8184
19 Ga0070708_100013582 3300005445 Bacteria 6675
20 Ga0070678_100282144 3300005456 Bacteria 1405
21 Ga0070681_10354722 3300005458 Bacteria 1377
22 Ga0068867_100165766 3300005459 Bacteria 1746
23 Ga0070706_100020157 3300005467 Bacteria 6144
24 Ga0070706_100046016 3300005467 Bacteria 4028
25 Ga0070707_100006084 3300005468 Bacteria 11258
26 Ga0070707_100011223 3300005468 Bacteria 8350
27 Ga0070698_100002193 3300005471 Bacteria 21678
28 Ga0070698_100002660 3300005471 Bacteria 19709
29 Ga0070679_100033314 3300005530 Bacteria 5101
30 Ga0070697_100006988 3300005536 Bacteria 8777
31 Ga0068853_100121364 3300005539 Bacteria 2332
32 Ga0070672_100019574 3300005543 Bacteria 4916
33 Ga0070696_100037742 3300005546 Bacteria 3332
34 Ga0070665_100121578 3300005548 Bacteria 2612
35 Ga0070704_100048804 3300005549 Bacteria 2965
36 Ga0070704_100056427 3300005549 Bacteria 2789
37 Ga0070704_100090598 3300005549 Bacteria 2278
38 Ga0068855_100001284 3300005563 Bacteria 31118
39 Ga0068855_100023203 3300005563 Bacteria 7433
40 Ga0068855_100034444 3300005563 Bacteria 6039
41 Ga0068855_100165527 3300005563 Bacteria 2507
42 Ga0068855_100185417 3300005563 Bacteria 2350
43 Ga0068857_100005100 3300005577 Bacteria 11165
44 Ga0068857_100280414 3300005577 Bacteria 1533
45 Ga0068856_100080053 3300005614 Bacteria 3240
46 Ga0068856_100116842 3300005614 Bacteria 2668
47 Ga0068856_100174122 3300005614 Bacteria 2165
48 Ga0068852_100008302 3300005616 Bacteria 7644
49 Ga0068852_100033118 3300005616 Bacteria 4287
50 Ga0068852_100061564 3300005616 Bacteria 3262
51 Ga0068852_100137570 3300005616 Bacteria 2256
52 Ga0068852_100183987 3300005616 Bacteria 1966
53 Ga0068859_100000011 3300005617 Bacteria 309687
54 Ga0068859_100123444 3300005617 Bacteria 2657
55 Ga0068864_100024877 3300005618 Bacteria 5037
56 Ga0068866_10003701 3300005718 Bacteria 6265
57 Ga0068851_10000053 3300005834 Bacteria 71192
58 Ga0068858_100000176 3300005842 Bacteria 68056
59 Ga0068860_100322654 3300005843 Bacteria 1516
60 Ga0081540_1004978 3300005983 Bacteria 9989
61 Ga0081539_10075124 3300005985 Bacteria 1797
62 Ga0075365_10011262 3300006038 Bacteria 5254
63 Ga0075364_10071618 3300006051 Bacteria 2283
64 Ga0070712_100121745 3300006175 Bacteria 1964
65 Ga0075369_10043320 3300006186 Bacteria 1931
66 Ga0075428_100016232 3300006844 Bacteria 8231
67 Ga0075428_100073953 3300006844 Bacteria 3722
68 Ga0075428_100242583 3300006844 Bacteria 1944
69 Ga0075430_100007980 3300006846 Bacteria 8945
70 Ga0075431_100001322 3300006847 Bacteria 22654
71 Ga0075429_100016093 3300006880 Bacteria 6478
72 Ga0075429_100019489 3300006880 Bacteria 5877
73 Ga0097620_100000011 3300006931 Bacteria 309687
74 Ga0097620_100123446 3300006931 Bacteria 2657
75 Ga0105240_10005148 3300009093 Bacteria 19564
76 Ga0105240_10065741 3300009093 Bacteria 4500
77 Ga0105240_10119336 3300009093 Bacteria 3177
78 Ga0111539_10000398 3300009094 Bacteria 54069
79 Ga0105245_10007692 3300009098 Bacteria 9438
80 Ga0105245_10025509 3300009098 Bacteria 5199
81 Ga0105245_10053498 3300009098 Bacteria 3624
82 Ga0105245_10063265 3300009098 Bacteria 3341
83 Ga0105247_10040923 3300009101 Bacteria 2834
84 Ga0105247_10116831 3300009101 Bacteria 1724
85 Ga0105247_10200242 3300009101 Bacteria 1341
86 Ga0114129_10075386 3300009147 Bacteria 4697
87 Ga0105243_10024345 3300009148 Bacteria 4617
88 Ga0105242_10004443 3300009176 Bacteria 10901
89 Ga0105242_10590166 3300009176 Bacteria 1071
90 Ga0105248_10000897 3300009177 Bacteria 33319
91 Ga0105248_10029387 3300009177 Bacteria 6131
92 Ga0105237_10004763 3300009545 Bacteria 15599
93 Ga0105237_10014141 3300009545 Bacteria 8353
94 Ga0105238_10000476 3300009551 Bacteria 42016
95 Ga0105246_10181612 3300011119 Bacteria 1620
96 Ga0157370_10137822 3300013104 Bacteria 2274
97 Ga0157370_10334575 3300013104 Bacteria 1396
98 Ga0157369_10137481 3300013105 Bacteria 2586
99 Ga0157369_10353660 3300013105 Bacteria 1526
100 Ga0157374_10030410 3300013296 Bacteria 4903
101 Ga0157374_10034123 3300013296 Bacteria 4646
102 Ga0157378_10006652 3300013297 Bacteria 10101
103 Ga0163162_10055545 3300013306 Bacteria 3987
104 Ga0157372_10487668 3300013307 Bacteria 1437
105 Ga0157375_10057903 3300013308 Bacteria 3832
106 Ga0163163_10031929 3300014325 Bacteria 5085
107 Ga0157379_10068421 3300014968 Bacteria 3175
108 Ga0157379_10311444 3300014968 Bacteria 1436
109 Ga0157376_10406334 3300014969 Bacteria 1318
110 Ga0206350_10494122 3300020080 Bacteria 1991
111 Ga0206353_11519911 3300020082 Bacteria 2496
112 Ga0213876_10007682 3300021384 Bacteria 5853
113 Ga0213875_10002389 3300021388 Bacteria 11298
114 Ga0224712_10042794 3300022467 Bacteria 1718
115 Ga0209677_100271 3300025253 Bacteria 34642
116 Ga0209148_1001014 3300025254 Bacteria 17716
117 Ga0209233_1003736 3300025261 Bacteria 5319
118 Ga0209455_1004265 3300025272 Bacteria 4750
119 Ga0207656_10000001 3300025321 Bacteria 1323684
120 Ga0207653_10000004 3300025885 Bacteria 263142
121 Ga0207642_10001660 3300025899 Bacteria 6867
122 Ga0207680_10206464 3300025903 Bacteria 1341
123 Ga0207705_10001738 3300025909 Bacteria 17257
124 Ga0207705_10009264 3300025909 Bacteria 7161
125 Ga0207684_10019133 3300025910 Bacteria 5857
126 Ga0207684_10163511 3300025910 Bacteria 1917
127 Ga0207654_10000001 3300025911 Bacteria 1816198
128 Ga0207695_10001399 3300025913 Bacteria 40720
129 Ga0207695_10002309 3300025913 Bacteria 28441
130 Ga0207695_10002481 3300025913 Bacteria 27163
131 Ga0207671_10000001 3300025914 Bacteria 1318881
132 Ga0207671_10003504 3300025914 Bacteria 15592
133 Ga0207693_10132058 3300025915 Bacteria 1963
134 Ga0207657_10007809 3300025919 Bacteria 10918
135 Ga0207657_10179181 3300025919 Bacteria 1714
136 Ga0207652_10009995 3300025921 Bacteria 7640
137 Ga0207646_10004377 3300025922 Bacteria 15372
138 Ga0207646_10046370 3300025922 Bacteria 3899
139 Ga0207646_10287780 3300025922 Bacteria 1485
140 Ga0207681_10251452 3300025923 Bacteria 1380
141 Ga0207694_10000019 3300025924 Bacteria 312382
142 Ga0207694_10061954 3300025924 Bacteria 2912
143 Ga0207687_10030424 3300025927 Bacteria 3640
144 Ga0207687_10052616 3300025927 Bacteria 2842
145 Ga0207687_10200003 3300025927 Bacteria 1561
146 Ga0207690_10002616 3300025932 Bacteria 10843
147 Ga0207686_10024326 3300025934 Bacteria 3508
148 Ga0207691_10023123 3300025940 Bacteria 5853
149 Ga0207711_10000405 3300025941 Bacteria 45662
150 Ga0207711_10016898 3300025941 Bacteria 6061
151 Ga0207711_10111833 3300025941 Bacteria 2430
152 Ga0207689_10156920 3300025942 Bacteria 1876
153 Ga0207679_10310278 3300025945 Bacteria 1363
154 Ga0207667_10000498 3300025949 Bacteria 51911
155 Ga0207667_10011472 3300025949 Bacteria 10295
156 Ga0207667_10034594 3300025949 Bacteria 5424
157 Ga0207667_10080812 3300025949 Bacteria 3368
158 Ga0207658_10000468 3300025986 Bacteria 37711
159 Ga0207677_10020549 3300026023 Bacteria 4011
160 Ga0207677_10080037 3300026023 Bacteria 2339
161 Ga0207703_10000121 3300026035 Bacteria 94523
162 Ga0207703_10171526 3300026035 Bacteria 1908
163 Ga0207639_10025918 3300026041 Bacteria 4255
164 Ga0207678_10176304 3300026067 Bacteria 1825
165 Ga0207702_10044197 3300026078 Bacteria 3744
166 Ga0207702_10140588 3300026078 Bacteria 2184
167 Ga0207702_10385596 3300026078 Bacteria 1348
168 Ga0207641_10022978 3300026088 Bacteria 5137
169 Ga0207641_10075488 3300026088 Bacteria 2911
170 Ga0207648_10171946 3300026089 Bacteria 1915
171 Ga0207676_10027237 3300026095 Bacteria 4256
172 Ga0207674_10016735 3300026116 Bacteria 8014
173 Ga0207674_10222053 3300026116 Bacteria 1838
174 Ga0207674_10390059 3300026116 Bacteria 1346
175 Ga0207674_10415914 3300026116 Bacteria 1299
176 Ga0207698_10008089 3300026142 Bacteria 6631
177 Ga0207698_10021347 3300026142 Bacteria 4476
178 Ga0207698_10023507 3300026142 Bacteria 4307
179 Ga0207698_10134921 3300026142 Bacteria 2116
180 Ga0209371_1020129 3300027312 Bacteria 1649
181 Ga0268266_10152056 3300028379 Bacteria 2087
182 Ga0268256_1010322 3300030500 Bacteria 3036
183 Ga0316182_1003868 3300030745 Bacteria 6985
184 Ga0265325_10003210 3300031241 Bacteria 10755
185 Ga0307408_100020202 3300031548 Bacteria 4492
186 Ga0307408_100076904 3300031548 Bacteria 2484
187 Ga0307514_10020516 3300031649 Bacteria 5391
188 Ga0265342_10000678 3300031712 Bacteria 35577
189 Ga0307405_10031487 3300031731 Bacteria 3123
190 Ga0307410_10014570 3300031852 Bacteria 4631
191 Ga0307406_10047366 3300031901 Bacteria 2709
192 Ga0307407_10006317 3300031903 Bacteria 5247
193 Ga0307407_10038539 3300031903 Bacteria 2650
194 Ga0307412_10018878 3300031911 Bacteria 4161
195 Ga0307409_100001515 3300031995 Bacteria 11498
196 Ga0307409_100016321 3300031995 Bacteria 4909
197 Ga0307416_100111768 3300032002 Bacteria 2410
198 Ga0307416_100143590 3300032002 Bacteria 2174
199 Ga0307416_100158505 3300032002 Bacteria 2088
200 Ga0307411_10213538 3300032005 Bacteria 1491
201 Ga0307415_100169315 3300032126 Bacteria 1702
202 Ga0307415_100257911 3300032126 Bacteria 1420
203 Ga0373930_0000293 3300034816 Bacteria 6420
204 Ga0373932_0000159 3300035112 Bacteria 19732
205 Ga0373931_0000003 3300035691 Bacteria 560286
206 Ga0373937_0003539 3300036401 Bacteria 13152
207 Ga0395899_0004601 3300037312 Bacteria 10752
208 Ga0395899_0007189 3300037312 Bacteria 8617
209 Ga0395899_0209230 3300037312 Bacteria 1356
210 Ga0395900_0005392 3300037418 Bacteria 13400
211 Ga0395900_0010729 3300037418 Bacteria 9371
212 Ga0395898_0038877 3300037466 Bacteria 4712
213 Ga0395898_0149489 3300037466 Bacteria 2235
214 Ga0395898_0214060 3300037466 Bacteria 1838
215 Ga0436364_1454558 3300037853 Bacteria 9705
216 Ga0395901_0019142 3300038443 Bacteria 6999
217 Ga0395901_0044677 3300038443 Bacteria 4595
218 Ga0395901_0321484 3300038443 Bacteria 1601
219 Ga0436365_0379914 3300039437 Bacteria 12297
220 Ga0436363_1107981 3300039450 Bacteria 1126
221 Ga0439465_0031616 3300041413 Bacteria 1687
222 Ga0451789_0054370 3300041443 Bacteria 2491
223 Ga0451791_0969053 3300041451 Bacteria 1292
224 Ga0451793_0123572 3300041452 Bacteria 3753
225 Ga0439445_0018285 3300042004 Bacteria 1739
226 Ga0466965_0000004 3300044683 Bacteria 229348
227 Ga0466965_0003538 3300044683 Bacteria 6868
228 Ga0466965_0044457 3300044683 Bacteria 2195
229 Ga0466965_0155677 3300044683 Bacteria 1196
230 Ga0466965_0172433 3300044683 Bacteria 1138
231 Ga0466966_0027871 3300044684 Bacteria 3682
232 Ga0466961_0235733 3300044693 Bacteria 1125
233 Ga0466963_0030350 3300044694 Bacteria 3487
234 Ga0466964_0005434 3300044706 Bacteria 4730
235 Ga0453684_0523635 3300044712 Bacteria 1309
236 Ga0466971_0070752 3300044719 Bacteria 1584
237 Ga0466970_0009784 3300044765 Bacteria 4854
238 Ga0466957_0017888 3300044842 Bacteria 4158
239 Ga0466960_0001267 3300044901 Bacteria 9146
240 Ga0466960_0012047 3300044901 Bacteria 3639
241 Ga0466960_0027184 3300044901 Bacteria 2607
242 Ga0466960_0217826 3300044901 Bacteria 1049
243 Ga0495603_0011205 3300046455 Bacteria 5434
244 Ga0495629_0111648 3300046459 Bacteria 1906
245 Ga0495651_0087987 3300046462 Bacteria 2335
246 Ga0495650_0000211 3300046471 Bacteria 125248
247 Ga0495580_0428621 3300046472 Bacteria 889
248 Ga0495628_0117188 3300046516 Bacteria 2045
249 Ga0495656_0073425 3300046615 Bacteria 1525
250 Ga0495635_0155661 3300046663 Bacteria 1556
251 Ga0495647_0033588 3300046681 Bacteria 1918
252 Ga0495658_0166612 3300046683 Bacteria 1362
253 Ga0495658_0252158 3300046683 Bacteria 1110
254 Ga0495672_0045936 3300047320 Bacteria 2609
255 Ga0495672_0058945 3300047320 Bacteria 2223
256 Ga0495686_0000003 3300047472 Bacteria 899502
257 Ga0496101_0005788 3300048904 Bacteria 7901
258 Ga0496107_0012077 3300048910 Bacteria 6023
259 Ga0496109_0143807 3300048912 Bacteria 2231
260 Ga0496110_0172379 3300048913 Bacteria 1963
261 Ga0496114_0143116 3300048917 Bacteria 2071
262 Ga0496117_0006843 3300048920 Bacteria 11334
263 Ga0496118_0029100 3300048921 Bacteria 4639
264 Ga0496119_0007823 3300048922 Bacteria 9529
265 Ga0496119_0043948 3300048922 Bacteria 2819
266 Ga0496120_0004926 3300048923 Bacteria 10863
267 Ga0496120_0008003 3300048923 Bacteria 7779
268 Ga0496120_0052715 3300048923 Bacteria 2315
269 Ga0496122_0002555 3300048925 Bacteria 25570
270 Ga0496123_0013320 3300048926 Bacteria 6918
271 Ga0496125_0127401 3300048928 Bacteria 1801
272 Ga0496126_0029791 3300048929 Bacteria 5181
273 Ga0496126_0033914 3300048929 Bacteria 4801
274 Ga0496126_0349439 3300048929 Bacteria 1210
275 Ga0501031_0008686 3300049568 Bacteria 6605
276 Ga0501031_0164248 3300049568 Bacteria 1451
277 Ga0501032_0004227 3300049569 Bacteria 10857
278 Ga0501032_0042504 3300049569 Bacteria 3082
279 Ga0501032_0093883 3300049569 Bacteria 1989
280 Ga0501032_0110803 3300049569 Bacteria 1816
281 Ga0501033_0008284 3300049570 Bacteria 8051
282 Ga0501033_0009083 3300049570 Bacteria 7669
283 Ga0501033_0011339 3300049570 Bacteria 6821
284 Ga0501033_0021907 3300049570 Bacteria 4822
285 Ga0501033_0036965 3300049570 Bacteria 3657
286 Ga0501033_0300225 3300049570 Bacteria 1131
287 Ga0501034_0001236 3300049571 Bacteria 34720
288 Ga0501034_0005919 3300049571 Bacteria 13268
289 Ga0501034_0024669 3300049571 Bacteria 6115
290 Ga0501034_0046529 3300049571 Bacteria 4383
291 Ga0501034_0051405 3300049571 Bacteria 4155
292 Ga0501034_0424341 3300049571 Bacteria 1250
293 Ga0501036_0013296 3300049572 Bacteria 6834
294 Ga0501036_0023300 3300049572 Bacteria 5214
295 Ga0501036_0053639 3300049572 Bacteria 3414
296 Ga0501036_0205133 3300049572 Bacteria 1657
297 Ga0501036_0317355 3300049572 Bacteria 1302
298 Ga0501037_0003406 3300049573 Bacteria 11561
299 Ga0501037_0028084 3300049573 Bacteria 4155
300 Ga0501038_0001027 3300049574 Bacteria 25180
301 Ga0501038_0023477 3300049574 Bacteria 5512
302 Ga0501039_0008445 3300049575 Bacteria 7849
303 Ga0501039_0055818 3300049575 Bacteria 3060
304 Ga0501039_0282251 3300049575 Bacteria 1305
305 Ga0501040_0000207 3300049576 Archaea 34069
306 Ga0501041_0012927 3300049577 Bacteria 4946
307 Ga0501042_0070007 3300049578 Bacteria 2509
308 Ga0501043_0042654 3300049579 Bacteria 3565
309 Ga0501046_0001009 3300049580 Bacteria 27472
310 Ga0501046_0110251 3300049580 Bacteria 2103
311 Ga0501046_0199499 3300049580 Bacteria 1489
312 Ga0501047_0013642 3300049581 Bacteria 7711
313 Ga0501047_0049259 3300049581 Bacteria 4068
314 Ga0501047_0086845 3300049581 Bacteria 3005
315 Ga0501047_0331662 3300049581 Bacteria 1360
316 Ga0501048_0046018 3300049582 Bacteria 3115
317 Ga0501067_0257447 3300049583 Bacteria 972
318 Ga0501068_0056076 3300049584 Bacteria 2388
319 Ga0501069_0283102 3300049585 Bacteria 970
320 Ga0501070_0001674 3300049586 Bacteria 19652
321 Ga0501070_0056263 3300049586 Bacteria 3261
322 Ga0501070_0075009 3300049586 Bacteria 2800
323 Ga0501070_0100991 3300049586 Bacteria 2386
324 Ga0501070_0169362 3300049586 Bacteria 1799
325 Ga0501070_0188439 3300049586 Bacteria 1696
326 Ga0501071_0188290 3300049587 Bacteria 1547
327 Ga0501072_0004925 3300049588 Bacteria 10154
328 Ga0501072_0037758 3300049588 Bacteria 3788
329 Ga0501072_0371762 3300049588 Bacteria 1135
330 Ga0501072_0452485 3300049588 Bacteria 1017
331 Ga0501073_0000063 3300049589 Bacteria 66508
332 Ga0501073_0001460 3300049589 Bacteria 17499
333 Ga0501073_0045048 3300049589 Bacteria 3108
334 Ga0501073_0045169 3300049589 Bacteria 3103
335 Ga0501073_0054551 3300049589 Bacteria 2798
336 Ga0501074_0123510 3300049590 Bacteria 1851
337 Ga0501075_0031691 3300049591 Bacteria 3926
338 Ga0501075_0032010 3300049591 Bacteria 3906
339 Ga0501076_0004403 3300049592 Bacteria 10009
340 Ga0501077_0025155 3300049593 Bacteria 3781
341 Ga0501079_0009983 3300049741 Bacteria 7207
342 Ga0501080_0023914 3300049742 Bacteria 5663
343 Ga0501080_0025887 3300049742 Bacteria 5451
344 Ga0501080_0048265 3300049742 Bacteria 3963
345 Ga0501080_0059272 3300049742 Bacteria 3563
346 Ga0501080_0060878 3300049742 Bacteria 3515
347 Ga0501080_0261114 3300049742 Bacteria 1578
348 Ga0501081_0002418 3300049743 Bacteria 11778
349 Ga0501083_0011631 3300049744 Bacteria 6176
350 Ga0501083_0092538 3300049744 Bacteria 1996
351 Ga0501083_0234368 3300049744 Bacteria 1195
352 Ga0501035_0038687 3300049822 Bacteria 4318
353 Ga0501044_0015462 3300049823 Bacteria 8219
354 Ga0501044_0178084 3300049823 Bacteria 2094
355 Ga0501044_0232502 3300049823 Bacteria 1790
356 Ga0501044_0232741 3300049823 Bacteria 1789
357 Ga0501044_0389440 3300049823 Bacteria 1308
358 Ga0501045_0005650 3300049824 Bacteria 8653
359 Ga0501045_0021444 3300049824 Bacteria 4621
360 Ga0501045_0022307 3300049824 Bacteria 4532
361 nmdc:mga00v17_8366_c1 3300050491 Bacteria 5566
362 nmdc:mga0yw44_10531_c1 3300050492 Bacteria 4729
363 nmdc:mga0yw44_2872_c1 3300050492 Bacteria 7484
364 nmdc:mga0yw44_327443_c1 3300050492 Bacteria 1029
365 nmdc:mga05p37_164093_c1 3300050507 Bacteria 2712
366 nmdc:mga05p37_21444_c2 3300050507 Bacteria 5462
367 nmdc:mga05p37_290231_c1 3300050507 Bacteria 1947
368 nmdc:mga05p37_68180_c1 3300050507 Bacteria 4375
369 nmdc:mga09592_162530_c1 3300050508 Bacteria 1929
370 nmdc:mga09592_35212_c1 3300050508 Bacteria 4190
371 nmdc:mga09592_386644_c1 3300050508 Bacteria 1210
372 nmdc:mga0qj67_498866_c1 3300050509 Bacteria 979
373 nmdc:mga0qj67_7263_c1 3300050509 Bacteria 8184
374 nmdc:mga06r32_17638_c1 3300050510 Bacteria 6521
375 nmdc:mga06r32_20092_c1 3300050510 Bacteria 6143
376 nmdc:mga06r32_55944_c1 3300050510 Bacteria 3785
377 nmdc:mga0n895_185959_c1 3300050512 Bacteria 2108
378 Ga0500635_0008410 3300053080 Bacteria 2827
379 Ga0500643_000124 3300053087 Bacteria 79663
380 Ga0500644_0000001 3300053088 Bacteria 529637
381 Ga0500651_0254232 3300053093 Bacteria 1021
382 Ga0500641_0000925 3300053096 Bacteria 10473
383 Ga0500650_0000021 3300053098 Bacteria 63762
384 Ga0500556_0000008 3300053104 Bacteria 304943
385 Ga0500556_0000527 3300053104 Bacteria 26115
386 Ga0500562_000180 3300053108 Bacteria 17367
387 Ga0500593_000024 3300053117 Bacteria 52015
388 Ga0500593_000674 3300053117 Bacteria 12998
389 Ga0500559_0000420 3300053136 Bacteria 30370
390 Ga0500559_0018868 3300053136 Bacteria 2914
391 Ga0500568_0000003 3300053139 Bacteria 863587
392 Ga0500568_0000099 3300053139 Bacteria 80197
393 Ga0500568_0004704 3300053139 Bacteria 7244
394 Ga0500568_0004874 3300053139 Bacteria 7077
395 Ga0500573_0000005 3300053140 Bacteria 315762
396 Ga0500573_0009020 3300053140 Bacteria 5517
397 Ga0500573_0153024 3300053140 Bacteria 1261
398 Ga0500577_0000002 3300053142 Bacteria 239615
399 Ga0500577_0003422 3300053142 Bacteria 4121
400 Ga0500588_0012248 3300053146 Bacteria 2122
401 Ga0500590_141738 3300053148 Bacteria 1097
402 Ga0501084_0003543 3300054114 Bacteria 12674
403 Ga0501082_0009504 3300060353 Bacteria 8369
404 Ga0501082_0570380 3300060353 Bacteria 990
405 Ga0530510_0010140 3300061734 Bacteria 6602
406 Ga0530510_0048675 3300061734 Bacteria 3064
407 Ga0530510_0073965 3300061734 Bacteria 2474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0257447 Ga0501067_0257447_18_773 234
2 3300044901 Ga0466960_0217826 Ga0466960_0217826_53_793 235
3 3300049572 Ga0501036_0317355 Ga0501036_0317355_548_1264 238
4 3300061734 Ga0530510_0048675 Ga0530510_0048675_1147_2166 246
5 3300041451 Ga0451791_0969053 Ga0451791_0969053_24_806 260
6 3300050509 nmdc:mga0qj67_498866_c1 nmdc:mga0qj67_498866_c1_10_825 262
7 3300046472 Ga0495580_0428621 Ga0495580_0428621_24_839 263
8 3300049744 Ga0501083_0234368 Ga0501083_0234368_97_888 263
9 3300034816 Ga0373930_0000293 Ga0373930_0000293_2042_2977 271
10 3300035112 Ga0373932_0000159 Ga0373932_0000159_1988_2923 271
11 3300035691 Ga0373931_0000003 Ga0373931_0000003_479869_480804 271
12 iso_pu_bacteria 2904541872 2904545616 271
13 iso_pu_bacteria 2929160207 2929168259 271
14 3300005327 Ga0070658_10000976 Ga0070658_1000097621 275
15 3300025909 Ga0207705_10001738 Ga0207705_100017383 275
16 3300049576 Ga0501040_0000207 Ga0501040_0000207_2075_2971 275
17 3300025922 Ga0207646_10287780 Ga0207646_102877802 277
18 3300044683 Ga0466965_0172433 Ga0466965_0172433_12_878 277
19 3300009101 Ga0105247_10040923 Ga0105247_100409232 279
20 3300013296 Ga0157374_10030410 Ga0157374_100304104 279
21 3300025942 Ga0207689_10156920 Ga0207689_101569202 279
22 3300026089 Ga0207648_10171946 Ga0207648_101719462 279
23 3300044712 Ga0453684_0523635 Ga0453684_0523635_226_1101 279
24 3300031995 Ga0307409_100016321 Ga0307409_1000163213 280
25 3300050508 nmdc:mga09592_162530_c1 nmdc:mga09592_162530_c1_11_904 280
26 3300031731 Ga0307405_10031487 Ga0307405_100314872 281
27 3300031911 Ga0307412_10018878 Ga0307412_100188782 281
28 3300032002 Ga0307416_100143590 Ga0307416_1001435903 281
29 3300032126 Ga0307415_100257911 Ga0307415_1002579112 281
30 3300037466 Ga0395898_0214060 Ga0395898_0214060_821_1699 281
31 3300038443 Ga0395901_0044677 Ga0395901_0044677_1233_2111 281
32 3300044683 Ga0466965_0003538 Ga0466965_0003538_101_979 281
33 3300031903 Ga0307407_10006317 Ga0307407_100063173 282
34 3300005548 Ga0070665_100121578 Ga0070665_1001215782 283
35 3300028379 Ga0268266_10152056 Ga0268266_101520562 283
36 3300031548 Ga0307408_100076904 Ga0307408_1000769042 284
37 3300042004 Ga0439445_0018285 Ga0439445_0018285_11_877 284
38 iso_pr_archaea 2597490337 2599020439 284
39 3300031901 Ga0307406_10047366 Ga0307406_100473663 285
40 3300032005 Ga0307411_10213538 Ga0307411_102135382 285
41 3300046683 Ga0495658_0252158 Ga0495658_0252158_188_1069 285
42 3300049569 Ga0501032_0110803 Ga0501032_0110803_23_907 285
43 3300049570 Ga0501033_0300225 Ga0501033_0300225_231_1115 285
44 3300049571 Ga0501034_0051405 Ga0501034_0051405_73_957 285
45 3300049574 Ga0501038_0023477 Ga0501038_0023477_3229_4113 285
46 3300049581 Ga0501047_0331662 Ga0501047_0331662_215_1099 285
47 3300049823 Ga0501044_0232741 Ga0501044_0232741_433_1317 285
48 3300049586 Ga0501070_0188439 Ga0501070_0188439_109_1020 286
49 3300049742 Ga0501080_0025887 Ga0501080_0025887_316_1227 286
50 3300049742 Ga0501080_0059272 Ga0501080_0059272_2085_2996 286
51 3300049744 Ga0501083_0011631 Ga0501083_0011631_1229_2140 286
52 3300005367 Ga0070667_100001084 Ga0070667_10000108417 287
53 3300025986 Ga0207658_10000468 Ga0207658_1000046814 287
54 3300053088 Ga0500644_0000001 Ga0500644_0000001_416503_417399 287
55 3300053096 Ga0500641_0000925 Ga0500641_0000925_3130_4026 287
56 3300053098 Ga0500650_0000021 Ga0500650_0000021_35907_36803 287
57 3300053142 Ga0500577_0000002 Ga0500577_0000002_60857_61753 287
58 iso_pu_bacteria 2643221615 2644092303 287
59 iso_pu_bacteria 2643221657 2644322106 287
60 iso_pu_bacteria 2811994874 2812330217 287
61 3300005549 Ga0070704_100090598 Ga0070704_1000905982 288
62 3300006844 Ga0075428_100073953 Ga0075428_1000739532 288
63 3300006844 Ga0075428_100242583 Ga0075428_1002425832 288
64 3300006846 Ga0075430_100007980 Ga0075430_1000079802 288
65 3300006847 Ga0075431_100001322 Ga0075431_1000013222 288
66 3300006880 Ga0075429_100016093 Ga0075429_1000160933 288
67 3300009147 Ga0114129_10075386 Ga0114129_100753862 288
68 3300031548 Ga0307408_100020202 Ga0307408_1000202022 288
69 3300032002 Ga0307416_100111768 Ga0307416_1001117682 288
70 3300032126 Ga0307415_100169315 Ga0307415_1001693152 288
71 3300046663 Ga0495635_0155661 Ga0495635_0155661_318_1208 288
72 3300048925 Ga0496122_0002555 Ga0496122_0002555_4887_5771 288
73 3300048926 Ga0496123_0013320 Ga0496123_0013320_584_1468 288
74 3300049572 Ga0501036_0053639 Ga0501036_0053639_1346_2239 288
75 3300049577 Ga0501041_0012927 Ga0501041_0012927_1009_1902 288
76 3300049580 Ga0501046_0199499 Ga0501046_0199499_294_1187 288
77 3300049582 Ga0501048_0046018 Ga0501048_0046018_131_1024 288
78 3300049586 Ga0501070_0056263 Ga0501070_0056263_596_1489 288
79 3300049587 Ga0501071_0188290 Ga0501071_0188290_52_945 288
80 3300049588 Ga0501072_0004925 Ga0501072_0004925_3225_4118 288
81 3300049588 Ga0501072_0371762 Ga0501072_0371762_136_1029 288
82 3300049591 Ga0501075_0031691 Ga0501075_0031691_39_932 288
83 3300049591 Ga0501075_0032010 Ga0501075_0032010_867_1760 288
84 3300049592 Ga0501076_0004403 Ga0501076_0004403_3080_3973 288
85 3300049593 Ga0501077_0025155 Ga0501077_0025155_742_1635 288
86 3300049741 Ga0501079_0009983 Ga0501079_0009983_3243_4136 288
87 3300049742 Ga0501080_0048265 Ga0501080_0048265_2273_3166 288
88 3300049743 Ga0501081_0002418 Ga0501081_0002418_6038_6931 288
89 3300049744 Ga0501083_0092538 Ga0501083_0092538_198_1091 288
90 3300049824 Ga0501045_0022307 Ga0501045_0022307_1773_2666 288
91 3300050507 nmdc:mga05p37_164093_c1 nmdc:mga05p37_164093_c1_143_1036 288
92 3300050507 nmdc:mga05p37_21444_c2 nmdc:mga05p37_21444_c2_1537_2430 288
93 3300050507 nmdc:mga05p37_290231_c1 nmdc:mga05p37_290231_c1_259_1152 288
94 3300050508 nmdc:mga09592_35212_c1 nmdc:mga09592_35212_c1_1576_2469 288
95 3300050508 nmdc:mga09592_386644_c1 nmdc:mga09592_386644_c1_45_938 288
96 3300050509 nmdc:mga0qj67_7263_c1 nmdc:mga0qj67_7263_c1_5409_6302 288
97 3300050510 nmdc:mga06r32_17638_c1 nmdc:mga06r32_17638_c1_2783_3676 288
98 3300050510 nmdc:mga06r32_20092_c1 nmdc:mga06r32_20092_c1_2247_3140 288
99 3300050510 nmdc:mga06r32_55944_c1 nmdc:mga06r32_55944_c1_1288_2181 288
100 3300050512 nmdc:mga0n895_185959_c1 nmdc:mga0n895_185959_c1_794_1687 288
101 3300054114 Ga0501084_0003543 Ga0501084_0003543_6410_7303 288
102 3300060353 Ga0501082_0009504 Ga0501082_0009504_1814_2707 288
103 3300061734 Ga0530510_0010140 Ga0530510_0010140_2933_3826 288
104 3300061734 Ga0530510_0073965 Ga0530510_0073965_892_1785 288
105 3300005335 Ga0070666_10039751 Ga0070666_100397513 289
106 3300005367 Ga0070667_100039929 Ga0070667_1000399292 289
107 3300005549 Ga0070704_100048804 Ga0070704_1000488042 289
108 3300005617 Ga0068859_100000011 Ga0068859_10000001158 289
109 3300005843 Ga0068860_100322654 Ga0068860_1003226541 289
110 3300006931 Ga0097620_100000011 Ga0097620_100000011195 289
111 3300009098 Ga0105245_10063265 Ga0105245_100632652 289
112 3300009176 Ga0105242_10590166 Ga0105242_105901661 289
113 3300014968 Ga0157379_10311444 Ga0157379_103114442 289
114 3300025903 Ga0207680_10206464 Ga0207680_102064642 289
115 3300025927 Ga0207687_10200003 Ga0207687_102000032 289
116 3300025941 Ga0207711_10111833 Ga0207711_101118332 289
117 3300026035 Ga0207703_10171526 Ga0207703_101715262 289
118 3300027312 Ga0209371_1020129 Ga0209371_10201292 289
119 3300030500 Ga0268256_1010322 Ga0268256_10103223 289
120 3300036401 Ga0373937_0003539 Ga0373937_0003539_7320_8213 289
121 3300046462 Ga0495651_0087987 Ga0495651_0087987_451_1344 289
122 3300046516 Ga0495628_0117188 Ga0495628_0117188_751_1647 289
123 3300046681 Ga0495647_0033588 Ga0495647_0033588_976_1869 289
124 3300005440 Ga0070705_100008931 Ga0070705_1000089315 290
125 3300006844 Ga0075428_100016232 Ga0075428_1000162328 290
126 3300006880 Ga0075429_100019489 Ga0075429_1000194895 290
127 3300013308 Ga0157375_10057903 Ga0157375_100579032 290
128 3300031649 Ga0307514_10020516 Ga0307514_100205165 290
129 3300031852 Ga0307410_10014570 Ga0307410_100145704 290
130 3300031903 Ga0307407_10038539 Ga0307407_100385393 290
131 3300031995 Ga0307409_100001515 Ga0307409_1000015154 290
132 3300032002 Ga0307416_100158505 Ga0307416_1001585052 290
133 3300049571 Ga0501034_0001236 Ga0501034_0001236_56_979 290
134 3300049584 Ga0501068_0056076 Ga0501068_0056076_1346_2269 290
135 3300049586 Ga0501070_0075009 Ga0501070_0075009_585_1508 290
136 3300049588 Ga0501072_0037758 Ga0501072_0037758_2052_2975 290
137 3300049588 Ga0501072_0452485 Ga0501072_0452485_72_953 290
138 3300049589 Ga0501073_0001460 Ga0501073_0001460_4038_4961 290
139 3300049590 Ga0501074_0123510 Ga0501074_0123510_793_1716 290
140 3300050507 nmdc:mga05p37_68180_c1 nmdc:mga05p37_68180_c1_1422_2345 290
141 iso_pu_bacteria 2852643534 2852643995 290
142 iso_pu_bacteria 2857733635 2857735068 290
143 iso_pu_bacteria 2862993130 2862994088 290
144 3300005563 Ga0068855_100023203 Ga0068855_1000232033 291
145 3300005563 Ga0068855_100165527 Ga0068855_1001655271 291
146 3300005985 Ga0081539_10075124 Ga0081539_100751242 291
147 3300006038 Ga0075365_10011262 Ga0075365_100112623 291
148 3300009093 Ga0105240_10119336 Ga0105240_101193364 291
149 3300013105 Ga0157369_10353660 Ga0157369_103536601 291
150 3300021384 Ga0213876_10007682 Ga0213876_100076825 291
151 3300021388 Ga0213875_10002389 Ga0213875_100023898 291
152 3300025927 Ga0207687_10052616 Ga0207687_100526163 291
153 3300025949 Ga0207667_10034594 Ga0207667_100345944 291
154 3300037418 Ga0395900_0005392 Ga0395900_0005392_11563_12474 291
155 3300037853 Ga0436364_1454558 Ga0436364_1454558_3626_4531 291
156 3300039437 Ga0436365_0379914 Ga0436365_0379914_5632_6537 291
157 3300039450 Ga0436363_1107981 Ga0436363_1107981_170_1075 291
158 3300044683 Ga0466965_0044457 Ga0466965_0044457_184_1089 291
159 3300044683 Ga0466965_0155677 Ga0466965_0155677_132_1037 291
160 3300044684 Ga0466966_0027871 Ga0466966_0027871_980_1888 291
161 3300044693 Ga0466961_0235733 Ga0466961_0235733_135_1043 291
162 3300044694 Ga0466963_0030350 Ga0466963_0030350_1289_2197 291
163 3300044706 Ga0466964_0005434 Ga0466964_0005434_1726_2634 291
164 3300044719 Ga0466971_0070752 Ga0466971_0070752_207_1115 291
165 3300044765 Ga0466970_0009784 Ga0466970_0009784_3636_4544 291
166 3300044842 Ga0466957_0017888 Ga0466957_0017888_1305_2213 291
167 3300044901 Ga0466960_0001267 Ga0466960_0001267_7269_8177 291
168 3300044901 Ga0466960_0012047 Ga0466960_0012047_993_1901 291
169 3300044901 Ga0466960_0027184 Ga0466960_0027184_1186_2091 291
170 3300046459 Ga0495629_0111648 Ga0495629_0111648_836_1774 291
171 3300047472 Ga0495686_0000003 Ga0495686_0000003_354440_355378 291
172 3300050492 nmdc:mga0yw44_10531_c1 nmdc:mga0yw44_10531_c1_2575_3480 291
173 3300053117 Ga0500593_000024 Ga0500593_000024_17755_18663 291
174 3300053140 Ga0500573_0009020 Ga0500573_0009020_1426_2331 291
175 iso_pu_bacteria 2939657138 2939660466 291
176 3300005458 Ga0070681_10354722 Ga0070681_103547222 292
177 3300005983 Ga0081540_1004978 Ga0081540_10049782 292
178 3300037312 Ga0395899_0004601 Ga0395899_0004601_7422_8372 292
179 3300037312 Ga0395899_0209230 Ga0395899_0209230_226_1176 292
180 3300037418 Ga0395900_0010729 Ga0395900_0010729_5011_5961 292
181 3300037466 Ga0395898_0038877 Ga0395898_0038877_677_1627 292
182 3300037466 Ga0395898_0149489 Ga0395898_0149489_1101_2051 292
183 3300038443 Ga0395901_0019142 Ga0395901_0019142_4730_5680 292
184 3300046683 Ga0495658_0166612 Ga0495658_0166612_32_1003 292
185 3300048912 Ga0496109_0143807 Ga0496109_0143807_904_1836 292
186 3300048913 Ga0496110_0172379 Ga0496110_0172379_100_1032 292
187 3300005327 Ga0070658_10031132 Ga0070658_100311322 293
188 3300005327 Ga0070658_10041206 Ga0070658_100412064 293
189 3300005435 Ga0070714_100225695 Ga0070714_1002256951 293
190 3300005456 Ga0070678_100282144 Ga0070678_1002821441 293
191 3300005459 Ga0068867_100165766 Ga0068867_1001657662 293
192 3300005530 Ga0070679_100033314 Ga0070679_1000333143 293
193 3300005563 Ga0068855_100034444 Ga0068855_1000344442 293
194 3300005563 Ga0068855_100185417 Ga0068855_1001854172 293
195 3300005614 Ga0068856_100080053 Ga0068856_1000800532 293
196 3300005616 Ga0068852_100061564 Ga0068852_1000615643 293
197 3300005616 Ga0068852_100137570 Ga0068852_1001375704 293
198 3300006175 Ga0070712_100121745 Ga0070712_1001217452 293
199 3300009098 Ga0105245_10007692 Ga0105245_1000769212 293
200 3300013104 Ga0157370_10334575 Ga0157370_103345752 293
201 3300013105 Ga0157369_10137481 Ga0157369_101374813 293
202 3300025261 Ga0209233_1003736 Ga0209233_10037363 293
203 3300025915 Ga0207693_10132058 Ga0207693_101320582 293
204 3300025919 Ga0207657_10179181 Ga0207657_101791811 293
205 3300025921 Ga0207652_10009995 Ga0207652_100099952 293
206 3300025924 Ga0207694_10061954 Ga0207694_100619542 293
207 3300025945 Ga0207679_10310278 Ga0207679_103102782 293
208 3300025949 Ga0207667_10011472 Ga0207667_100114724 293
209 3300025949 Ga0207667_10080812 Ga0207667_100808122 293
210 3300026078 Ga0207702_10385596 Ga0207702_103855961 293
211 3300026116 Ga0207674_10222053 Ga0207674_102220534 293
212 3300026116 Ga0207674_10390059 Ga0207674_103900592 293
213 3300026142 Ga0207698_10134921 Ga0207698_101349214 293
214 3300031241 Ga0265325_10003210 Ga0265325_100032105 293
215 3300031712 Ga0265342_10000678 Ga0265342_1000067816 293
216 3300049823 Ga0501044_0232502 Ga0501044_0232502_418_1374 293
217 3300049823 Ga0501044_0389440 Ga0501044_0389440_56_1012 293
218 3300005327 Ga0070658_10001447 Ga0070658_100014474 294
219 3300005327 Ga0070658_10011720 Ga0070658_100117201 294
220 3300005338 Ga0068868_100036222 Ga0068868_1000362224 294
221 3300005339 Ga0070660_100043651 Ga0070660_1000436513 294
222 3300005366 Ga0070659_100003355 Ga0070659_10000335511 294
223 3300005367 Ga0070667_100224780 Ga0070667_1002247802 294
224 3300005406 Ga0070703_10000021 Ga0070703_1000002154 294
225 3300005444 Ga0070694_100023703 Ga0070694_1000237032 294
226 3300005445 Ga0070708_100008641 Ga0070708_1000086417 294
227 3300005467 Ga0070706_100020157 Ga0070706_1000201572 294
228 3300005468 Ga0070707_100006084 Ga0070707_1000060846 294
229 3300005471 Ga0070698_100002193 Ga0070698_1000021937 294
230 3300005539 Ga0068853_100121364 Ga0068853_1001213642 294
231 3300005543 Ga0070672_100019574 Ga0070672_1000195743 294
232 3300005546 Ga0070696_100037742 Ga0070696_1000377421 294
233 3300005549 Ga0070704_100056427 Ga0070704_1000564271 294
234 3300005563 Ga0068855_100001284 Ga0068855_1000012849 294
235 3300005577 Ga0068857_100005100 Ga0068857_1000051006 294
236 3300005577 Ga0068857_100280414 Ga0068857_1002804142 294
237 3300005614 Ga0068856_100116842 Ga0068856_1001168422 294
238 3300005614 Ga0068856_100174122 Ga0068856_1001741222 294
239 3300005616 Ga0068852_100008302 Ga0068852_1000083022 294
240 3300005616 Ga0068852_100033118 Ga0068852_1000331184 294
241 3300005616 Ga0068852_100183987 Ga0068852_1001839872 294
242 3300005617 Ga0068859_100123444 Ga0068859_1001234442 294
243 3300005618 Ga0068864_100024877 Ga0068864_1000248773 294
244 3300005718 Ga0068866_10003701 Ga0068866_100037012 294
245 3300005834 Ga0068851_10000053 Ga0068851_1000005352 294
246 3300005842 Ga0068858_100000176 Ga0068858_10000017626 294
247 3300006051 Ga0075364_10071618 Ga0075364_100716182 294
248 3300006186 Ga0075369_10043320 Ga0075369_100433202 294
249 3300006931 Ga0097620_100123446 Ga0097620_1001234462 294
250 3300009093 Ga0105240_10005148 Ga0105240_1000514816 294
251 3300009093 Ga0105240_10065741 Ga0105240_100657413 294
252 3300009094 Ga0111539_10000398 Ga0111539_1000039826 294
253 3300009098 Ga0105245_10025509 Ga0105245_100255092 294
254 3300009098 Ga0105245_10053498 Ga0105245_100534982 294
255 3300009101 Ga0105247_10116831 Ga0105247_101168312 294
256 3300009101 Ga0105247_10200242 Ga0105247_102002422 294
257 3300009148 Ga0105243_10024345 Ga0105243_100243453 294
258 3300009176 Ga0105242_10004443 Ga0105242_100044435 294
259 3300009177 Ga0105248_10000897 Ga0105248_1000089712 294
260 3300009177 Ga0105248_10029387 Ga0105248_100293875 294
261 3300009545 Ga0105237_10004763 Ga0105237_100047634 294
262 3300009545 Ga0105237_10014141 Ga0105237_100141412 294
263 3300009551 Ga0105238_10000476 Ga0105238_1000047634 294
264 3300011119 Ga0105246_10181612 Ga0105246_101816122 294
265 3300013296 Ga0157374_10034123 Ga0157374_100341234 294
266 3300013297 Ga0157378_10006652 Ga0157378_100066529 294
267 3300013306 Ga0163162_10055545 Ga0163162_100555452 294
268 3300014325 Ga0163163_10031929 Ga0163163_100319295 294
269 3300014968 Ga0157379_10068421 Ga0157379_100684211 294
270 3300014969 Ga0157376_10406334 Ga0157376_104063342 294
271 3300025254 Ga0209148_1001014 Ga0209148_10010149 294
272 3300025321 Ga0207656_10000001 Ga0207656_100000011161 294
273 3300025885 Ga0207653_10000004 Ga0207653_10000004261 294
274 3300025899 Ga0207642_10001660 Ga0207642_100016605 294
275 3300025909 Ga0207705_10009264 Ga0207705_100092643 294
276 3300025911 Ga0207654_10000001 Ga0207654_10000001473 294
277 3300025913 Ga0207695_10001399 Ga0207695_100013999 294
278 3300025913 Ga0207695_10002309 Ga0207695_100023095 294
279 3300025913 Ga0207695_10002481 Ga0207695_100024819 294
280 3300025914 Ga0207671_10000001 Ga0207671_100000011160 294
281 3300025914 Ga0207671_10003504 Ga0207671_100035044 294
282 3300025919 Ga0207657_10007809 Ga0207657_100078095 294
283 3300025922 Ga0207646_10004377 Ga0207646_1000437710 294
284 3300025924 Ga0207694_10000019 Ga0207694_1000001967 294
285 3300025927 Ga0207687_10030424 Ga0207687_100304244 294
286 3300025932 Ga0207690_10002616 Ga0207690_100026164 294
287 3300025934 Ga0207686_10024326 Ga0207686_100243264 294
288 3300025940 Ga0207691_10023123 Ga0207691_100231233 294
289 3300025941 Ga0207711_10000405 Ga0207711_1000040536 294
290 3300025941 Ga0207711_10016898 Ga0207711_100168985 294
291 3300025949 Ga0207667_10000498 Ga0207667_1000049814 294
292 3300026023 Ga0207677_10020549 Ga0207677_100205492 294
293 3300026023 Ga0207677_10080037 Ga0207677_100800372 294
294 3300026035 Ga0207703_10000121 Ga0207703_1000012134 294
295 3300026041 Ga0207639_10025918 Ga0207639_100259183 294
296 3300026078 Ga0207702_10140588 Ga0207702_101405882 294
297 3300026088 Ga0207641_10022978 Ga0207641_100229784 294
298 3300026088 Ga0207641_10075488 Ga0207641_100754882 294
299 3300026095 Ga0207676_10027237 Ga0207676_100272373 294
300 3300026116 Ga0207674_10016735 Ga0207674_100167354 294
301 3300026116 Ga0207674_10415914 Ga0207674_104159142 294
302 3300026142 Ga0207698_10008089 Ga0207698_100080896 294
303 3300026142 Ga0207698_10021347 Ga0207698_100213472 294
304 3300026142 Ga0207698_10023507 Ga0207698_100235074 294
305 3300030745 Ga0316182_1003868 Ga0316182_10038683 294
306 3300041413 Ga0439465_0031616 Ga0439465_0031616_238_1137 294
307 3300041443 Ga0451789_0054370 Ga0451789_0054370_1337_2221 294
308 3300041452 Ga0451793_0123572 Ga0451793_0123572_2449_3333 294
309 3300044683 Ga0466965_0000004 Ga0466965_0000004_129456_130340 294
310 3300046455 Ga0495603_0011205 Ga0495603_0011205_2861_3898 294
311 3300046471 Ga0495650_0000211 Ga0495650_0000211_89348_90238 294
312 3300046615 Ga0495656_0073425 Ga0495656_0073425_547_1431 294
313 3300047320 Ga0495672_0045936 Ga0495672_0045936_23_907 294
314 3300047320 Ga0495672_0058945 Ga0495672_0058945_471_1373 294
315 3300048904 Ga0496101_0005788 Ga0496101_0005788_4010_5047 294
316 3300048910 Ga0496107_0012077 Ga0496107_0012077_2578_3615 294
317 3300048920 Ga0496117_0006843 Ga0496117_0006843_4700_5590 294
318 3300048921 Ga0496118_0029100 Ga0496118_0029100_3392_4282 294
319 3300048922 Ga0496119_0007823 Ga0496119_0007823_6786_7676 294
320 3300048922 Ga0496119_0043948 Ga0496119_0043948_222_1112 294
321 3300048923 Ga0496120_0004926 Ga0496120_0004926_7162_8052 294
322 3300048923 Ga0496120_0008003 Ga0496120_0008003_5653_6543 294
323 3300048923 Ga0496120_0052715 Ga0496120_0052715_384_1274 294
324 3300048929 Ga0496126_0029791 Ga0496126_0029791_936_1844 294
325 3300048929 Ga0496126_0033914 Ga0496126_0033914_2379_3269 294
326 3300048929 Ga0496126_0349439 Ga0496126_0349439_303_1193 294
327 3300049569 Ga0501032_0093883 Ga0501032_0093883_713_1597 294
328 3300049570 Ga0501033_0021907 Ga0501033_0021907_486_1370 294
329 3300049570 Ga0501033_0036965 Ga0501033_0036965_1424_2308 294
330 3300049571 Ga0501034_0024669 Ga0501034_0024669_1410_2315 294
331 3300049571 Ga0501034_0046529 Ga0501034_0046529_2849_3733 294
332 3300049571 Ga0501034_0424341 Ga0501034_0424341_36_941 294
333 3300049572 Ga0501036_0205133 Ga0501036_0205133_413_1297 294
334 3300049573 Ga0501037_0028084 Ga0501037_0028084_2845_3729 294
335 3300049575 Ga0501039_0055818 Ga0501039_0055818_1503_2387 294
336 3300049586 Ga0501070_0001674 Ga0501070_0001674_14393_15298 294
337 3300049586 Ga0501070_0100991 Ga0501070_0100991_158_1042 294
338 3300049589 Ga0501073_0000063 Ga0501073_0000063_5150_6055 294
339 3300049589 Ga0501073_0045048 Ga0501073_0045048_2157_3062 294
340 3300049742 Ga0501080_0023914 Ga0501080_0023914_2019_2924 294
341 3300049742 Ga0501080_0261114 Ga0501080_0261114_130_1035 294
342 3300050491 nmdc:mga00v17_8366_c1 nmdc:mga00v17_8366_c1_4192_5094 294
343 3300050492 nmdc:mga0yw44_2872_c1 nmdc:mga0yw44_2872_c1_1346_2248 294
344 3300050492 nmdc:mga0yw44_327443_c1 nmdc:mga0yw44_327443_c1_105_1004 294
345 3300053080 Ga0500635_0008410 Ga0500635_0008410_1187_2077 294
346 3300053087 Ga0500643_000124 Ga0500643_000124_61363_62262 294
347 3300053093 Ga0500651_0254232 Ga0500651_0254232_18_902 294
348 3300053104 Ga0500556_0000008 Ga0500556_0000008_273439_274323 294
349 3300053104 Ga0500556_0000527 Ga0500556_0000527_15090_15998 294
350 3300053108 Ga0500562_000180 Ga0500562_000180_14043_14942 294
351 3300053117 Ga0500593_000674 Ga0500593_000674_5130_6038 294
352 3300053136 Ga0500559_0000420 Ga0500559_0000420_15157_16062 294
353 3300053136 Ga0500559_0018868 Ga0500559_0018868_927_1811 294
354 3300053139 Ga0500568_0000003 Ga0500568_0000003_30621_31505 294
355 3300053139 Ga0500568_0000099 Ga0500568_0000099_29157_30041 294
356 3300053139 Ga0500568_0004704 Ga0500568_0004704_5810_6709 294
357 3300053139 Ga0500568_0004874 Ga0500568_0004874_1995_2900 294
358 3300053140 Ga0500573_0000005 Ga0500573_0000005_122005_122889 294
359 3300053140 Ga0500573_0153024 Ga0500573_0153024_247_1131 294
360 3300053146 Ga0500588_0012248 Ga0500588_0012248_753_1658 294
361 3300053148 Ga0500590_141738 Ga0500590_141738_113_1018 294
362 iso_pu_bacteria 2857737099 2857738791 294
363 3300003758 Ga0055532_1003448 Ga0055532_10034482 295
364 3300005445 Ga0070708_100013582 Ga0070708_1000135825 295
365 3300005467 Ga0070706_100046016 Ga0070706_1000460161 295
366 3300005468 Ga0070707_100011223 Ga0070707_1000112233 295
367 3300005471 Ga0070698_100002660 Ga0070698_10000266014 295
368 3300005536 Ga0070697_100006988 Ga0070697_1000069884 295
369 3300013104 Ga0157370_10137822 Ga0157370_101378222 295
370 3300013307 Ga0157372_10487668 Ga0157372_104876682 295
371 3300020080 Ga0206350_10494122 Ga0206350_104941222 295
372 3300020082 Ga0206353_11519911 Ga0206353_115199112 295
373 3300022467 Ga0224712_10042794 Ga0224712_100427942 295
374 3300025253 Ga0209677_100271 Ga0209677_10027132 295
375 3300025272 Ga0209455_1004265 Ga0209455_10042654 295
376 3300025910 Ga0207684_10019133 Ga0207684_100191333 295
377 3300025910 Ga0207684_10163511 Ga0207684_101635111 295
378 3300025922 Ga0207646_10046370 Ga0207646_100463702 295
379 3300025923 Ga0207681_10251452 Ga0207681_102514522 295
380 3300026067 Ga0207678_10176304 Ga0207678_101763042 295
381 3300026078 Ga0207702_10044197 Ga0207702_100441972 295
382 3300037312 Ga0395899_0007189 Ga0395899_0007189_4249_5136 295
383 3300038443 Ga0395901_0321484 Ga0395901_0321484_532_1419 295
384 3300048917 Ga0496114_0143116 Ga0496114_0143116_300_1187 295
385 3300048928 Ga0496125_0127401 Ga0496125_0127401_88_984 295
386 3300049568 Ga0501031_0008686 Ga0501031_0008686_1812_2699 295
387 3300049568 Ga0501031_0164248 Ga0501031_0164248_43_930 295
388 3300049569 Ga0501032_0004227 Ga0501032_0004227_2653_3540 295
389 3300049569 Ga0501032_0042504 Ga0501032_0042504_1943_2830 295
390 3300049570 Ga0501033_0008284 Ga0501033_0008284_2644_3531 295
391 3300049570 Ga0501033_0009083 Ga0501033_0009083_4200_5087 295
392 3300049570 Ga0501033_0011339 Ga0501033_0011339_541_1428 295
393 3300049571 Ga0501034_0005919 Ga0501034_0005919_5064_5951 295
394 3300049572 Ga0501036_0013296 Ga0501036_0013296_834_1721 295
395 3300049572 Ga0501036_0023300 Ga0501036_0023300_2042_2929 295
396 3300049573 Ga0501037_0003406 Ga0501037_0003406_5071_5958 295
397 3300049574 Ga0501038_0001027 Ga0501038_0001027_19813_20700 295
398 3300049575 Ga0501039_0008445 Ga0501039_0008445_6478_7365 295
399 3300049575 Ga0501039_0282251 Ga0501039_0282251_381_1268 295
400 3300049578 Ga0501042_0070007 Ga0501042_0070007_482_1369 295
401 3300049579 Ga0501043_0042654 Ga0501043_0042654_1322_2209 295
402 3300049580 Ga0501046_0001009 Ga0501046_0001009_21863_22750 295
403 3300049580 Ga0501046_0110251 Ga0501046_0110251_381_1268 295
404 3300049581 Ga0501047_0013642 Ga0501047_0013642_5268_6155 295
405 3300049581 Ga0501047_0049259 Ga0501047_0049259_1971_2858 295
406 3300049581 Ga0501047_0086845 Ga0501047_0086845_1757_2644 295
407 3300049585 Ga0501069_0283102 Ga0501069_0283102_10_897 295
408 3300049586 Ga0501070_0169362 Ga0501070_0169362_505_1392 295
409 3300049589 Ga0501073_0045169 Ga0501073_0045169_1235_2122 295
410 3300049589 Ga0501073_0054551 Ga0501073_0054551_1086_1973 295
411 3300049742 Ga0501080_0060878 Ga0501080_0060878_1262_2149 295
412 3300049822 Ga0501035_0038687 Ga0501035_0038687_2596_3483 295
413 3300049823 Ga0501044_0015462 Ga0501044_0015462_133_1020 295
414 3300049823 Ga0501044_0178084 Ga0501044_0178084_998_1885 295
415 3300049824 Ga0501045_0005650 Ga0501045_0005650_2234_3121 295
416 3300049824 Ga0501045_0021444 Ga0501045_0021444_3115_4002 295
417 3300053142 Ga0500577_0003422 Ga0500577_0003422_1927_2814 295
418 3300060353 Ga0501082_0570380 Ga0501082_0570380_27_914 295
419 iso_pu_bacteria 8046352972 8046354590 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

8

166

0.96

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

192

231

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v3o-assembly1.cif.gz_A crystal structure of tetx2 t280a: an adaptive mutant in complex with tigecycline 0.9402 2 30
3v3n-assembly3.cif.gz_C crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.936 2 30
3v3n-assembly4.cif.gz_D crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9356 2 30
3v3n-assembly1.cif.gz_A crystal structure of tetx2 t280a: an adaptive mutant in complex with minocycline 0.9352 2 30
3rp7-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae hpxo complexed with fad and uric acid 0.935 1 30
ID Description Score Start End Superfamily
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 2 162 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 1 128 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9296 2 30 3.50.50.60
2y6qB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9288 2 29 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9282 3 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7K2P8W7-F1-model_v4 6-phosphogluconate dehydrogenase 0.9977 1 113 GO:0004616
GO:0050661
AF-A0A7K0RNE6-F1-model_v4 deleted 0.997 1 97
AF-A0A6B3FZF1-F1-model_v4 6-phosphogluconate dehydrogenase 0.997 23 112 GO:0004616
GO:0050661
AF-A0A4Q5YXB7-F1-model_v4 deleted 0.9962 1 125
AF-A0A0D5CEP4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9945 1 295 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661

Feature Viewer

pLDDT pTM Quality
93.72 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map