F439389

General Info

Members Datasets Scaffolds Average Seq Length
418 282 418 126

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0054363|Ga0496118_0054363_665_1132
Length 155
Sequence LICSDYWHRAHDPEKWRPVFGSDHAQKQGEDMQDEPRPDELVKAVADFLRNDIAPQISGHAAFKLRVAINALDLVTRQLTLAGDSDAAELHGLTMLLGVHGTLDGLNQDLADRIAQGDIDLTTPGVKEHLWQTTLAKLAVDQPNYGSYKRELEPK

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
240 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
244 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
248 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
254 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
255 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
256 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
259 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
273 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
277 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 0
Rhizoplane 1.44
Rhizosphere 70.57
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10049709 3300002077 Bacteria 774
2 Ga0065165_1061690 3300005262 Bacteria 1025
3 Ga0070683_100172892 3300005329 Bacteria 2051
4 Ga0070690_100058058 3300005330 Bacteria 2484
5 Ga0070666_10038193 3300005335 Bacteria 3194
6 Ga0070680_100007389 3300005336 Bacteria 8386
7 Ga0070680_101541969 3300005336 Bacteria 575
8 Ga0070682_100155311 3300005337 Bacteria 1574
9 Ga0070660_100031034 3300005339 Bacteria 4011
10 Ga0070691_10682683 3300005341 Bacteria 615
11 Ga0070661_100113731 3300005344 Bacteria 2023
12 Ga0070668_100359354 3300005347 Bacteria 1234
13 Ga0070673_101458785 3300005364 Bacteria 645
14 Ga0070659_100656577 3300005366 Bacteria 904
15 Ga0070659_101205208 3300005366 Bacteria 669
16 Ga0070667_100613874 3300005367 Bacteria 1002
17 Ga0070709_10016067 3300005434 Bacteria 4266
18 Ga0070714_100294234 3300005435 Bacteria 1512
19 Ga0070713_100160598 3300005436 Bacteria 2006
20 Ga0070710_10022746 3300005437 Bacteria 3284
21 Ga0070710_11423936 3300005437 Bacteria 519
22 Ga0070701_10039619 3300005438 Bacteria 2391
23 Ga0070711_100074531 3300005439 Bacteria 2400
24 Ga0070700_100038164 3300005441 Bacteria 2926
25 Ga0070708_100918273 3300005445 Bacteria 822
26 Ga0070663_100071910 3300005455 Bacteria 2518
27 Ga0070663_100288993 3300005455 Bacteria 1309
28 Ga0070663_100305072 3300005455 Bacteria 1276
29 Ga0070663_101777163 3300005455 Bacteria 552
30 Ga0070678_100015766 3300005456 Bacteria 4813
31 Ga0070678_100081184 3300005456 Bacteria 2457
32 Ga0070662_100174890 3300005457 Bacteria 1688
33 Ga0070681_10292834 3300005458 Bacteria 1538
34 Ga0070681_10423433 3300005458 Bacteria 1243
35 Ga0070681_10924128 3300005458 Bacteria 791
36 Ga0070681_11378498 3300005458 Bacteria 628
37 Ga0068867_100320231 3300005459 Bacteria 1284
38 Ga0070685_10240521 3300005466 Bacteria 1195
39 Ga0070679_100139562 3300005530 Bacteria 2404
40 Ga0070679_100358580 3300005530 Bacteria 1405
41 Ga0070679_100376984 3300005530 Bacteria 1365
42 Ga0070679_100426980 3300005530 Bacteria 1270
43 Ga0070684_100106654 3300005535 Bacteria 2508
44 Ga0070697_100138279 3300005536 Bacteria 2047
45 Ga0068853_100055730 3300005539 Bacteria 3407
46 Ga0068853_100148017 3300005539 Bacteria 2112
47 Ga0068853_100172343 3300005539 Bacteria 1958
48 Ga0068853_100284872 3300005539 Bacteria 1524
49 Ga0068853_100633780 3300005539 Bacteria 1017
50 Ga0070672_100033812 3300005543 Bacteria 3875
51 Ga0070693_100036806 3300005547 Bacteria 2723
52 Ga0070665_100608590 3300005548 Bacteria 1106
53 Ga0070704_100295425 3300005549 Bacteria 1348
54 Ga0068855_100128442 3300005563 Bacteria 2896
55 Ga0068855_100232775 3300005563 Bacteria 2062
56 Ga0068855_100545390 3300005563 Bacteria 1256
57 Ga0068855_102134287 3300005563 Bacteria 563
58 Ga0070664_100795987 3300005564 Bacteria 884
59 Ga0068857_100105694 3300005577 Bacteria 2528
60 Ga0068854_100451516 3300005578 Bacteria 1074
61 Ga0068856_100052958 3300005614 Bacteria 4003
62 Ga0070702_100697112 3300005615 Bacteria 773
63 Ga0070702_101158828 3300005615 Bacteria 621
64 Ga0068852_100494051 3300005616 Bacteria 1218
65 Ga0068859_100755891 3300005617 Bacteria 1061
66 Ga0068866_10035166 3300005718 Bacteria 2445
67 Ga0068861_100269480 3300005719 Bacteria 1461
68 Ga0068861_102040495 3300005719 Bacteria 573
69 Ga0068870_10192013 3300005840 Bacteria 1233
70 Ga0068858_101813642 3300005842 Bacteria 603
71 Ga0068860_100289130 3300005843 Bacteria 1603
72 Ga0081455_10029336 3300005937 Bacteria 5016
73 Ga0081540_1036331 3300005983 Bacteria 2628
74 Ga0070717_10157941 3300006028 Bacteria 1966
75 Ga0070717_10544488 3300006028 Bacteria 1051
76 Ga0070717_10777688 3300006028 Bacteria 870
77 Ga0075365_10010590 3300006038 Bacteria 5380
78 Ga0075365_10219578 3300006038 Bacteria 1333
79 Ga0075363_100157866 3300006048 Bacteria 1283
80 Ga0075364_10105790 3300006051 Bacteria 1875
81 Ga0070716_100155776 3300006173 Bacteria 1475
82 Ga0075369_10005935 3300006186 Bacteria 4594
83 Ga0075370_10128050 3300006353 Bacteria 1481
84 Ga0068871_100528645 3300006358 Bacteria 1066
85 Ga0068871_100871097 3300006358 Bacteria 833
86 Ga0075434_100808064 3300006871 Bacteria 954
87 Ga0068865_100121416 3300006881 Bacteria 1943
88 Ga0097620_100756011 3300006931 Bacteria 1061
89 Ga0099794_10051835 3300007265 Bacteria 1977
90 Ga0105240_10189307 3300009093 Bacteria 2421
91 Ga0105240_10364428 3300009093 Bacteria 1636
92 Ga0105243_10077605 3300009148 Bacteria 2702
93 Ga0105248_10355813 3300009177 Bacteria 1649
94 Ga0105237_10084021 3300009545 Bacteria 3174
95 Ga0105237_11181696 3300009545 Bacteria 772
96 Ga0105237_11441453 3300009545 Bacteria 695
97 Ga0105238_10053335 3300009551 Bacteria 4063
98 Ga0105238_10100152 3300009551 Bacteria 2881
99 Ga0105238_10940108 3300009551 Bacteria 884
100 Ga0105238_11031944 3300009551 Bacteria 844
101 Ga0105238_11095211 3300009551 Bacteria 819
102 Ga0105249_10526570 3300009553 Bacteria 1230
103 Ga0105249_10987675 3300009553 Bacteria 910
104 Ga0099796_10248810 3300010159 Bacteria 737
105 Ga0105239_10118317 3300010375 Bacteria 2940
106 Ga0105239_11467835 3300010375 Bacteria 788
107 Ga0105239_12608125 3300010375 Bacteria 589
108 Ga0157336_1021652 3300012477 Bacteria 586
109 Ga0157373_10422977 3300013100 Bacteria 956
110 Ga0157371_10195502 3300013102 Bacteria 1449
111 Ga0157370_10230389 3300013104 Bacteria 1715
112 Ga0157370_10287386 3300013104 Bacteria 1519
113 Ga0157370_11787725 3300013104 Bacteria 552
114 Ga0157369_10023406 3300013105 Bacteria 6879
115 Ga0157369_10210761 3300013105 Bacteria 2036
116 Ga0157369_12168543 3300013105 Bacteria 563
117 Ga0157369_12206903 3300013105 Bacteria 558
118 Ga0157374_11770303 3300013296 Bacteria 643
119 Ga0157378_10053833 3300013297 Bacteria 3583
120 Ga0157378_10207045 3300013297 Bacteria 1858
121 Ga0163162_10744684 3300013306 Bacteria 1100
122 Ga0157372_11744827 3300013307 Bacteria 716
123 Ga0157372_12065312 3300013307 Bacteria 655
124 Ga0157375_10388145 3300013308 Bacteria 1563
125 Ga0157380_10769004 3300014326 Bacteria 977
126 Ga0163161_10373389 3300017792 Bacteria 1138
127 Ga0206353_10888638 3300020082 Bacteria 502
128 Ga0213876_10140856 3300021384 Bacteria 1283
129 Ga0213876_10367344 3300021384 Bacteria 765
130 Ga0213875_10513547 3300021388 Bacteria 576
131 Ga0209564_1012301 3300025295 Bacteria 3744
132 Ga0209758_1001389 3300025297 Bacteria 28787
133 Ga0209758_1122871 3300025297 Bacteria 698
134 Ga0209256_1054405 3300025299 Bacteria 954
135 Ga0207682_10156823 3300025893 Bacteria 1029
136 Ga0207692_10089711 3300025898 Bacteria 1664
137 Ga0207642_10032263 3300025899 Bacteria 2203
138 Ga0207688_10080193 3300025901 Bacteria 1863
139 Ga0207688_10111212 3300025901 Bacteria 1590
140 Ga0207699_10015638 3300025906 Bacteria 3947
141 Ga0207699_10223569 3300025906 Bacteria 1286
142 Ga0207645_10025563 3300025907 Bacteria 3820
143 Ga0207643_10256456 3300025908 Bacteria 1079
144 Ga0207705_10062712 3300025909 Bacteria 2685
145 Ga0207705_10089169 3300025909 Bacteria 2257
146 Ga0207654_10736031 3300025911 Bacteria 710
147 Ga0207707_10003914 3300025912 Bacteria 13215
148 Ga0207695_10101630 3300025913 Bacteria 2869
149 Ga0207695_10686317 3300025913 Bacteria 905
150 Ga0207671_10059694 3300025914 Bacteria 2829
151 Ga0207671_10824282 3300025914 Bacteria 735
152 Ga0207671_10956806 3300025914 Bacteria 676
153 Ga0207663_10052543 3300025916 Bacteria 2542
154 Ga0207660_10007130 3300025917 Bacteria 7239
155 Ga0207660_10127243 3300025917 Bacteria 1936
156 Ga0207657_10001107 3300025919 Bacteria 28599
157 Ga0207657_10003265 3300025919 Bacteria 17354
158 Ga0207657_10113495 3300025919 Bacteria 2235
159 Ga0207652_10006801 3300025921 Bacteria 9217
160 Ga0207652_10107372 3300025921 Bacteria 2472
161 Ga0207652_10222297 3300025921 Bacteria 1701
162 Ga0207652_10239816 3300025921 Bacteria 1634
163 Ga0207694_10272395 3300025924 Bacteria 1389
164 Ga0207694_11450643 3300025924 Bacteria 580
165 Ga0207659_10989090 3300025926 Bacteria 724
166 Ga0207700_10030198 3300025928 Bacteria 3835
167 Ga0207700_10032738 3300025928 Bacteria 3712
168 Ga0207664_10174642 3300025929 Bacteria 1841
169 Ga0207664_10741659 3300025929 Bacteria 883
170 Ga0207690_10628948 3300025932 Bacteria 878
171 Ga0207706_10068509 3300025933 Bacteria 3122
172 Ga0207709_10064742 3300025935 Bacteria 2297
173 Ga0207669_10044284 3300025937 Bacteria 2613
174 Ga0207704_10383072 3300025938 Bacteria 1104
175 Ga0207665_10139544 3300025939 Bacteria 1727
176 Ga0207691_10174632 3300025940 Bacteria 1880
177 Ga0207711_10742657 3300025941 Bacteria 915
178 Ga0207689_10347380 3300025942 Bacteria 1233
179 Ga0207661_10316817 3300025944 Bacteria 1401
180 Ga0207679_11060235 3300025945 Bacteria 743
181 Ga0207667_10006765 3300025949 Bacteria 13842
182 Ga0207667_10286473 3300025949 Bacteria 1683
183 Ga0207667_10687616 3300025949 Bacteria 1026
184 Ga0207667_11049112 3300025949 Bacteria 800
185 Ga0207651_10676730 3300025960 Bacteria 907
186 Ga0207712_10050677 3300025961 Bacteria 2900
187 Ga0207712_11383037 3300025961 Bacteria 630
188 Ga0207668_10073062 3300025972 Bacteria 2456
189 Ga0207668_11364262 3300025972 Bacteria 639
190 Ga0207658_10879161 3300025986 Bacteria 815
191 Ga0207658_11133011 3300025986 Bacteria 715
192 Ga0207639_10082247 3300026041 Bacteria 2552
193 Ga0207639_11029962 3300026041 Bacteria 771
194 Ga0207678_10243027 3300026067 Bacteria 1542
195 Ga0207678_10314679 3300026067 Bacteria 1346
196 Ga0207678_10549058 3300026067 Bacteria 1010
197 Ga0207708_10020945 3300026075 Bacteria 4933
198 Ga0207702_10000779 3300026078 Bacteria 33703
199 Ga0207648_10295404 3300026089 Bacteria 1452
200 Ga0207674_10026227 3300026116 Bacteria 6196
201 Ga0207675_100054504 3300026118 Bacteria 3730
202 Ga0207675_101588932 3300026118 Bacteria 674
203 Ga0207683_10135032 3300026121 Bacteria 2221
204 Ga0207683_10417393 3300026121 Bacteria 1236
205 Ga0268266_10804910 3300028379 Bacteria 908
206 Ga0268264_10246093 3300028381 Bacteria 1659
207 Ga0268264_11302069 3300028381 Bacteria 737
208 Ga0307517_10222087 3300028786 Bacteria 1147
209 Ga0307515_10160916 3300028794 Bacteria 2290
210 Ga0307511_10257392 3300030521 Bacteria 831
211 Ga0265330_10080250 3300031235 Bacteria 1406
212 Ga0265331_10085570 3300031250 Bacteria 1461
213 Ga0307513_10303541 3300031456 Bacteria 1362
214 Ga0307509_10005003 3300031507 Bacteria 18702
215 Ga0307509_10506323 3300031507 Bacteria 891
216 Ga0307408_101759755 3300031548 Bacteria 592
217 Ga0307508_10156499 3300031616 Bacteria 1882
218 Ga0265314_10003829 3300031711 Bacteria 14364
219 Ga0307507_10135440 3300033179 Bacteria 1910
220 Ga0307510_10304132 3300033180 Bacteria 1056
221 Ga0373926_0170328 3300035083 Bacteria 833
222 Ga0373960_0237389 3300035121 Bacteria 658
223 Ga0373927_0004710 3300035695 Bacteria 9507
224 Ga0373927_0370666 3300035695 Bacteria 944
225 Ga0373927_0639096 3300035695 Bacteria 703
226 Ga0373933_0312628 3300035724 Bacteria 1018
227 Ga0373947_0028170 3300035725 Bacteria 3291
228 Ga0373947_0435920 3300035725 Bacteria 887
229 Ga0436364_0235057 3300037853 Bacteria 711
230 Ga0436364_0342884 3300037853 Bacteria 3145
231 Ga0436364_1488077 3300037853 Bacteria 790
232 Ga0436365_0236628 3300039437 Bacteria 541
233 Ga0436365_0602497 3300039437 Bacteria 768
234 Ga0436365_1775282 3300039437 Bacteria 1162
235 Ga0436361_0113118 3300039447 Bacteria 523
236 Ga0451847_0693823 3300041503 Bacteria 526
237 Ga0466970_0236486 3300044765 Bacteria 1022
238 Ga0466957_0020953 3300044842 Bacteria 3847
239 Ga0466959_0008200 3300045049 Bacteria 7372
240 Ga0466967_0052094 3300045976 Bacteria 3590
241 Ga0466967_0291737 3300045976 Bacteria 1567
242 Ga0466967_1033854 3300045976 Bacteria 818
243 Ga0495590_0372221 3300046457 Bacteria 545
244 Ga0495638_0006147 3300046460 Bacteria 8778
245 Ga0495638_0021606 3300046460 Bacteria 4238
246 Ga0495638_0156399 3300046460 Bacteria 1318
247 Ga0495585_0529522 3300046492 Bacteria 558
248 Ga0495596_0206394 3300046500 Bacteria 763
249 Ga0495596_0326209 3300046500 Bacteria 597
250 Ga0495607_0021583 3300046501 Bacteria 4050
251 Ga0495607_0411769 3300046501 Bacteria 613
252 Ga0495583_0074598 3300046506 Bacteria 1485
253 Ga0495583_0351697 3300046506 Bacteria 581
254 Ga0495606_0497871 3300046507 Bacteria 616
255 Ga0495610_0052281 3300046512 Bacteria 1984
256 Ga0495616_0387549 3300046513 Bacteria 576
257 Ga0495620_0027189 3300046515 Bacteria 2680
258 Ga0495631_0170698 3300046518 Bacteria 933
259 Ga0495631_0174257 3300046518 Bacteria 922
260 Ga0495631_0309673 3300046518 Bacteria 672
261 Ga0495632_0058973 3300046519 Bacteria 1869
262 Ga0495643_0478199 3300046522 Bacteria 539
263 Ga0495648_0001581 3300046524 Bacteria 22185
264 Ga0495648_0106511 3300046524 Bacteria 1535
265 Ga0495666_0406740 3300046526 Bacteria 611
266 Ga0495654_0057472 3300046530 Bacteria 1879
267 Ga0495654_0316291 3300046530 Bacteria 634
268 Ga0495586_0214964 3300046535 Bacteria 1092
269 Ga0495597_0195007 3300046542 Bacteria 813
270 Ga0495645_0141104 3300046543 Bacteria 1681
271 Ga0495622_0351620 3300046557 Bacteria 638
272 Ga0495625_0378990 3300046660 Bacteria 888
273 Ga0495625_0396425 3300046660 Bacteria 863
274 Ga0495625_0603085 3300046660 Bacteria 659
275 Ga0495661_0087118 3300046665 Bacteria 1786
276 Ga0495661_0612512 3300046665 Bacteria 511
277 Ga0495599_0125275 3300046678 Bacteria 1597
278 Ga0495669_0002591 3300046684 Bacteria 7392
279 Ga0495613_0102551 3300046689 Bacteria 2066
280 Ga0495670_0069818 3300046691 Bacteria 1777
281 Ga0495670_0324126 3300046691 Bacteria 827
282 Ga0495671_0386506 3300046692 Bacteria 670
283 Ga0495671_0443905 3300046692 Bacteria 620
284 Ga0495660_0103989 3300046810 Bacteria 1458
285 Ga0495681_0069341 3300047470 Bacteria 1602
286 Ga0495686_0023146 3300047472 Bacteria 4101
287 Ga0495593_0234013 3300047673 Bacteria 921
288 Ga0496101_0036213 3300048904 Bacteria 3495
289 Ga0496102_1279632 3300048905 Bacteria 653
290 Ga0496102_1650481 3300048905 Bacteria 559
291 Ga0496111_0294099 3300048914 Bacteria 1204
292 Ga0496113_0434250 3300048916 Bacteria 1055
293 Ga0496114_0054141 3300048917 Bacteria 3346
294 Ga0496116_0001079 3300048919 Bacteria 32822
295 Ga0496117_0062392 3300048920 Bacteria 2554
296 Ga0496117_0072971 3300048920 Bacteria 2291
297 Ga0496117_0318226 3300048920 Bacteria 816
298 Ga0496118_0054363 3300048921 Bacteria 3033
299 Ga0496118_0108334 3300048921 Bacteria 1852
300 Ga0496118_0141975 3300048921 Bacteria 1520
301 Ga0496118_0213227 3300048921 Bacteria 1131
302 Ga0496119_0385332 3300048922 Bacteria 671
303 Ga0496121_0002000 3300048924 Bacteria 32381
304 Ga0496121_0004531 3300048924 Bacteria 18595
305 Ga0496121_0008731 3300048924 Bacteria 11827
306 Ga0496121_0036259 3300048924 Bacteria 4397
307 Ga0496121_0619636 3300048924 Bacteria 664
308 Ga0496122_0026282 3300048925 Bacteria 5023
309 Ga0496122_0115865 3300048925 Bacteria 1744
310 Ga0496123_0009805 3300048926 Bacteria 8554
311 Ga0496124_0016295 3300048927 Bacteria 7076
312 Ga0496124_0329718 3300048927 Bacteria 1089
313 Ga0496125_0010155 3300048928 Bacteria 9542
314 Ga0496125_0020224 3300048928 Bacteria 6252
315 Ga0496126_0010504 3300048929 Bacteria 9695
316 Ga0496126_0019779 3300048929 Bacteria 6624
317 Ga0496126_0038161 3300048929 Bacteria 4472
318 Ga0496126_0069195 3300048929 Bacteria 3149
319 Ga0496126_0249785 3300048929 Bacteria 1479
320 Ga0496126_0281922 3300048929 Bacteria 1376
321 Ga0495678_103743 3300049459 Bacteria 982
322 Ga0501031_0001416 3300049568 Bacteria 14844
323 Ga0501032_0001535 3300049569 Bacteria 18415
324 Ga0501033_0000311 3300049570 Bacteria 46039
325 Ga0501034_0000039 3300049571 Bacteria 237357
326 Ga0501036_0000127 3300049572 Bacteria 48559
327 Ga0501037_0000025 3300049573 Bacteria 143276
328 Ga0501038_0000168 3300049574 Bacteria 55496
329 Ga0501039_0001738 3300049575 Bacteria 16057
330 Ga0501042_0100718 3300049578 Bacteria 2077
331 Ga0501043_0000120 3300049579 Bacteria 72670
332 Ga0501046_0000359 3300049580 Bacteria 45929
333 Ga0501047_0000379 3300049581 Bacteria 50147
334 Ga0501047_0297069 3300049581 Bacteria 1458
335 Ga0501047_1099645 3300049581 Bacteria 608
336 Ga0501048_0005136 3300049582 Bacteria 9969
337 Ga0501067_0000025 3300049583 Bacteria 91481
338 Ga0501068_0017473 3300049584 Bacteria 4148
339 Ga0501069_0006075 3300049585 Bacteria 6302
340 Ga0501070_0000966 3300049586 Bacteria 25809
341 Ga0501070_0178694 3300049586 Bacteria 1747
342 Ga0501072_0002586 3300049588 Bacteria 13564
343 Ga0501073_0001352 3300049589 Bacteria 18086
344 Ga0501074_0001829 3300049590 Bacteria 14566
345 Ga0501076_1551857 3300049592 Bacteria 544
346 Ga0501079_0005974 3300049741 Bacteria 9114
347 Ga0501079_1413043 3300049741 Bacteria 547
348 Ga0501080_0002456 3300049742 Bacteria 16216
349 Ga0501080_1014912 3300049742 Bacteria 719
350 Ga0501080_1494646 3300049742 Bacteria 574
351 Ga0501035_0000052 3300049822 Bacteria 143038
352 Ga0501044_0002732 3300049823 Bacteria 20068
353 Ga0501044_0047552 3300049823 Bacteria 4437
354 Ga0501045_0042514 3300049824 Bacteria 3307
355 nmdc:mga03n38_173796_c1 3300050490 Bacteria 1099
356 nmdc:mga00v17_15331_c1 3300050491 Bacteria 4302
357 nmdc:mga0yw44_356818_c1 3300050492 Bacteria 985
358 nmdc:mga0yw44_76597_c1 3300050492 Bacteria 2088
359 nmdc:mga07m45_417537_c1 3300050496 Bacteria 778
360 nmdc:mga07m45_96735_c1 3300050496 Bacteria 1694
361 nmdc:mga0sz30_1268_c1 3300050516 Bacteria 8280
362 Ga0500610_0261104 3300053079 Bacteria 791
363 Ga0495655_0214785 3300053083 Bacteria 634
364 Ga0500578_0031647 3300053086 Bacteria 3400
365 Ga0500643_012208 3300053087 Bacteria 3085
366 Ga0500644_0059857 3300053088 Bacteria 1337
367 Ga0500647_0387774 3300053091 Bacteria 570
368 Ga0500566_0002556 3300053094 Bacteria 10823
369 Ga0500566_0390257 3300053094 Bacteria 626
370 Ga0500641_0003271 3300053096 Bacteria 5729
371 Ga0500648_037938 3300053097 Bacteria 2729
372 Ga0500650_0001335 3300053098 Bacteria 7361
373 Ga0500556_0000093 3300053104 Bacteria 82933
374 Ga0500562_022038 3300053108 Bacteria 1659
375 Ga0500562_159746 3300053108 Bacteria 613
376 Ga0500569_081914 3300053109 Bacteria 1033
377 Ga0500572_001373 3300053111 Bacteria 6718
378 Ga0500592_000949 3300053116 Bacteria 4713
379 Ga0500595_000722 3300053119 Bacteria 19637
380 Ga0500595_001932 3300053119 Bacteria 10667
381 Ga0500607_069184 3300053121 Bacteria 1826
382 Ga0500608_115573 3300053122 Bacteria 1224
383 Ga0500618_026755 3300053125 Bacteria 1376
384 Ga0500642_0000013 3300053130 Bacteria 197927
385 Ga0500652_020561 3300053131 Bacteria 2471
386 Ga0500658_0046532 3300053134 Bacteria 1757
387 Ga0500658_0463218 3300053134 Bacteria 576
388 Ga0500559_0000773 3300053136 Bacteria 20950
389 Ga0500559_0068115 3300053136 Bacteria 1598
390 Ga0500559_0276337 3300053136 Bacteria 790
391 Ga0500564_278133 3300053138 Bacteria 652
392 Ga0500568_0004553 3300053139 Bacteria 7393
393 Ga0500573_0034746 3300053140 Bacteria 2907
394 Ga0500586_012230 3300053145 Bacteria 2490
395 Ga0500590_019174 3300053148 Bacteria 3545
396 Ga0500590_154910 3300053148 Bacteria 1029
397 Ga0500604_0005473 3300053151 Bacteria 3351
398 Ga0500604_0158680 3300053151 Bacteria 770
399 Ga0500616_0000288 3300053153 Bacteria 73364
400 Ga0500622_0000563 3300053156 Bacteria 33995
401 Ga0500627_0114519 3300053158 Bacteria 1214
402 Ga0500627_0285287 3300053158 Bacteria 724
403 Ga0500633_0211331 3300053160 Bacteria 725
404 Ga0500638_062268 3300053162 Bacteria 1792
405 Ga0500639_103536 3300053163 Bacteria 1396
406 Ga0500639_223881 3300053163 Bacteria 782
407 Ga0500636_0002673 3300053177 Bacteria 9910
408 Ga0500636_0022695 3300053177 Bacteria 3710
409 Ga0500636_0043799 3300053177 Bacteria 2641
410 Ga0500637_0194619 3300053178 Bacteria 1157
411 Ga0500637_0284941 3300053178 Bacteria 907
412 Ga0500570_192555 3300053724 Bacteria 635
413 Ga0500576_154472 3300053725 Bacteria 852
414 Ga0500645_066449 3300053730 Bacteria 1038
415 Ga0500596_005359 3300053735 Bacteria 2266
416 Ga0501084_0003876 3300054114 Bacteria 12173
417 Ga0501082_0005063 3300060353 Bacteria 11489
418 Ga0466962_0069484 3300061719 Bacteria 1682

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_101777163 Ga0070663_1017771631 123
2 3300005539 Ga0068853_100148017 Ga0068853_1001480172 123
3 3300005614 Ga0068856_100052958 Ga0068856_1000529583 123
4 3300006028 Ga0070717_10777688 Ga0070717_107776882 123
5 3300013105 Ga0157369_10210761 Ga0157369_102107613 123
6 3300002077 JGI24744J21845_10049709 JGI24744J21845_100497091 124
7 3300005262 Ga0065165_1061690 Ga0065165_10616902 124
8 3300005329 Ga0070683_100172892 Ga0070683_1001728921 124
9 3300005330 Ga0070690_100058058 Ga0070690_1000580582 124
10 3300005335 Ga0070666_10038193 Ga0070666_100381933 124
11 3300005336 Ga0070680_100007389 Ga0070680_1000073894 124
12 3300005336 Ga0070680_101541969 Ga0070680_1015419691 124
13 3300005337 Ga0070682_100155311 Ga0070682_1001553112 124
14 3300005339 Ga0070660_100031034 Ga0070660_1000310343 124
15 3300005341 Ga0070691_10682683 Ga0070691_106826831 124
16 3300005344 Ga0070661_100113731 Ga0070661_1001137312 124
17 3300005347 Ga0070668_100359354 Ga0070668_1003593541 124
18 3300005364 Ga0070673_101458785 Ga0070673_1014587851 124
19 3300005366 Ga0070659_100656577 Ga0070659_1006565771 124
20 3300005366 Ga0070659_101205208 Ga0070659_1012052081 124
21 3300005367 Ga0070667_100613874 Ga0070667_1006138741 124
22 3300005434 Ga0070709_10016067 Ga0070709_100160672 124
23 3300005435 Ga0070714_100294234 Ga0070714_1002942342 124
24 3300005436 Ga0070713_100160598 Ga0070713_1001605982 124
25 3300005437 Ga0070710_10022746 Ga0070710_100227464 124
26 3300005437 Ga0070710_11423936 Ga0070710_114239361 124
27 3300005438 Ga0070701_10039619 Ga0070701_100396192 124
28 3300005439 Ga0070711_100074531 Ga0070711_1000745312 124
29 3300005441 Ga0070700_100038164 Ga0070700_1000381642 124
30 3300005445 Ga0070708_100918273 Ga0070708_1009182731 124
31 3300005455 Ga0070663_100071910 Ga0070663_1000719103 124
32 3300005455 Ga0070663_100288993 Ga0070663_1002889932 124
33 3300005455 Ga0070663_100305072 Ga0070663_1003050722 124
34 3300005456 Ga0070678_100015766 Ga0070678_1000157662 124
35 3300005456 Ga0070678_100081184 Ga0070678_1000811842 124
36 3300005457 Ga0070662_100174890 Ga0070662_1001748902 124
37 3300005458 Ga0070681_10292834 Ga0070681_102928342 124
38 3300005458 Ga0070681_10423433 Ga0070681_104234331 124
39 3300005458 Ga0070681_10924128 Ga0070681_109241281 124
40 3300005458 Ga0070681_11378498 Ga0070681_113784981 124
41 3300005459 Ga0068867_100320231 Ga0068867_1003202312 124
42 3300005466 Ga0070685_10240521 Ga0070685_102405212 124
43 3300005530 Ga0070679_100139562 Ga0070679_1001395624 124
44 3300005530 Ga0070679_100358580 Ga0070679_1003585802 124
45 3300005530 Ga0070679_100376984 Ga0070679_1003769842 124
46 3300005530 Ga0070679_100426980 Ga0070679_1004269802 124
47 3300005535 Ga0070684_100106654 Ga0070684_1001066544 124
48 3300005536 Ga0070697_100138279 Ga0070697_1001382792 124
49 3300005539 Ga0068853_100055730 Ga0068853_1000557303 124
50 3300005539 Ga0068853_100172343 Ga0068853_1001723433 124
51 3300005539 Ga0068853_100284872 Ga0068853_1002848722 124
52 3300005539 Ga0068853_100633780 Ga0068853_1006337802 124
53 3300005543 Ga0070672_100033812 Ga0070672_1000338122 124
54 3300005547 Ga0070693_100036806 Ga0070693_1000368062 124
55 3300005548 Ga0070665_100608590 Ga0070665_1006085902 124
56 3300005549 Ga0070704_100295425 Ga0070704_1002954252 124
57 3300005563 Ga0068855_100128442 Ga0068855_1001284422 124
58 3300005563 Ga0068855_100232775 Ga0068855_1002327751 124
59 3300005563 Ga0068855_100545390 Ga0068855_1005453902 124
60 3300005563 Ga0068855_102134287 Ga0068855_1021342871 124
61 3300005564 Ga0070664_100795987 Ga0070664_1007959872 124
62 3300005577 Ga0068857_100105694 Ga0068857_1001056941 124
63 3300005578 Ga0068854_100451516 Ga0068854_1004515162 124
64 3300005615 Ga0070702_100697112 Ga0070702_1006971121 124
65 3300005615 Ga0070702_101158828 Ga0070702_1011588281 124
66 3300005616 Ga0068852_100494051 Ga0068852_1004940512 124
67 3300005617 Ga0068859_100755891 Ga0068859_1007558912 124
68 3300005718 Ga0068866_10035166 Ga0068866_100351662 124
69 3300005719 Ga0068861_100269480 Ga0068861_1002694802 124
70 3300005719 Ga0068861_102040495 Ga0068861_1020404951 124
71 3300005840 Ga0068870_10192013 Ga0068870_101920132 124
72 3300005842 Ga0068858_101813642 Ga0068858_1018136422 124
73 3300005843 Ga0068860_100289130 Ga0068860_1002891302 124
74 3300005937 Ga0081455_10029336 Ga0081455_100293366 124
75 3300005983 Ga0081540_1036331 Ga0081540_10363314 124
76 3300006028 Ga0070717_10157941 Ga0070717_101579413 124
77 3300006028 Ga0070717_10544488 Ga0070717_105444882 124
78 3300006038 Ga0075365_10010590 Ga0075365_100105903 124
79 3300006038 Ga0075365_10219578 Ga0075365_102195782 124
80 3300006048 Ga0075363_100157866 Ga0075363_1001578662 124
81 3300006051 Ga0075364_10105790 Ga0075364_101057903 124
82 3300006173 Ga0070716_100155776 Ga0070716_1001557762 124
83 3300006186 Ga0075369_10005935 Ga0075369_100059355 124
84 3300006353 Ga0075370_10128050 Ga0075370_101280502 124
85 3300006358 Ga0068871_100528645 Ga0068871_1005286452 124
86 3300006358 Ga0068871_100871097 Ga0068871_1008710972 124
87 3300006871 Ga0075434_100808064 Ga0075434_1008080642 124
88 3300006881 Ga0068865_100121416 Ga0068865_1001214162 124
89 3300006931 Ga0097620_100756011 Ga0097620_1007560112 124
90 3300007265 Ga0099794_10051835 Ga0099794_100518353 124
91 3300009093 Ga0105240_10189307 Ga0105240_101893073 124
92 3300009093 Ga0105240_10364428 Ga0105240_103644283 124
93 3300009148 Ga0105243_10077605 Ga0105243_100776053 124
94 3300009177 Ga0105248_10355813 Ga0105248_103558131 124
95 3300009545 Ga0105237_10084021 Ga0105237_100840214 124
96 3300009545 Ga0105237_11181696 Ga0105237_111816962 124
97 3300009545 Ga0105237_11441453 Ga0105237_114414532 124
98 3300009551 Ga0105238_10053335 Ga0105238_100533354 124
99 3300009551 Ga0105238_10100152 Ga0105238_101001523 124
100 3300009551 Ga0105238_10940108 Ga0105238_109401082 124
101 3300009551 Ga0105238_11031944 Ga0105238_110319441 124
102 3300009551 Ga0105238_11095211 Ga0105238_110952112 124
103 3300009553 Ga0105249_10526570 Ga0105249_105265702 124
104 3300009553 Ga0105249_10987675 Ga0105249_109876752 124
105 3300010159 Ga0099796_10248810 Ga0099796_102488101 124
106 3300010375 Ga0105239_10118317 Ga0105239_101183173 124
107 3300010375 Ga0105239_11467835 Ga0105239_114678352 124
108 3300010375 Ga0105239_12608125 Ga0105239_126081251 124
109 3300012477 Ga0157336_1021652 Ga0157336_10216522 124
110 3300013100 Ga0157373_10422977 Ga0157373_104229771 124
111 3300013102 Ga0157371_10195502 Ga0157371_101955022 124
112 3300013104 Ga0157370_10230389 Ga0157370_102303893 124
113 3300013104 Ga0157370_10287386 Ga0157370_102873862 124
114 3300013104 Ga0157370_11787725 Ga0157370_117877251 124
115 3300013105 Ga0157369_10023406 Ga0157369_100234067 124
116 3300013105 Ga0157369_12168543 Ga0157369_121685431 124
117 3300013105 Ga0157369_12206903 Ga0157369_122069031 124
118 3300013296 Ga0157374_11770303 Ga0157374_117703031 124
119 3300013297 Ga0157378_10053833 Ga0157378_100538333 124
120 3300013297 Ga0157378_10207045 Ga0157378_102070453 124
121 3300013306 Ga0163162_10744684 Ga0163162_107446842 124
122 3300013307 Ga0157372_11744827 Ga0157372_117448271 124
123 3300013307 Ga0157372_12065312 Ga0157372_120653122 124
124 3300013308 Ga0157375_10388145 Ga0157375_103881451 124
125 3300014326 Ga0157380_10769004 Ga0157380_107690042 124
126 3300017792 Ga0163161_10373389 Ga0163161_103733892 124
127 3300020082 Ga0206353_10888638 Ga0206353_108886382 124
128 3300021384 Ga0213876_10140856 Ga0213876_101408562 124
129 3300021384 Ga0213876_10367344 Ga0213876_103673441 124
130 3300021388 Ga0213875_10513547 Ga0213875_105135471 124
131 3300025295 Ga0209564_1012301 Ga0209564_10123014 124
132 3300025297 Ga0209758_1001389 Ga0209758_100138923 124
133 3300025297 Ga0209758_1122871 Ga0209758_11228712 124
134 3300025299 Ga0209256_1054405 Ga0209256_10544052 124
135 3300025893 Ga0207682_10156823 Ga0207682_101568231 124
136 3300025898 Ga0207692_10089711 Ga0207692_100897112 124
137 3300025899 Ga0207642_10032263 Ga0207642_100322632 124
138 3300025901 Ga0207688_10080193 Ga0207688_100801932 124
139 3300025901 Ga0207688_10111212 Ga0207688_101112121 124
140 3300025906 Ga0207699_10015638 Ga0207699_100156382 124
141 3300025906 Ga0207699_10223569 Ga0207699_102235691 124
142 3300025907 Ga0207645_10025563 Ga0207645_100255632 124
143 3300025908 Ga0207643_10256456 Ga0207643_102564562 124
144 3300025909 Ga0207705_10062712 Ga0207705_100627123 124
145 3300025909 Ga0207705_10089169 Ga0207705_100891693 124
146 3300025911 Ga0207654_10736031 Ga0207654_107360312 124
147 3300025912 Ga0207707_10003914 Ga0207707_100039143 124
148 3300025913 Ga0207695_10101630 Ga0207695_101016302 124
149 3300025913 Ga0207695_10686317 Ga0207695_106863171 124
150 3300025914 Ga0207671_10059694 Ga0207671_100596941 124
151 3300025914 Ga0207671_10824282 Ga0207671_108242821 124
152 3300025914 Ga0207671_10956806 Ga0207671_109568062 124
153 3300025916 Ga0207663_10052543 Ga0207663_100525432 124
154 3300025917 Ga0207660_10007130 Ga0207660_100071306 124
155 3300025917 Ga0207660_10127243 Ga0207660_101272431 124
156 3300025919 Ga0207657_10001107 Ga0207657_100011072 124
157 3300025919 Ga0207657_10003265 Ga0207657_100032655 124
158 3300025919 Ga0207657_10113495 Ga0207657_101134952 124
159 3300025921 Ga0207652_10006801 Ga0207652_100068018 124
160 3300025921 Ga0207652_10107372 Ga0207652_101073723 124
161 3300025921 Ga0207652_10222297 Ga0207652_102222973 124
162 3300025921 Ga0207652_10239816 Ga0207652_102398163 124
163 3300025924 Ga0207694_10272395 Ga0207694_102723952 124
164 3300025924 Ga0207694_11450643 Ga0207694_114506431 124
165 3300025926 Ga0207659_10989090 Ga0207659_109890902 124
166 3300025928 Ga0207700_10030198 Ga0207700_100301984 124
167 3300025928 Ga0207700_10032738 Ga0207700_100327382 124
168 3300025929 Ga0207664_10174642 Ga0207664_101746421 124
169 3300025929 Ga0207664_10741659 Ga0207664_107416592 124
170 3300025932 Ga0207690_10628948 Ga0207690_106289482 124
171 3300025933 Ga0207706_10068509 Ga0207706_100685093 124
172 3300025935 Ga0207709_10064742 Ga0207709_100647422 124
173 3300025937 Ga0207669_10044284 Ga0207669_100442843 124
174 3300025938 Ga0207704_10383072 Ga0207704_103830722 124
175 3300025939 Ga0207665_10139544 Ga0207665_101395442 124
176 3300025940 Ga0207691_10174632 Ga0207691_101746322 124
177 3300025941 Ga0207711_10742657 Ga0207711_107426572 124
178 3300025942 Ga0207689_10347380 Ga0207689_103473802 124
179 3300025944 Ga0207661_10316817 Ga0207661_103168172 124
180 3300025945 Ga0207679_11060235 Ga0207679_110602352 124
181 3300025949 Ga0207667_10006765 Ga0207667_100067659 124
182 3300025949 Ga0207667_10286473 Ga0207667_102864733 124
183 3300025949 Ga0207667_10687616 Ga0207667_106876162 124
184 3300025949 Ga0207667_11049112 Ga0207667_110491122 124
185 3300025960 Ga0207651_10676730 Ga0207651_106767302 124
186 3300025961 Ga0207712_10050677 Ga0207712_100506772 124
187 3300025961 Ga0207712_11383037 Ga0207712_113830372 124
188 3300025972 Ga0207668_10073062 Ga0207668_100730623 124
189 3300025972 Ga0207668_11364262 Ga0207668_113642622 124
190 3300025986 Ga0207658_10879161 Ga0207658_108791611 124
191 3300025986 Ga0207658_11133011 Ga0207658_111330112 124
192 3300026041 Ga0207639_10082247 Ga0207639_100822472 124
193 3300026041 Ga0207639_11029962 Ga0207639_110299622 124
194 3300026067 Ga0207678_10243027 Ga0207678_102430272 124
195 3300026067 Ga0207678_10314679 Ga0207678_103146792 124
196 3300026067 Ga0207678_10549058 Ga0207678_105490582 124
197 3300026075 Ga0207708_10020945 Ga0207708_100209454 124
198 3300026078 Ga0207702_10000779 Ga0207702_100007795 124
199 3300026089 Ga0207648_10295404 Ga0207648_102954042 124
200 3300026116 Ga0207674_10026227 Ga0207674_100262273 124
201 3300026118 Ga0207675_100054504 Ga0207675_1000545042 124
202 3300026118 Ga0207675_101588932 Ga0207675_1015889321 124
203 3300026121 Ga0207683_10135032 Ga0207683_101350321 124
204 3300026121 Ga0207683_10417393 Ga0207683_104173932 124
205 3300028379 Ga0268266_10804910 Ga0268266_108049102 124
206 3300028381 Ga0268264_10246093 Ga0268264_102460932 124
207 3300028381 Ga0268264_11302069 Ga0268264_113020691 124
208 3300028786 Ga0307517_10222087 Ga0307517_102220872 124
209 3300028794 Ga0307515_10160916 Ga0307515_101609163 124
210 3300030521 Ga0307511_10257392 Ga0307511_102573922 124
211 3300031235 Ga0265330_10080250 Ga0265330_100802502 124
212 3300031250 Ga0265331_10085570 Ga0265331_100855702 124
213 3300031456 Ga0307513_10303541 Ga0307513_103035412 124
214 3300031507 Ga0307509_10005003 Ga0307509_1000500311 124
215 3300031507 Ga0307509_10506323 Ga0307509_105063232 124
216 3300031548 Ga0307408_101759755 Ga0307408_1017597551 124
217 3300031616 Ga0307508_10156499 Ga0307508_101564993 124
218 3300031711 Ga0265314_10003829 Ga0265314_100038297 124
219 3300033179 Ga0307507_10135440 Ga0307507_101354402 124
220 3300033180 Ga0307510_10304132 Ga0307510_103041321 124
221 3300035083 Ga0373926_0170328 Ga0373926_0170328_347_727 124
222 3300035121 Ga0373960_0237389 Ga0373960_0237389_76_450 124
223 3300035695 Ga0373927_0004710 Ga0373927_0004710_4804_5184 124
224 3300035695 Ga0373927_0370666 Ga0373927_0370666_122_508 124
225 3300035695 Ga0373927_0639096 Ga0373927_0639096_207_587 124
226 3300035724 Ga0373933_0312628 Ga0373933_0312628_579_962 124
227 3300035725 Ga0373947_0028170 Ga0373947_0028170_1668_2048 124
228 3300035725 Ga0373947_0435920 Ga0373947_0435920_126_509 124
229 3300037853 Ga0436364_0235057 Ga0436364_0235057_136_513 124
230 3300037853 Ga0436364_0342884 Ga0436364_0342884_2712_3092 124
231 3300037853 Ga0436364_1488077 Ga0436364_1488077_379_753 124
232 3300039437 Ga0436365_0236628 Ga0436365_0236628_36_416 124
233 3300039437 Ga0436365_0602497 Ga0436365_0602497_345_719 124
234 3300039437 Ga0436365_1775282 Ga0436365_1775282_224_598 124
235 3300039447 Ga0436361_0113118 Ga0436361_0113118_19_393 124
236 3300041503 Ga0451847_0693823 Ga0451847_0693823_104_478 124
237 3300044765 Ga0466970_0236486 Ga0466970_0236486_618_992 124
238 3300044842 Ga0466957_0020953 Ga0466957_0020953_3362_3736 124
239 3300045049 Ga0466959_0008200 Ga0466959_0008200_6491_6865 124
240 3300045976 Ga0466967_0052094 Ga0466967_0052094_998_1381 124
241 3300045976 Ga0466967_0291737 Ga0466967_0291737_946_1320 124
242 3300045976 Ga0466967_1033854 Ga0466967_1033854_129_515 124
243 3300046457 Ga0495590_0372221 Ga0495590_0372221_110_484 124
244 3300046460 Ga0495638_0006147 Ga0495638_0006147_731_1105 124
245 3300046460 Ga0495638_0021606 Ga0495638_0021606_1870_2244 124
246 3300046460 Ga0495638_0156399 Ga0495638_0156399_768_1142 124
247 3300046492 Ga0495585_0529522 Ga0495585_0529522_35_409 124
248 3300046500 Ga0495596_0206394 Ga0495596_0206394_44_418 124
249 3300046500 Ga0495596_0326209 Ga0495596_0326209_69_443 124
250 3300046501 Ga0495607_0021583 Ga0495607_0021583_210_584 124
251 3300046501 Ga0495607_0411769 Ga0495607_0411769_127_501 124
252 3300046506 Ga0495583_0074598 Ga0495583_0074598_299_673 124
253 3300046506 Ga0495583_0351697 Ga0495583_0351697_102_476 124
254 3300046507 Ga0495606_0497871 Ga0495606_0497871_136_510 124
255 3300046512 Ga0495610_0052281 Ga0495610_0052281_108_482 124
256 3300046513 Ga0495616_0387549 Ga0495616_0387549_83_457 124
257 3300046515 Ga0495620_0027189 Ga0495620_0027189_1288_1662 124
258 3300046518 Ga0495631_0170698 Ga0495631_0170698_143_517 124
259 3300046518 Ga0495631_0174257 Ga0495631_0174257_145_519 124
260 3300046518 Ga0495631_0309673 Ga0495631_0309673_43_417 124
261 3300046519 Ga0495632_0058973 Ga0495632_0058973_1313_1687 124
262 3300046522 Ga0495643_0478199 Ga0495643_0478199_130_504 124
263 3300046524 Ga0495648_0001581 Ga0495648_0001581_11432_11809 124
264 3300046524 Ga0495648_0106511 Ga0495648_0106511_1041_1415 124
265 3300046526 Ga0495666_0406740 Ga0495666_0406740_69_443 124
266 3300046530 Ga0495654_0057472 Ga0495654_0057472_58_432 124
267 3300046530 Ga0495654_0316291 Ga0495654_0316291_160_534 124
268 3300046535 Ga0495586_0214964 Ga0495586_0214964_170_547 124
269 3300046542 Ga0495597_0195007 Ga0495597_0195007_238_612 124
270 3300046543 Ga0495645_0141104 Ga0495645_0141104_791_1174 124
271 3300046557 Ga0495622_0351620 Ga0495622_0351620_163_543 124
272 3300046660 Ga0495625_0378990 Ga0495625_0378990_502_876 124
273 3300046660 Ga0495625_0396425 Ga0495625_0396425_325_699 124
274 3300046660 Ga0495625_0603085 Ga0495625_0603085_102_476 124
275 3300046665 Ga0495661_0087118 Ga0495661_0087118_418_792 124
276 3300046665 Ga0495661_0612512 Ga0495661_0612512_14_388 124
277 3300046678 Ga0495599_0125275 Ga0495599_0125275_581_958 124
278 3300046684 Ga0495669_0002591 Ga0495669_0002591_2709_3083 124
279 3300046689 Ga0495613_0102551 Ga0495613_0102551_717_1097 124
280 3300046691 Ga0495670_0069818 Ga0495670_0069818_956_1330 124
281 3300046691 Ga0495670_0324126 Ga0495670_0324126_69_443 124
282 3300046692 Ga0495671_0386506 Ga0495671_0386506_61_435 124
283 3300046692 Ga0495671_0443905 Ga0495671_0443905_35_409 124
284 3300046810 Ga0495660_0103989 Ga0495660_0103989_124_498 124
285 3300047470 Ga0495681_0069341 Ga0495681_0069341_810_1184 124
286 3300047472 Ga0495686_0023146 Ga0495686_0023146_621_995 124
287 3300047673 Ga0495593_0234013 Ga0495593_0234013_117_497 124
288 3300048904 Ga0496101_0036213 Ga0496101_0036213_1932_2306 124
289 3300048905 Ga0496102_1279632 Ga0496102_1279632_38_412 124
290 3300048905 Ga0496102_1650481 Ga0496102_1650481_148_522 124
291 3300048914 Ga0496111_0294099 Ga0496111_0294099_153_530 124
292 3300048916 Ga0496113_0434250 Ga0496113_0434250_59_436 124
293 3300048917 Ga0496114_0054141 Ga0496114_0054141_2404_2778 124
294 3300048919 Ga0496116_0001079 Ga0496116_0001079_25619_25996 124
295 3300048920 Ga0496117_0062392 Ga0496117_0062392_212_589 124
296 3300048920 Ga0496117_0072971 Ga0496117_0072971_1100_1474 124
297 3300048920 Ga0496117_0318226 Ga0496117_0318226_432_806 124
298 3300048921 Ga0496118_0054363 Ga0496118_0054363_665_1132 124
299 3300048921 Ga0496118_0108334 Ga0496118_0108334_553_927 124
300 3300048921 Ga0496118_0141975 Ga0496118_0141975_895_1272 124
301 3300048921 Ga0496118_0213227 Ga0496118_0213227_19_393 124
302 3300048922 Ga0496119_0385332 Ga0496119_0385332_61_435 124
303 3300048924 Ga0496121_0002000 Ga0496121_0002000_18332_18706 124
304 3300048924 Ga0496121_0004531 Ga0496121_0004531_4506_4883 124
305 3300048924 Ga0496121_0008731 Ga0496121_0008731_10181_10561 124
306 3300048924 Ga0496121_0036259 Ga0496121_0036259_3836_4210 124
307 3300048924 Ga0496121_0619636 Ga0496121_0619636_82_456 124
308 3300048925 Ga0496122_0026282 Ga0496122_0026282_1480_1854 124
309 3300048925 Ga0496122_0115865 Ga0496122_0115865_709_1083 124
310 3300048926 Ga0496123_0009805 Ga0496123_0009805_1327_1701 124
311 3300048927 Ga0496124_0016295 Ga0496124_0016295_3144_3521 124
312 3300048927 Ga0496124_0329718 Ga0496124_0329718_392_766 124
313 3300048928 Ga0496125_0010155 Ga0496125_0010155_4533_4907 124
314 3300048928 Ga0496125_0020224 Ga0496125_0020224_1343_1720 124
315 3300048929 Ga0496126_0010504 Ga0496126_0010504_4112_4510 124
316 3300048929 Ga0496126_0019779 Ga0496126_0019779_1778_2152 124
317 3300048929 Ga0496126_0038161 Ga0496126_0038161_3551_3931 124
318 3300048929 Ga0496126_0069195 Ga0496126_0069195_113_562 124
319 3300048929 Ga0496126_0249785 Ga0496126_0249785_65_439 124
320 3300048929 Ga0496126_0281922 Ga0496126_0281922_951_1325 124
321 3300049459 Ga0495678_103743 Ga0495678_103743_250_624 124
322 3300049568 Ga0501031_0001416 Ga0501031_0001416_3383_3760 124
323 3300049569 Ga0501032_0001535 Ga0501032_0001535_15499_15876 124
324 3300049570 Ga0501033_0000311 Ga0501033_0000311_40320_40697 124
325 3300049571 Ga0501034_0000039 Ga0501034_0000039_194958_195335 124
326 3300049572 Ga0501036_0000127 Ga0501036_0000127_42154_42531 124
327 3300049573 Ga0501037_0000025 Ga0501037_0000025_97527_97904 124
328 3300049574 Ga0501038_0000168 Ga0501038_0000168_31885_32262 124
329 3300049575 Ga0501039_0001738 Ga0501039_0001738_12262_12639 124
330 3300049578 Ga0501042_0100718 Ga0501042_0100718_561_938 124
331 3300049579 Ga0501043_0000120 Ga0501043_0000120_3330_3707 124
332 3300049580 Ga0501046_0000359 Ga0501046_0000359_42173_42550 124
333 3300049581 Ga0501047_0000379 Ga0501047_0000379_32109_32486 124
334 3300049581 Ga0501047_0297069 Ga0501047_0297069_297_677 124
335 3300049581 Ga0501047_1099645 Ga0501047_1099645_49_423 124
336 3300049582 Ga0501048_0005136 Ga0501048_0005136_6252_6629 124
337 3300049583 Ga0501067_0000025 Ga0501067_0000025_40736_41113 124
338 3300049584 Ga0501068_0017473 Ga0501068_0017473_2399_2776 124
339 3300049585 Ga0501069_0006075 Ga0501069_0006075_1200_1577 124
340 3300049586 Ga0501070_0000966 Ga0501070_0000966_9089_9466 124
341 3300049586 Ga0501070_0178694 Ga0501070_0178694_62_439 124
342 3300049588 Ga0501072_0002586 Ga0501072_0002586_3394_3771 124
343 3300049589 Ga0501073_0001352 Ga0501073_0001352_2666_3043 124
344 3300049590 Ga0501074_0001829 Ga0501074_0001829_686_1063 124
345 3300049592 Ga0501076_1551857 Ga0501076_1551857_94_468 124
346 3300049741 Ga0501079_0005974 Ga0501079_0005974_3379_3756 124
347 3300049741 Ga0501079_1413043 Ga0501079_1413043_159_533 124
348 3300049742 Ga0501080_0002456 Ga0501080_0002456_3379_3756 124
349 3300049742 Ga0501080_1014912 Ga0501080_1014912_278_676 124
350 3300049742 Ga0501080_1494646 Ga0501080_1494646_48_428 124
351 3300049822 Ga0501035_0000052 Ga0501035_0000052_5309_5686 124
352 3300049823 Ga0501044_0002732 Ga0501044_0002732_9195_9572 124
353 3300049823 Ga0501044_0047552 Ga0501044_0047552_3457_3837 124
354 3300049824 Ga0501045_0042514 Ga0501045_0042514_2382_2759 124
355 3300050490 nmdc:mga03n38_173796_c1 nmdc:mga03n38_173796_c1_120_497 124
356 3300050491 nmdc:mga00v17_15331_c1 nmdc:mga00v17_15331_c1_3595_3972 124
357 3300050492 nmdc:mga0yw44_356818_c1 nmdc:mga0yw44_356818_c1_217_591 124
358 3300050492 nmdc:mga0yw44_76597_c1 nmdc:mga0yw44_76597_c1_735_1112 124
359 3300050496 nmdc:mga07m45_417537_c1 nmdc:mga07m45_417537_c1_394_768 124
360 3300050496 nmdc:mga07m45_96735_c1 nmdc:mga07m45_96735_c1_223_600 124
361 3300050516 nmdc:mga0sz30_1268_c1 nmdc:mga0sz30_1268_c1_2491_2868 124
362 3300053079 Ga0500610_0261104 Ga0500610_0261104_360_734 124
363 3300053083 Ga0495655_0214785 Ga0495655_0214785_34_408 124
364 3300053086 Ga0500578_0031647 Ga0500578_0031647_1102_1476 124
365 3300053087 Ga0500643_012208 Ga0500643_012208_394_768 124
366 3300053088 Ga0500644_0059857 Ga0500644_0059857_672_1046 124
367 3300053091 Ga0500647_0387774 Ga0500647_0387774_56_436 124
368 3300053094 Ga0500566_0002556 Ga0500566_0002556_8208_8642 124
369 3300053094 Ga0500566_0390257 Ga0500566_0390257_80_460 124
370 3300053096 Ga0500641_0003271 Ga0500641_0003271_5158_5532 124
371 3300053097 Ga0500648_037938 Ga0500648_037938_80_457 124
372 3300053098 Ga0500650_0001335 Ga0500650_0001335_6035_6409 124
373 3300053104 Ga0500556_0000093 Ga0500556_0000093_27839_28213 124
374 3300053108 Ga0500562_022038 Ga0500562_022038_165_539 124
375 3300053108 Ga0500562_159746 Ga0500562_159746_215_589 124
376 3300053109 Ga0500569_081914 Ga0500569_081914_260_634 124
377 3300053111 Ga0500572_001373 Ga0500572_001373_2279_2659 124
378 3300053116 Ga0500592_000949 Ga0500592_000949_240_614 124
379 3300053119 Ga0500595_000722 Ga0500595_000722_19145_19519 124
380 3300053119 Ga0500595_001932 Ga0500595_001932_10184_10558 124
381 3300053121 Ga0500607_069184 Ga0500607_069184_647_1024 124
382 3300053122 Ga0500608_115573 Ga0500608_115573_158_592 124
383 3300053125 Ga0500618_026755 Ga0500618_026755_401_835 124
384 3300053130 Ga0500642_0000013 Ga0500642_0000013_45825_46199 124
385 3300053131 Ga0500652_020561 Ga0500652_020561_736_1110 124
386 3300053134 Ga0500658_0046532 Ga0500658_0046532_1061_1435 124
387 3300053134 Ga0500658_0463218 Ga0500658_0463218_127_501 124
388 3300053136 Ga0500559_0000773 Ga0500559_0000773_20515_20895 124
389 3300053136 Ga0500559_0068115 Ga0500559_0068115_205_582 124
390 3300053136 Ga0500559_0276337 Ga0500559_0276337_345_722 124
391 3300053138 Ga0500564_278133 Ga0500564_278133_205_582 124
392 3300053139 Ga0500568_0004553 Ga0500568_0004553_2859_3233 124
393 3300053140 Ga0500573_0034746 Ga0500573_0034746_611_988 124
394 3300053145 Ga0500586_012230 Ga0500586_012230_1271_1648 124
395 3300053148 Ga0500590_019174 Ga0500590_019174_2960_3394 124
396 3300053148 Ga0500590_154910 Ga0500590_154910_241_618 124
397 3300053151 Ga0500604_0005473 Ga0500604_0005473_1568_1942 124
398 3300053151 Ga0500604_0158680 Ga0500604_0158680_186_560 124
399 3300053153 Ga0500616_0000288 Ga0500616_0000288_28340_28714 124
400 3300053156 Ga0500622_0000563 Ga0500622_0000563_961_1335 124
401 3300053158 Ga0500627_0114519 Ga0500627_0114519_87_461 124
402 3300053158 Ga0500627_0285287 Ga0500627_0285287_110_484 124
403 3300053160 Ga0500633_0211331 Ga0500633_0211331_211_585 124
404 3300053162 Ga0500638_062268 Ga0500638_062268_542_922 124
405 3300053163 Ga0500639_103536 Ga0500639_103536_530_910 124
406 3300053163 Ga0500639_223881 Ga0500639_223881_120_497 124
407 3300053177 Ga0500636_0002673 Ga0500636_0002673_3842_4276 124
408 3300053177 Ga0500636_0022695 Ga0500636_0022695_2245_2625 124
409 3300053177 Ga0500636_0043799 Ga0500636_0043799_54_431 124
410 3300053178 Ga0500637_0194619 Ga0500637_0194619_366_800 124
411 3300053178 Ga0500637_0284941 Ga0500637_0284941_54_434 124
412 3300053724 Ga0500570_192555 Ga0500570_192555_172_546 124
413 3300053725 Ga0500576_154472 Ga0500576_154472_421_801 124
414 3300053730 Ga0500645_066449 Ga0500645_066449_33_407 124
415 3300053735 Ga0500596_005359 Ga0500596_005359_185_562 124
416 3300054114 Ga0501084_0003876 Ga0501084_0003876_9783_10160 124
417 3300060353 Ga0501082_0005063 Ga0501082_0005063_2306_2683 124
418 3300061719 Ga0466962_0069484 Ga0466962_0069484_113_487 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19802

DUF6285

Domain of unknown function (DUF6285)

55

145

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ztb-assembly2.cif.gz_B structure of the salmonella trna pyrophosphokinase caprel 0.4899 4 64
2qxl-assembly1.cif.gz_A crystal structure analysis of sse1, a yeast hsp110 0.4249 25 122
2qxl-assembly1.cif.gz_B crystal structure analysis of sse1, a yeast hsp110 0.4192 25 123
6gxn-assembly1.cif.gz_v cryo-em structure of an e. coli 70s ribosome in complex with rf3-gdpcp, rf1(gaq) and pint-trna (state iii) 0.378 8 104
8bqs-assembly1.cif.gz_BV cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.3626 1 108
ID Description Score Start End Superfamily
af_Q6UWM9_1_280_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.4919 1 64 3.40.50.2000
af_Q9VDA0_266_386_1.20.1320.20 Mainly Alpha;Up-down Bundle;phosphoenolpyruvate carboxylase, domain 3;hef helicase domain 0.4833 45 109 1.20.1320.20
af_Q8ITC7_61_376_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4563 7 120 1.20.1070.10
af_Q96DT5_1475_1622_1.20.140.100 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Dynein motor heavy chain, linker domain, N-terminal subdomain 0.4355 1 119 1.20.140.100
af_Q96DT5_1475_1622_1.20.140.100 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Dynein motor heavy chain, linker domain, N-terminal subdomain 0.4206 1 119 1.20.140.100
ID Description Score Start End GO Terms
AF-A0A534WHP3-F1-model_v4 DUF6285 domain-containing protein 0.8901 1 68
AF-A0A1M5M7Z4-F1-model_v4 DUF6285 domain-containing protein 0.8757 1 93
AF-A0A098T391-F1-model_v4 DUF6285 domain-containing protein 0.8431 1 69
AF-A0A7Y4ZH00-F1-model_v4 DUF6285 domain-containing protein 0.827 1 113
AF-A0A098T391-F1-model_v4 DUF6285 domain-containing protein 0.8228 1 69

Feature Viewer

pLDDT pTM Quality
89.51 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map