F439389
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 418 | 282 | 418 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300048921|Ga0496118_0054363|Ga0496118_0054363_665_1132 |
| Length | 155 |
| Sequence | LICSDYWHRAHDPEKWRPVFGSDHAQKQGEDMQDEPRPDELVKAVADFLRNDIAPQISGHAAFKLRVAINALDLVTRQLTLAGDSDAAELHGLTMLLGVHGTLDGLNQDLADRIAQGDIDLTTPGVKEHLWQTTLAKLAVDQPNYGSYKRELEPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 147 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 148 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 149 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 156 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 157 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 198 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 199 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 200 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 201 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 207 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 240 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 243 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 244 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 245 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 246 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 247 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 248 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 249 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 250 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 251 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 252 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 254 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 255 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 256 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 257 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 259 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 260 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 262 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 265 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 266 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 267 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 270 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 272 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 273 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 274 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 276 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 277 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 278 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 279 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.99 |
| Nodule | 0 |
| Rhizoplane | 1.44 |
| Rhizosphere | 70.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10049709 | 3300002077 | Bacteria | 774 |
| 2 | Ga0065165_1061690 | 3300005262 | Bacteria | 1025 |
| 3 | Ga0070683_100172892 | 3300005329 | Bacteria | 2051 |
| 4 | Ga0070690_100058058 | 3300005330 | Bacteria | 2484 |
| 5 | Ga0070666_10038193 | 3300005335 | Bacteria | 3194 |
| 6 | Ga0070680_100007389 | 3300005336 | Bacteria | 8386 |
| 7 | Ga0070680_101541969 | 3300005336 | Bacteria | 575 |
| 8 | Ga0070682_100155311 | 3300005337 | Bacteria | 1574 |
| 9 | Ga0070660_100031034 | 3300005339 | Bacteria | 4011 |
| 10 | Ga0070691_10682683 | 3300005341 | Bacteria | 615 |
| 11 | Ga0070661_100113731 | 3300005344 | Bacteria | 2023 |
| 12 | Ga0070668_100359354 | 3300005347 | Bacteria | 1234 |
| 13 | Ga0070673_101458785 | 3300005364 | Bacteria | 645 |
| 14 | Ga0070659_100656577 | 3300005366 | Bacteria | 904 |
| 15 | Ga0070659_101205208 | 3300005366 | Bacteria | 669 |
| 16 | Ga0070667_100613874 | 3300005367 | Bacteria | 1002 |
| 17 | Ga0070709_10016067 | 3300005434 | Bacteria | 4266 |
| 18 | Ga0070714_100294234 | 3300005435 | Bacteria | 1512 |
| 19 | Ga0070713_100160598 | 3300005436 | Bacteria | 2006 |
| 20 | Ga0070710_10022746 | 3300005437 | Bacteria | 3284 |
| 21 | Ga0070710_11423936 | 3300005437 | Bacteria | 519 |
| 22 | Ga0070701_10039619 | 3300005438 | Bacteria | 2391 |
| 23 | Ga0070711_100074531 | 3300005439 | Bacteria | 2400 |
| 24 | Ga0070700_100038164 | 3300005441 | Bacteria | 2926 |
| 25 | Ga0070708_100918273 | 3300005445 | Bacteria | 822 |
| 26 | Ga0070663_100071910 | 3300005455 | Bacteria | 2518 |
| 27 | Ga0070663_100288993 | 3300005455 | Bacteria | 1309 |
| 28 | Ga0070663_100305072 | 3300005455 | Bacteria | 1276 |
| 29 | Ga0070663_101777163 | 3300005455 | Bacteria | 552 |
| 30 | Ga0070678_100015766 | 3300005456 | Bacteria | 4813 |
| 31 | Ga0070678_100081184 | 3300005456 | Bacteria | 2457 |
| 32 | Ga0070662_100174890 | 3300005457 | Bacteria | 1688 |
| 33 | Ga0070681_10292834 | 3300005458 | Bacteria | 1538 |
| 34 | Ga0070681_10423433 | 3300005458 | Bacteria | 1243 |
| 35 | Ga0070681_10924128 | 3300005458 | Bacteria | 791 |
| 36 | Ga0070681_11378498 | 3300005458 | Bacteria | 628 |
| 37 | Ga0068867_100320231 | 3300005459 | Bacteria | 1284 |
| 38 | Ga0070685_10240521 | 3300005466 | Bacteria | 1195 |
| 39 | Ga0070679_100139562 | 3300005530 | Bacteria | 2404 |
| 40 | Ga0070679_100358580 | 3300005530 | Bacteria | 1405 |
| 41 | Ga0070679_100376984 | 3300005530 | Bacteria | 1365 |
| 42 | Ga0070679_100426980 | 3300005530 | Bacteria | 1270 |
| 43 | Ga0070684_100106654 | 3300005535 | Bacteria | 2508 |
| 44 | Ga0070697_100138279 | 3300005536 | Bacteria | 2047 |
| 45 | Ga0068853_100055730 | 3300005539 | Bacteria | 3407 |
| 46 | Ga0068853_100148017 | 3300005539 | Bacteria | 2112 |
| 47 | Ga0068853_100172343 | 3300005539 | Bacteria | 1958 |
| 48 | Ga0068853_100284872 | 3300005539 | Bacteria | 1524 |
| 49 | Ga0068853_100633780 | 3300005539 | Bacteria | 1017 |
| 50 | Ga0070672_100033812 | 3300005543 | Bacteria | 3875 |
| 51 | Ga0070693_100036806 | 3300005547 | Bacteria | 2723 |
| 52 | Ga0070665_100608590 | 3300005548 | Bacteria | 1106 |
| 53 | Ga0070704_100295425 | 3300005549 | Bacteria | 1348 |
| 54 | Ga0068855_100128442 | 3300005563 | Bacteria | 2896 |
| 55 | Ga0068855_100232775 | 3300005563 | Bacteria | 2062 |
| 56 | Ga0068855_100545390 | 3300005563 | Bacteria | 1256 |
| 57 | Ga0068855_102134287 | 3300005563 | Bacteria | 563 |
| 58 | Ga0070664_100795987 | 3300005564 | Bacteria | 884 |
| 59 | Ga0068857_100105694 | 3300005577 | Bacteria | 2528 |
| 60 | Ga0068854_100451516 | 3300005578 | Bacteria | 1074 |
| 61 | Ga0068856_100052958 | 3300005614 | Bacteria | 4003 |
| 62 | Ga0070702_100697112 | 3300005615 | Bacteria | 773 |
| 63 | Ga0070702_101158828 | 3300005615 | Bacteria | 621 |
| 64 | Ga0068852_100494051 | 3300005616 | Bacteria | 1218 |
| 65 | Ga0068859_100755891 | 3300005617 | Bacteria | 1061 |
| 66 | Ga0068866_10035166 | 3300005718 | Bacteria | 2445 |
| 67 | Ga0068861_100269480 | 3300005719 | Bacteria | 1461 |
| 68 | Ga0068861_102040495 | 3300005719 | Bacteria | 573 |
| 69 | Ga0068870_10192013 | 3300005840 | Bacteria | 1233 |
| 70 | Ga0068858_101813642 | 3300005842 | Bacteria | 603 |
| 71 | Ga0068860_100289130 | 3300005843 | Bacteria | 1603 |
| 72 | Ga0081455_10029336 | 3300005937 | Bacteria | 5016 |
| 73 | Ga0081540_1036331 | 3300005983 | Bacteria | 2628 |
| 74 | Ga0070717_10157941 | 3300006028 | Bacteria | 1966 |
| 75 | Ga0070717_10544488 | 3300006028 | Bacteria | 1051 |
| 76 | Ga0070717_10777688 | 3300006028 | Bacteria | 870 |
| 77 | Ga0075365_10010590 | 3300006038 | Bacteria | 5380 |
| 78 | Ga0075365_10219578 | 3300006038 | Bacteria | 1333 |
| 79 | Ga0075363_100157866 | 3300006048 | Bacteria | 1283 |
| 80 | Ga0075364_10105790 | 3300006051 | Bacteria | 1875 |
| 81 | Ga0070716_100155776 | 3300006173 | Bacteria | 1475 |
| 82 | Ga0075369_10005935 | 3300006186 | Bacteria | 4594 |
| 83 | Ga0075370_10128050 | 3300006353 | Bacteria | 1481 |
| 84 | Ga0068871_100528645 | 3300006358 | Bacteria | 1066 |
| 85 | Ga0068871_100871097 | 3300006358 | Bacteria | 833 |
| 86 | Ga0075434_100808064 | 3300006871 | Bacteria | 954 |
| 87 | Ga0068865_100121416 | 3300006881 | Bacteria | 1943 |
| 88 | Ga0097620_100756011 | 3300006931 | Bacteria | 1061 |
| 89 | Ga0099794_10051835 | 3300007265 | Bacteria | 1977 |
| 90 | Ga0105240_10189307 | 3300009093 | Bacteria | 2421 |
| 91 | Ga0105240_10364428 | 3300009093 | Bacteria | 1636 |
| 92 | Ga0105243_10077605 | 3300009148 | Bacteria | 2702 |
| 93 | Ga0105248_10355813 | 3300009177 | Bacteria | 1649 |
| 94 | Ga0105237_10084021 | 3300009545 | Bacteria | 3174 |
| 95 | Ga0105237_11181696 | 3300009545 | Bacteria | 772 |
| 96 | Ga0105237_11441453 | 3300009545 | Bacteria | 695 |
| 97 | Ga0105238_10053335 | 3300009551 | Bacteria | 4063 |
| 98 | Ga0105238_10100152 | 3300009551 | Bacteria | 2881 |
| 99 | Ga0105238_10940108 | 3300009551 | Bacteria | 884 |
| 100 | Ga0105238_11031944 | 3300009551 | Bacteria | 844 |
| 101 | Ga0105238_11095211 | 3300009551 | Bacteria | 819 |
| 102 | Ga0105249_10526570 | 3300009553 | Bacteria | 1230 |
| 103 | Ga0105249_10987675 | 3300009553 | Bacteria | 910 |
| 104 | Ga0099796_10248810 | 3300010159 | Bacteria | 737 |
| 105 | Ga0105239_10118317 | 3300010375 | Bacteria | 2940 |
| 106 | Ga0105239_11467835 | 3300010375 | Bacteria | 788 |
| 107 | Ga0105239_12608125 | 3300010375 | Bacteria | 589 |
| 108 | Ga0157336_1021652 | 3300012477 | Bacteria | 586 |
| 109 | Ga0157373_10422977 | 3300013100 | Bacteria | 956 |
| 110 | Ga0157371_10195502 | 3300013102 | Bacteria | 1449 |
| 111 | Ga0157370_10230389 | 3300013104 | Bacteria | 1715 |
| 112 | Ga0157370_10287386 | 3300013104 | Bacteria | 1519 |
| 113 | Ga0157370_11787725 | 3300013104 | Bacteria | 552 |
| 114 | Ga0157369_10023406 | 3300013105 | Bacteria | 6879 |
| 115 | Ga0157369_10210761 | 3300013105 | Bacteria | 2036 |
| 116 | Ga0157369_12168543 | 3300013105 | Bacteria | 563 |
| 117 | Ga0157369_12206903 | 3300013105 | Bacteria | 558 |
| 118 | Ga0157374_11770303 | 3300013296 | Bacteria | 643 |
| 119 | Ga0157378_10053833 | 3300013297 | Bacteria | 3583 |
| 120 | Ga0157378_10207045 | 3300013297 | Bacteria | 1858 |
| 121 | Ga0163162_10744684 | 3300013306 | Bacteria | 1100 |
| 122 | Ga0157372_11744827 | 3300013307 | Bacteria | 716 |
| 123 | Ga0157372_12065312 | 3300013307 | Bacteria | 655 |
| 124 | Ga0157375_10388145 | 3300013308 | Bacteria | 1563 |
| 125 | Ga0157380_10769004 | 3300014326 | Bacteria | 977 |
| 126 | Ga0163161_10373389 | 3300017792 | Bacteria | 1138 |
| 127 | Ga0206353_10888638 | 3300020082 | Bacteria | 502 |
| 128 | Ga0213876_10140856 | 3300021384 | Bacteria | 1283 |
| 129 | Ga0213876_10367344 | 3300021384 | Bacteria | 765 |
| 130 | Ga0213875_10513547 | 3300021388 | Bacteria | 576 |
| 131 | Ga0209564_1012301 | 3300025295 | Bacteria | 3744 |
| 132 | Ga0209758_1001389 | 3300025297 | Bacteria | 28787 |
| 133 | Ga0209758_1122871 | 3300025297 | Bacteria | 698 |
| 134 | Ga0209256_1054405 | 3300025299 | Bacteria | 954 |
| 135 | Ga0207682_10156823 | 3300025893 | Bacteria | 1029 |
| 136 | Ga0207692_10089711 | 3300025898 | Bacteria | 1664 |
| 137 | Ga0207642_10032263 | 3300025899 | Bacteria | 2203 |
| 138 | Ga0207688_10080193 | 3300025901 | Bacteria | 1863 |
| 139 | Ga0207688_10111212 | 3300025901 | Bacteria | 1590 |
| 140 | Ga0207699_10015638 | 3300025906 | Bacteria | 3947 |
| 141 | Ga0207699_10223569 | 3300025906 | Bacteria | 1286 |
| 142 | Ga0207645_10025563 | 3300025907 | Bacteria | 3820 |
| 143 | Ga0207643_10256456 | 3300025908 | Bacteria | 1079 |
| 144 | Ga0207705_10062712 | 3300025909 | Bacteria | 2685 |
| 145 | Ga0207705_10089169 | 3300025909 | Bacteria | 2257 |
| 146 | Ga0207654_10736031 | 3300025911 | Bacteria | 710 |
| 147 | Ga0207707_10003914 | 3300025912 | Bacteria | 13215 |
| 148 | Ga0207695_10101630 | 3300025913 | Bacteria | 2869 |
| 149 | Ga0207695_10686317 | 3300025913 | Bacteria | 905 |
| 150 | Ga0207671_10059694 | 3300025914 | Bacteria | 2829 |
| 151 | Ga0207671_10824282 | 3300025914 | Bacteria | 735 |
| 152 | Ga0207671_10956806 | 3300025914 | Bacteria | 676 |
| 153 | Ga0207663_10052543 | 3300025916 | Bacteria | 2542 |
| 154 | Ga0207660_10007130 | 3300025917 | Bacteria | 7239 |
| 155 | Ga0207660_10127243 | 3300025917 | Bacteria | 1936 |
| 156 | Ga0207657_10001107 | 3300025919 | Bacteria | 28599 |
| 157 | Ga0207657_10003265 | 3300025919 | Bacteria | 17354 |
| 158 | Ga0207657_10113495 | 3300025919 | Bacteria | 2235 |
| 159 | Ga0207652_10006801 | 3300025921 | Bacteria | 9217 |
| 160 | Ga0207652_10107372 | 3300025921 | Bacteria | 2472 |
| 161 | Ga0207652_10222297 | 3300025921 | Bacteria | 1701 |
| 162 | Ga0207652_10239816 | 3300025921 | Bacteria | 1634 |
| 163 | Ga0207694_10272395 | 3300025924 | Bacteria | 1389 |
| 164 | Ga0207694_11450643 | 3300025924 | Bacteria | 580 |
| 165 | Ga0207659_10989090 | 3300025926 | Bacteria | 724 |
| 166 | Ga0207700_10030198 | 3300025928 | Bacteria | 3835 |
| 167 | Ga0207700_10032738 | 3300025928 | Bacteria | 3712 |
| 168 | Ga0207664_10174642 | 3300025929 | Bacteria | 1841 |
| 169 | Ga0207664_10741659 | 3300025929 | Bacteria | 883 |
| 170 | Ga0207690_10628948 | 3300025932 | Bacteria | 878 |
| 171 | Ga0207706_10068509 | 3300025933 | Bacteria | 3122 |
| 172 | Ga0207709_10064742 | 3300025935 | Bacteria | 2297 |
| 173 | Ga0207669_10044284 | 3300025937 | Bacteria | 2613 |
| 174 | Ga0207704_10383072 | 3300025938 | Bacteria | 1104 |
| 175 | Ga0207665_10139544 | 3300025939 | Bacteria | 1727 |
| 176 | Ga0207691_10174632 | 3300025940 | Bacteria | 1880 |
| 177 | Ga0207711_10742657 | 3300025941 | Bacteria | 915 |
| 178 | Ga0207689_10347380 | 3300025942 | Bacteria | 1233 |
| 179 | Ga0207661_10316817 | 3300025944 | Bacteria | 1401 |
| 180 | Ga0207679_11060235 | 3300025945 | Bacteria | 743 |
| 181 | Ga0207667_10006765 | 3300025949 | Bacteria | 13842 |
| 182 | Ga0207667_10286473 | 3300025949 | Bacteria | 1683 |
| 183 | Ga0207667_10687616 | 3300025949 | Bacteria | 1026 |
| 184 | Ga0207667_11049112 | 3300025949 | Bacteria | 800 |
| 185 | Ga0207651_10676730 | 3300025960 | Bacteria | 907 |
| 186 | Ga0207712_10050677 | 3300025961 | Bacteria | 2900 |
| 187 | Ga0207712_11383037 | 3300025961 | Bacteria | 630 |
| 188 | Ga0207668_10073062 | 3300025972 | Bacteria | 2456 |
| 189 | Ga0207668_11364262 | 3300025972 | Bacteria | 639 |
| 190 | Ga0207658_10879161 | 3300025986 | Bacteria | 815 |
| 191 | Ga0207658_11133011 | 3300025986 | Bacteria | 715 |
| 192 | Ga0207639_10082247 | 3300026041 | Bacteria | 2552 |
| 193 | Ga0207639_11029962 | 3300026041 | Bacteria | 771 |
| 194 | Ga0207678_10243027 | 3300026067 | Bacteria | 1542 |
| 195 | Ga0207678_10314679 | 3300026067 | Bacteria | 1346 |
| 196 | Ga0207678_10549058 | 3300026067 | Bacteria | 1010 |
| 197 | Ga0207708_10020945 | 3300026075 | Bacteria | 4933 |
| 198 | Ga0207702_10000779 | 3300026078 | Bacteria | 33703 |
| 199 | Ga0207648_10295404 | 3300026089 | Bacteria | 1452 |
| 200 | Ga0207674_10026227 | 3300026116 | Bacteria | 6196 |
| 201 | Ga0207675_100054504 | 3300026118 | Bacteria | 3730 |
| 202 | Ga0207675_101588932 | 3300026118 | Bacteria | 674 |
| 203 | Ga0207683_10135032 | 3300026121 | Bacteria | 2221 |
| 204 | Ga0207683_10417393 | 3300026121 | Bacteria | 1236 |
| 205 | Ga0268266_10804910 | 3300028379 | Bacteria | 908 |
| 206 | Ga0268264_10246093 | 3300028381 | Bacteria | 1659 |
| 207 | Ga0268264_11302069 | 3300028381 | Bacteria | 737 |
| 208 | Ga0307517_10222087 | 3300028786 | Bacteria | 1147 |
| 209 | Ga0307515_10160916 | 3300028794 | Bacteria | 2290 |
| 210 | Ga0307511_10257392 | 3300030521 | Bacteria | 831 |
| 211 | Ga0265330_10080250 | 3300031235 | Bacteria | 1406 |
| 212 | Ga0265331_10085570 | 3300031250 | Bacteria | 1461 |
| 213 | Ga0307513_10303541 | 3300031456 | Bacteria | 1362 |
| 214 | Ga0307509_10005003 | 3300031507 | Bacteria | 18702 |
| 215 | Ga0307509_10506323 | 3300031507 | Bacteria | 891 |
| 216 | Ga0307408_101759755 | 3300031548 | Bacteria | 592 |
| 217 | Ga0307508_10156499 | 3300031616 | Bacteria | 1882 |
| 218 | Ga0265314_10003829 | 3300031711 | Bacteria | 14364 |
| 219 | Ga0307507_10135440 | 3300033179 | Bacteria | 1910 |
| 220 | Ga0307510_10304132 | 3300033180 | Bacteria | 1056 |
| 221 | Ga0373926_0170328 | 3300035083 | Bacteria | 833 |
| 222 | Ga0373960_0237389 | 3300035121 | Bacteria | 658 |
| 223 | Ga0373927_0004710 | 3300035695 | Bacteria | 9507 |
| 224 | Ga0373927_0370666 | 3300035695 | Bacteria | 944 |
| 225 | Ga0373927_0639096 | 3300035695 | Bacteria | 703 |
| 226 | Ga0373933_0312628 | 3300035724 | Bacteria | 1018 |
| 227 | Ga0373947_0028170 | 3300035725 | Bacteria | 3291 |
| 228 | Ga0373947_0435920 | 3300035725 | Bacteria | 887 |
| 229 | Ga0436364_0235057 | 3300037853 | Bacteria | 711 |
| 230 | Ga0436364_0342884 | 3300037853 | Bacteria | 3145 |
| 231 | Ga0436364_1488077 | 3300037853 | Bacteria | 790 |
| 232 | Ga0436365_0236628 | 3300039437 | Bacteria | 541 |
| 233 | Ga0436365_0602497 | 3300039437 | Bacteria | 768 |
| 234 | Ga0436365_1775282 | 3300039437 | Bacteria | 1162 |
| 235 | Ga0436361_0113118 | 3300039447 | Bacteria | 523 |
| 236 | Ga0451847_0693823 | 3300041503 | Bacteria | 526 |
| 237 | Ga0466970_0236486 | 3300044765 | Bacteria | 1022 |
| 238 | Ga0466957_0020953 | 3300044842 | Bacteria | 3847 |
| 239 | Ga0466959_0008200 | 3300045049 | Bacteria | 7372 |
| 240 | Ga0466967_0052094 | 3300045976 | Bacteria | 3590 |
| 241 | Ga0466967_0291737 | 3300045976 | Bacteria | 1567 |
| 242 | Ga0466967_1033854 | 3300045976 | Bacteria | 818 |
| 243 | Ga0495590_0372221 | 3300046457 | Bacteria | 545 |
| 244 | Ga0495638_0006147 | 3300046460 | Bacteria | 8778 |
| 245 | Ga0495638_0021606 | 3300046460 | Bacteria | 4238 |
| 246 | Ga0495638_0156399 | 3300046460 | Bacteria | 1318 |
| 247 | Ga0495585_0529522 | 3300046492 | Bacteria | 558 |
| 248 | Ga0495596_0206394 | 3300046500 | Bacteria | 763 |
| 249 | Ga0495596_0326209 | 3300046500 | Bacteria | 597 |
| 250 | Ga0495607_0021583 | 3300046501 | Bacteria | 4050 |
| 251 | Ga0495607_0411769 | 3300046501 | Bacteria | 613 |
| 252 | Ga0495583_0074598 | 3300046506 | Bacteria | 1485 |
| 253 | Ga0495583_0351697 | 3300046506 | Bacteria | 581 |
| 254 | Ga0495606_0497871 | 3300046507 | Bacteria | 616 |
| 255 | Ga0495610_0052281 | 3300046512 | Bacteria | 1984 |
| 256 | Ga0495616_0387549 | 3300046513 | Bacteria | 576 |
| 257 | Ga0495620_0027189 | 3300046515 | Bacteria | 2680 |
| 258 | Ga0495631_0170698 | 3300046518 | Bacteria | 933 |
| 259 | Ga0495631_0174257 | 3300046518 | Bacteria | 922 |
| 260 | Ga0495631_0309673 | 3300046518 | Bacteria | 672 |
| 261 | Ga0495632_0058973 | 3300046519 | Bacteria | 1869 |
| 262 | Ga0495643_0478199 | 3300046522 | Bacteria | 539 |
| 263 | Ga0495648_0001581 | 3300046524 | Bacteria | 22185 |
| 264 | Ga0495648_0106511 | 3300046524 | Bacteria | 1535 |
| 265 | Ga0495666_0406740 | 3300046526 | Bacteria | 611 |
| 266 | Ga0495654_0057472 | 3300046530 | Bacteria | 1879 |
| 267 | Ga0495654_0316291 | 3300046530 | Bacteria | 634 |
| 268 | Ga0495586_0214964 | 3300046535 | Bacteria | 1092 |
| 269 | Ga0495597_0195007 | 3300046542 | Bacteria | 813 |
| 270 | Ga0495645_0141104 | 3300046543 | Bacteria | 1681 |
| 271 | Ga0495622_0351620 | 3300046557 | Bacteria | 638 |
| 272 | Ga0495625_0378990 | 3300046660 | Bacteria | 888 |
| 273 | Ga0495625_0396425 | 3300046660 | Bacteria | 863 |
| 274 | Ga0495625_0603085 | 3300046660 | Bacteria | 659 |
| 275 | Ga0495661_0087118 | 3300046665 | Bacteria | 1786 |
| 276 | Ga0495661_0612512 | 3300046665 | Bacteria | 511 |
| 277 | Ga0495599_0125275 | 3300046678 | Bacteria | 1597 |
| 278 | Ga0495669_0002591 | 3300046684 | Bacteria | 7392 |
| 279 | Ga0495613_0102551 | 3300046689 | Bacteria | 2066 |
| 280 | Ga0495670_0069818 | 3300046691 | Bacteria | 1777 |
| 281 | Ga0495670_0324126 | 3300046691 | Bacteria | 827 |
| 282 | Ga0495671_0386506 | 3300046692 | Bacteria | 670 |
| 283 | Ga0495671_0443905 | 3300046692 | Bacteria | 620 |
| 284 | Ga0495660_0103989 | 3300046810 | Bacteria | 1458 |
| 285 | Ga0495681_0069341 | 3300047470 | Bacteria | 1602 |
| 286 | Ga0495686_0023146 | 3300047472 | Bacteria | 4101 |
| 287 | Ga0495593_0234013 | 3300047673 | Bacteria | 921 |
| 288 | Ga0496101_0036213 | 3300048904 | Bacteria | 3495 |
| 289 | Ga0496102_1279632 | 3300048905 | Bacteria | 653 |
| 290 | Ga0496102_1650481 | 3300048905 | Bacteria | 559 |
| 291 | Ga0496111_0294099 | 3300048914 | Bacteria | 1204 |
| 292 | Ga0496113_0434250 | 3300048916 | Bacteria | 1055 |
| 293 | Ga0496114_0054141 | 3300048917 | Bacteria | 3346 |
| 294 | Ga0496116_0001079 | 3300048919 | Bacteria | 32822 |
| 295 | Ga0496117_0062392 | 3300048920 | Bacteria | 2554 |
| 296 | Ga0496117_0072971 | 3300048920 | Bacteria | 2291 |
| 297 | Ga0496117_0318226 | 3300048920 | Bacteria | 816 |
| 298 | Ga0496118_0054363 | 3300048921 | Bacteria | 3033 |
| 299 | Ga0496118_0108334 | 3300048921 | Bacteria | 1852 |
| 300 | Ga0496118_0141975 | 3300048921 | Bacteria | 1520 |
| 301 | Ga0496118_0213227 | 3300048921 | Bacteria | 1131 |
| 302 | Ga0496119_0385332 | 3300048922 | Bacteria | 671 |
| 303 | Ga0496121_0002000 | 3300048924 | Bacteria | 32381 |
| 304 | Ga0496121_0004531 | 3300048924 | Bacteria | 18595 |
| 305 | Ga0496121_0008731 | 3300048924 | Bacteria | 11827 |
| 306 | Ga0496121_0036259 | 3300048924 | Bacteria | 4397 |
| 307 | Ga0496121_0619636 | 3300048924 | Bacteria | 664 |
| 308 | Ga0496122_0026282 | 3300048925 | Bacteria | 5023 |
| 309 | Ga0496122_0115865 | 3300048925 | Bacteria | 1744 |
| 310 | Ga0496123_0009805 | 3300048926 | Bacteria | 8554 |
| 311 | Ga0496124_0016295 | 3300048927 | Bacteria | 7076 |
| 312 | Ga0496124_0329718 | 3300048927 | Bacteria | 1089 |
| 313 | Ga0496125_0010155 | 3300048928 | Bacteria | 9542 |
| 314 | Ga0496125_0020224 | 3300048928 | Bacteria | 6252 |
| 315 | Ga0496126_0010504 | 3300048929 | Bacteria | 9695 |
| 316 | Ga0496126_0019779 | 3300048929 | Bacteria | 6624 |
| 317 | Ga0496126_0038161 | 3300048929 | Bacteria | 4472 |
| 318 | Ga0496126_0069195 | 3300048929 | Bacteria | 3149 |
| 319 | Ga0496126_0249785 | 3300048929 | Bacteria | 1479 |
| 320 | Ga0496126_0281922 | 3300048929 | Bacteria | 1376 |
| 321 | Ga0495678_103743 | 3300049459 | Bacteria | 982 |
| 322 | Ga0501031_0001416 | 3300049568 | Bacteria | 14844 |
| 323 | Ga0501032_0001535 | 3300049569 | Bacteria | 18415 |
| 324 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 325 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 326 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 327 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 328 | Ga0501038_0000168 | 3300049574 | Bacteria | 55496 |
| 329 | Ga0501039_0001738 | 3300049575 | Bacteria | 16057 |
| 330 | Ga0501042_0100718 | 3300049578 | Bacteria | 2077 |
| 331 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 332 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 333 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 334 | Ga0501047_0297069 | 3300049581 | Bacteria | 1458 |
| 335 | Ga0501047_1099645 | 3300049581 | Bacteria | 608 |
| 336 | Ga0501048_0005136 | 3300049582 | Bacteria | 9969 |
| 337 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 338 | Ga0501068_0017473 | 3300049584 | Bacteria | 4148 |
| 339 | Ga0501069_0006075 | 3300049585 | Bacteria | 6302 |
| 340 | Ga0501070_0000966 | 3300049586 | Bacteria | 25809 |
| 341 | Ga0501070_0178694 | 3300049586 | Bacteria | 1747 |
| 342 | Ga0501072_0002586 | 3300049588 | Bacteria | 13564 |
| 343 | Ga0501073_0001352 | 3300049589 | Bacteria | 18086 |
| 344 | Ga0501074_0001829 | 3300049590 | Bacteria | 14566 |
| 345 | Ga0501076_1551857 | 3300049592 | Bacteria | 544 |
| 346 | Ga0501079_0005974 | 3300049741 | Bacteria | 9114 |
| 347 | Ga0501079_1413043 | 3300049741 | Bacteria | 547 |
| 348 | Ga0501080_0002456 | 3300049742 | Bacteria | 16216 |
| 349 | Ga0501080_1014912 | 3300049742 | Bacteria | 719 |
| 350 | Ga0501080_1494646 | 3300049742 | Bacteria | 574 |
| 351 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 352 | Ga0501044_0002732 | 3300049823 | Bacteria | 20068 |
| 353 | Ga0501044_0047552 | 3300049823 | Bacteria | 4437 |
| 354 | Ga0501045_0042514 | 3300049824 | Bacteria | 3307 |
| 355 | nmdc:mga03n38_173796_c1 | 3300050490 | Bacteria | 1099 |
| 356 | nmdc:mga00v17_15331_c1 | 3300050491 | Bacteria | 4302 |
| 357 | nmdc:mga0yw44_356818_c1 | 3300050492 | Bacteria | 985 |
| 358 | nmdc:mga0yw44_76597_c1 | 3300050492 | Bacteria | 2088 |
| 359 | nmdc:mga07m45_417537_c1 | 3300050496 | Bacteria | 778 |
| 360 | nmdc:mga07m45_96735_c1 | 3300050496 | Bacteria | 1694 |
| 361 | nmdc:mga0sz30_1268_c1 | 3300050516 | Bacteria | 8280 |
| 362 | Ga0500610_0261104 | 3300053079 | Bacteria | 791 |
| 363 | Ga0495655_0214785 | 3300053083 | Bacteria | 634 |
| 364 | Ga0500578_0031647 | 3300053086 | Bacteria | 3400 |
| 365 | Ga0500643_012208 | 3300053087 | Bacteria | 3085 |
| 366 | Ga0500644_0059857 | 3300053088 | Bacteria | 1337 |
| 367 | Ga0500647_0387774 | 3300053091 | Bacteria | 570 |
| 368 | Ga0500566_0002556 | 3300053094 | Bacteria | 10823 |
| 369 | Ga0500566_0390257 | 3300053094 | Bacteria | 626 |
| 370 | Ga0500641_0003271 | 3300053096 | Bacteria | 5729 |
| 371 | Ga0500648_037938 | 3300053097 | Bacteria | 2729 |
| 372 | Ga0500650_0001335 | 3300053098 | Bacteria | 7361 |
| 373 | Ga0500556_0000093 | 3300053104 | Bacteria | 82933 |
| 374 | Ga0500562_022038 | 3300053108 | Bacteria | 1659 |
| 375 | Ga0500562_159746 | 3300053108 | Bacteria | 613 |
| 376 | Ga0500569_081914 | 3300053109 | Bacteria | 1033 |
| 377 | Ga0500572_001373 | 3300053111 | Bacteria | 6718 |
| 378 | Ga0500592_000949 | 3300053116 | Bacteria | 4713 |
| 379 | Ga0500595_000722 | 3300053119 | Bacteria | 19637 |
| 380 | Ga0500595_001932 | 3300053119 | Bacteria | 10667 |
| 381 | Ga0500607_069184 | 3300053121 | Bacteria | 1826 |
| 382 | Ga0500608_115573 | 3300053122 | Bacteria | 1224 |
| 383 | Ga0500618_026755 | 3300053125 | Bacteria | 1376 |
| 384 | Ga0500642_0000013 | 3300053130 | Bacteria | 197927 |
| 385 | Ga0500652_020561 | 3300053131 | Bacteria | 2471 |
| 386 | Ga0500658_0046532 | 3300053134 | Bacteria | 1757 |
| 387 | Ga0500658_0463218 | 3300053134 | Bacteria | 576 |
| 388 | Ga0500559_0000773 | 3300053136 | Bacteria | 20950 |
| 389 | Ga0500559_0068115 | 3300053136 | Bacteria | 1598 |
| 390 | Ga0500559_0276337 | 3300053136 | Bacteria | 790 |
| 391 | Ga0500564_278133 | 3300053138 | Bacteria | 652 |
| 392 | Ga0500568_0004553 | 3300053139 | Bacteria | 7393 |
| 393 | Ga0500573_0034746 | 3300053140 | Bacteria | 2907 |
| 394 | Ga0500586_012230 | 3300053145 | Bacteria | 2490 |
| 395 | Ga0500590_019174 | 3300053148 | Bacteria | 3545 |
| 396 | Ga0500590_154910 | 3300053148 | Bacteria | 1029 |
| 397 | Ga0500604_0005473 | 3300053151 | Bacteria | 3351 |
| 398 | Ga0500604_0158680 | 3300053151 | Bacteria | 770 |
| 399 | Ga0500616_0000288 | 3300053153 | Bacteria | 73364 |
| 400 | Ga0500622_0000563 | 3300053156 | Bacteria | 33995 |
| 401 | Ga0500627_0114519 | 3300053158 | Bacteria | 1214 |
| 402 | Ga0500627_0285287 | 3300053158 | Bacteria | 724 |
| 403 | Ga0500633_0211331 | 3300053160 | Bacteria | 725 |
| 404 | Ga0500638_062268 | 3300053162 | Bacteria | 1792 |
| 405 | Ga0500639_103536 | 3300053163 | Bacteria | 1396 |
| 406 | Ga0500639_223881 | 3300053163 | Bacteria | 782 |
| 407 | Ga0500636_0002673 | 3300053177 | Bacteria | 9910 |
| 408 | Ga0500636_0022695 | 3300053177 | Bacteria | 3710 |
| 409 | Ga0500636_0043799 | 3300053177 | Bacteria | 2641 |
| 410 | Ga0500637_0194619 | 3300053178 | Bacteria | 1157 |
| 411 | Ga0500637_0284941 | 3300053178 | Bacteria | 907 |
| 412 | Ga0500570_192555 | 3300053724 | Bacteria | 635 |
| 413 | Ga0500576_154472 | 3300053725 | Bacteria | 852 |
| 414 | Ga0500645_066449 | 3300053730 | Bacteria | 1038 |
| 415 | Ga0500596_005359 | 3300053735 | Bacteria | 2266 |
| 416 | Ga0501084_0003876 | 3300054114 | Bacteria | 12173 |
| 417 | Ga0501082_0005063 | 3300060353 | Bacteria | 11489 |
| 418 | Ga0466962_0069484 | 3300061719 | Bacteria | 1682 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005455 | Ga0070663_101777163 | Ga0070663_1017771631 | 123 |
| 2 | 3300005539 | Ga0068853_100148017 | Ga0068853_1001480172 | 123 |
| 3 | 3300005614 | Ga0068856_100052958 | Ga0068856_1000529583 | 123 |
| 4 | 3300006028 | Ga0070717_10777688 | Ga0070717_107776882 | 123 |
| 5 | 3300013105 | Ga0157369_10210761 | Ga0157369_102107613 | 123 |
| 6 | 3300002077 | JGI24744J21845_10049709 | JGI24744J21845_100497091 | 124 |
| 7 | 3300005262 | Ga0065165_1061690 | Ga0065165_10616902 | 124 |
| 8 | 3300005329 | Ga0070683_100172892 | Ga0070683_1001728921 | 124 |
| 9 | 3300005330 | Ga0070690_100058058 | Ga0070690_1000580582 | 124 |
| 10 | 3300005335 | Ga0070666_10038193 | Ga0070666_100381933 | 124 |
| 11 | 3300005336 | Ga0070680_100007389 | Ga0070680_1000073894 | 124 |
| 12 | 3300005336 | Ga0070680_101541969 | Ga0070680_1015419691 | 124 |
| 13 | 3300005337 | Ga0070682_100155311 | Ga0070682_1001553112 | 124 |
| 14 | 3300005339 | Ga0070660_100031034 | Ga0070660_1000310343 | 124 |
| 15 | 3300005341 | Ga0070691_10682683 | Ga0070691_106826831 | 124 |
| 16 | 3300005344 | Ga0070661_100113731 | Ga0070661_1001137312 | 124 |
| 17 | 3300005347 | Ga0070668_100359354 | Ga0070668_1003593541 | 124 |
| 18 | 3300005364 | Ga0070673_101458785 | Ga0070673_1014587851 | 124 |
| 19 | 3300005366 | Ga0070659_100656577 | Ga0070659_1006565771 | 124 |
| 20 | 3300005366 | Ga0070659_101205208 | Ga0070659_1012052081 | 124 |
| 21 | 3300005367 | Ga0070667_100613874 | Ga0070667_1006138741 | 124 |
| 22 | 3300005434 | Ga0070709_10016067 | Ga0070709_100160672 | 124 |
| 23 | 3300005435 | Ga0070714_100294234 | Ga0070714_1002942342 | 124 |
| 24 | 3300005436 | Ga0070713_100160598 | Ga0070713_1001605982 | 124 |
| 25 | 3300005437 | Ga0070710_10022746 | Ga0070710_100227464 | 124 |
| 26 | 3300005437 | Ga0070710_11423936 | Ga0070710_114239361 | 124 |
| 27 | 3300005438 | Ga0070701_10039619 | Ga0070701_100396192 | 124 |
| 28 | 3300005439 | Ga0070711_100074531 | Ga0070711_1000745312 | 124 |
| 29 | 3300005441 | Ga0070700_100038164 | Ga0070700_1000381642 | 124 |
| 30 | 3300005445 | Ga0070708_100918273 | Ga0070708_1009182731 | 124 |
| 31 | 3300005455 | Ga0070663_100071910 | Ga0070663_1000719103 | 124 |
| 32 | 3300005455 | Ga0070663_100288993 | Ga0070663_1002889932 | 124 |
| 33 | 3300005455 | Ga0070663_100305072 | Ga0070663_1003050722 | 124 |
| 34 | 3300005456 | Ga0070678_100015766 | Ga0070678_1000157662 | 124 |
| 35 | 3300005456 | Ga0070678_100081184 | Ga0070678_1000811842 | 124 |
| 36 | 3300005457 | Ga0070662_100174890 | Ga0070662_1001748902 | 124 |
| 37 | 3300005458 | Ga0070681_10292834 | Ga0070681_102928342 | 124 |
| 38 | 3300005458 | Ga0070681_10423433 | Ga0070681_104234331 | 124 |
| 39 | 3300005458 | Ga0070681_10924128 | Ga0070681_109241281 | 124 |
| 40 | 3300005458 | Ga0070681_11378498 | Ga0070681_113784981 | 124 |
| 41 | 3300005459 | Ga0068867_100320231 | Ga0068867_1003202312 | 124 |
| 42 | 3300005466 | Ga0070685_10240521 | Ga0070685_102405212 | 124 |
| 43 | 3300005530 | Ga0070679_100139562 | Ga0070679_1001395624 | 124 |
| 44 | 3300005530 | Ga0070679_100358580 | Ga0070679_1003585802 | 124 |
| 45 | 3300005530 | Ga0070679_100376984 | Ga0070679_1003769842 | 124 |
| 46 | 3300005530 | Ga0070679_100426980 | Ga0070679_1004269802 | 124 |
| 47 | 3300005535 | Ga0070684_100106654 | Ga0070684_1001066544 | 124 |
| 48 | 3300005536 | Ga0070697_100138279 | Ga0070697_1001382792 | 124 |
| 49 | 3300005539 | Ga0068853_100055730 | Ga0068853_1000557303 | 124 |
| 50 | 3300005539 | Ga0068853_100172343 | Ga0068853_1001723433 | 124 |
| 51 | 3300005539 | Ga0068853_100284872 | Ga0068853_1002848722 | 124 |
| 52 | 3300005539 | Ga0068853_100633780 | Ga0068853_1006337802 | 124 |
| 53 | 3300005543 | Ga0070672_100033812 | Ga0070672_1000338122 | 124 |
| 54 | 3300005547 | Ga0070693_100036806 | Ga0070693_1000368062 | 124 |
| 55 | 3300005548 | Ga0070665_100608590 | Ga0070665_1006085902 | 124 |
| 56 | 3300005549 | Ga0070704_100295425 | Ga0070704_1002954252 | 124 |
| 57 | 3300005563 | Ga0068855_100128442 | Ga0068855_1001284422 | 124 |
| 58 | 3300005563 | Ga0068855_100232775 | Ga0068855_1002327751 | 124 |
| 59 | 3300005563 | Ga0068855_100545390 | Ga0068855_1005453902 | 124 |
| 60 | 3300005563 | Ga0068855_102134287 | Ga0068855_1021342871 | 124 |
| 61 | 3300005564 | Ga0070664_100795987 | Ga0070664_1007959872 | 124 |
| 62 | 3300005577 | Ga0068857_100105694 | Ga0068857_1001056941 | 124 |
| 63 | 3300005578 | Ga0068854_100451516 | Ga0068854_1004515162 | 124 |
| 64 | 3300005615 | Ga0070702_100697112 | Ga0070702_1006971121 | 124 |
| 65 | 3300005615 | Ga0070702_101158828 | Ga0070702_1011588281 | 124 |
| 66 | 3300005616 | Ga0068852_100494051 | Ga0068852_1004940512 | 124 |
| 67 | 3300005617 | Ga0068859_100755891 | Ga0068859_1007558912 | 124 |
| 68 | 3300005718 | Ga0068866_10035166 | Ga0068866_100351662 | 124 |
| 69 | 3300005719 | Ga0068861_100269480 | Ga0068861_1002694802 | 124 |
| 70 | 3300005719 | Ga0068861_102040495 | Ga0068861_1020404951 | 124 |
| 71 | 3300005840 | Ga0068870_10192013 | Ga0068870_101920132 | 124 |
| 72 | 3300005842 | Ga0068858_101813642 | Ga0068858_1018136422 | 124 |
| 73 | 3300005843 | Ga0068860_100289130 | Ga0068860_1002891302 | 124 |
| 74 | 3300005937 | Ga0081455_10029336 | Ga0081455_100293366 | 124 |
| 75 | 3300005983 | Ga0081540_1036331 | Ga0081540_10363314 | 124 |
| 76 | 3300006028 | Ga0070717_10157941 | Ga0070717_101579413 | 124 |
| 77 | 3300006028 | Ga0070717_10544488 | Ga0070717_105444882 | 124 |
| 78 | 3300006038 | Ga0075365_10010590 | Ga0075365_100105903 | 124 |
| 79 | 3300006038 | Ga0075365_10219578 | Ga0075365_102195782 | 124 |
| 80 | 3300006048 | Ga0075363_100157866 | Ga0075363_1001578662 | 124 |
| 81 | 3300006051 | Ga0075364_10105790 | Ga0075364_101057903 | 124 |
| 82 | 3300006173 | Ga0070716_100155776 | Ga0070716_1001557762 | 124 |
| 83 | 3300006186 | Ga0075369_10005935 | Ga0075369_100059355 | 124 |
| 84 | 3300006353 | Ga0075370_10128050 | Ga0075370_101280502 | 124 |
| 85 | 3300006358 | Ga0068871_100528645 | Ga0068871_1005286452 | 124 |
| 86 | 3300006358 | Ga0068871_100871097 | Ga0068871_1008710972 | 124 |
| 87 | 3300006871 | Ga0075434_100808064 | Ga0075434_1008080642 | 124 |
| 88 | 3300006881 | Ga0068865_100121416 | Ga0068865_1001214162 | 124 |
| 89 | 3300006931 | Ga0097620_100756011 | Ga0097620_1007560112 | 124 |
| 90 | 3300007265 | Ga0099794_10051835 | Ga0099794_100518353 | 124 |
| 91 | 3300009093 | Ga0105240_10189307 | Ga0105240_101893073 | 124 |
| 92 | 3300009093 | Ga0105240_10364428 | Ga0105240_103644283 | 124 |
| 93 | 3300009148 | Ga0105243_10077605 | Ga0105243_100776053 | 124 |
| 94 | 3300009177 | Ga0105248_10355813 | Ga0105248_103558131 | 124 |
| 95 | 3300009545 | Ga0105237_10084021 | Ga0105237_100840214 | 124 |
| 96 | 3300009545 | Ga0105237_11181696 | Ga0105237_111816962 | 124 |
| 97 | 3300009545 | Ga0105237_11441453 | Ga0105237_114414532 | 124 |
| 98 | 3300009551 | Ga0105238_10053335 | Ga0105238_100533354 | 124 |
| 99 | 3300009551 | Ga0105238_10100152 | Ga0105238_101001523 | 124 |
| 100 | 3300009551 | Ga0105238_10940108 | Ga0105238_109401082 | 124 |
| 101 | 3300009551 | Ga0105238_11031944 | Ga0105238_110319441 | 124 |
| 102 | 3300009551 | Ga0105238_11095211 | Ga0105238_110952112 | 124 |
| 103 | 3300009553 | Ga0105249_10526570 | Ga0105249_105265702 | 124 |
| 104 | 3300009553 | Ga0105249_10987675 | Ga0105249_109876752 | 124 |
| 105 | 3300010159 | Ga0099796_10248810 | Ga0099796_102488101 | 124 |
| 106 | 3300010375 | Ga0105239_10118317 | Ga0105239_101183173 | 124 |
| 107 | 3300010375 | Ga0105239_11467835 | Ga0105239_114678352 | 124 |
| 108 | 3300010375 | Ga0105239_12608125 | Ga0105239_126081251 | 124 |
| 109 | 3300012477 | Ga0157336_1021652 | Ga0157336_10216522 | 124 |
| 110 | 3300013100 | Ga0157373_10422977 | Ga0157373_104229771 | 124 |
| 111 | 3300013102 | Ga0157371_10195502 | Ga0157371_101955022 | 124 |
| 112 | 3300013104 | Ga0157370_10230389 | Ga0157370_102303893 | 124 |
| 113 | 3300013104 | Ga0157370_10287386 | Ga0157370_102873862 | 124 |
| 114 | 3300013104 | Ga0157370_11787725 | Ga0157370_117877251 | 124 |
| 115 | 3300013105 | Ga0157369_10023406 | Ga0157369_100234067 | 124 |
| 116 | 3300013105 | Ga0157369_12168543 | Ga0157369_121685431 | 124 |
| 117 | 3300013105 | Ga0157369_12206903 | Ga0157369_122069031 | 124 |
| 118 | 3300013296 | Ga0157374_11770303 | Ga0157374_117703031 | 124 |
| 119 | 3300013297 | Ga0157378_10053833 | Ga0157378_100538333 | 124 |
| 120 | 3300013297 | Ga0157378_10207045 | Ga0157378_102070453 | 124 |
| 121 | 3300013306 | Ga0163162_10744684 | Ga0163162_107446842 | 124 |
| 122 | 3300013307 | Ga0157372_11744827 | Ga0157372_117448271 | 124 |
| 123 | 3300013307 | Ga0157372_12065312 | Ga0157372_120653122 | 124 |
| 124 | 3300013308 | Ga0157375_10388145 | Ga0157375_103881451 | 124 |
| 125 | 3300014326 | Ga0157380_10769004 | Ga0157380_107690042 | 124 |
| 126 | 3300017792 | Ga0163161_10373389 | Ga0163161_103733892 | 124 |
| 127 | 3300020082 | Ga0206353_10888638 | Ga0206353_108886382 | 124 |
| 128 | 3300021384 | Ga0213876_10140856 | Ga0213876_101408562 | 124 |
| 129 | 3300021384 | Ga0213876_10367344 | Ga0213876_103673441 | 124 |
| 130 | 3300021388 | Ga0213875_10513547 | Ga0213875_105135471 | 124 |
| 131 | 3300025295 | Ga0209564_1012301 | Ga0209564_10123014 | 124 |
| 132 | 3300025297 | Ga0209758_1001389 | Ga0209758_100138923 | 124 |
| 133 | 3300025297 | Ga0209758_1122871 | Ga0209758_11228712 | 124 |
| 134 | 3300025299 | Ga0209256_1054405 | Ga0209256_10544052 | 124 |
| 135 | 3300025893 | Ga0207682_10156823 | Ga0207682_101568231 | 124 |
| 136 | 3300025898 | Ga0207692_10089711 | Ga0207692_100897112 | 124 |
| 137 | 3300025899 | Ga0207642_10032263 | Ga0207642_100322632 | 124 |
| 138 | 3300025901 | Ga0207688_10080193 | Ga0207688_100801932 | 124 |
| 139 | 3300025901 | Ga0207688_10111212 | Ga0207688_101112121 | 124 |
| 140 | 3300025906 | Ga0207699_10015638 | Ga0207699_100156382 | 124 |
| 141 | 3300025906 | Ga0207699_10223569 | Ga0207699_102235691 | 124 |
| 142 | 3300025907 | Ga0207645_10025563 | Ga0207645_100255632 | 124 |
| 143 | 3300025908 | Ga0207643_10256456 | Ga0207643_102564562 | 124 |
| 144 | 3300025909 | Ga0207705_10062712 | Ga0207705_100627123 | 124 |
| 145 | 3300025909 | Ga0207705_10089169 | Ga0207705_100891693 | 124 |
| 146 | 3300025911 | Ga0207654_10736031 | Ga0207654_107360312 | 124 |
| 147 | 3300025912 | Ga0207707_10003914 | Ga0207707_100039143 | 124 |
| 148 | 3300025913 | Ga0207695_10101630 | Ga0207695_101016302 | 124 |
| 149 | 3300025913 | Ga0207695_10686317 | Ga0207695_106863171 | 124 |
| 150 | 3300025914 | Ga0207671_10059694 | Ga0207671_100596941 | 124 |
| 151 | 3300025914 | Ga0207671_10824282 | Ga0207671_108242821 | 124 |
| 152 | 3300025914 | Ga0207671_10956806 | Ga0207671_109568062 | 124 |
| 153 | 3300025916 | Ga0207663_10052543 | Ga0207663_100525432 | 124 |
| 154 | 3300025917 | Ga0207660_10007130 | Ga0207660_100071306 | 124 |
| 155 | 3300025917 | Ga0207660_10127243 | Ga0207660_101272431 | 124 |
| 156 | 3300025919 | Ga0207657_10001107 | Ga0207657_100011072 | 124 |
| 157 | 3300025919 | Ga0207657_10003265 | Ga0207657_100032655 | 124 |
| 158 | 3300025919 | Ga0207657_10113495 | Ga0207657_101134952 | 124 |
| 159 | 3300025921 | Ga0207652_10006801 | Ga0207652_100068018 | 124 |
| 160 | 3300025921 | Ga0207652_10107372 | Ga0207652_101073723 | 124 |
| 161 | 3300025921 | Ga0207652_10222297 | Ga0207652_102222973 | 124 |
| 162 | 3300025921 | Ga0207652_10239816 | Ga0207652_102398163 | 124 |
| 163 | 3300025924 | Ga0207694_10272395 | Ga0207694_102723952 | 124 |
| 164 | 3300025924 | Ga0207694_11450643 | Ga0207694_114506431 | 124 |
| 165 | 3300025926 | Ga0207659_10989090 | Ga0207659_109890902 | 124 |
| 166 | 3300025928 | Ga0207700_10030198 | Ga0207700_100301984 | 124 |
| 167 | 3300025928 | Ga0207700_10032738 | Ga0207700_100327382 | 124 |
| 168 | 3300025929 | Ga0207664_10174642 | Ga0207664_101746421 | 124 |
| 169 | 3300025929 | Ga0207664_10741659 | Ga0207664_107416592 | 124 |
| 170 | 3300025932 | Ga0207690_10628948 | Ga0207690_106289482 | 124 |
| 171 | 3300025933 | Ga0207706_10068509 | Ga0207706_100685093 | 124 |
| 172 | 3300025935 | Ga0207709_10064742 | Ga0207709_100647422 | 124 |
| 173 | 3300025937 | Ga0207669_10044284 | Ga0207669_100442843 | 124 |
| 174 | 3300025938 | Ga0207704_10383072 | Ga0207704_103830722 | 124 |
| 175 | 3300025939 | Ga0207665_10139544 | Ga0207665_101395442 | 124 |
| 176 | 3300025940 | Ga0207691_10174632 | Ga0207691_101746322 | 124 |
| 177 | 3300025941 | Ga0207711_10742657 | Ga0207711_107426572 | 124 |
| 178 | 3300025942 | Ga0207689_10347380 | Ga0207689_103473802 | 124 |
| 179 | 3300025944 | Ga0207661_10316817 | Ga0207661_103168172 | 124 |
| 180 | 3300025945 | Ga0207679_11060235 | Ga0207679_110602352 | 124 |
| 181 | 3300025949 | Ga0207667_10006765 | Ga0207667_100067659 | 124 |
| 182 | 3300025949 | Ga0207667_10286473 | Ga0207667_102864733 | 124 |
| 183 | 3300025949 | Ga0207667_10687616 | Ga0207667_106876162 | 124 |
| 184 | 3300025949 | Ga0207667_11049112 | Ga0207667_110491122 | 124 |
| 185 | 3300025960 | Ga0207651_10676730 | Ga0207651_106767302 | 124 |
| 186 | 3300025961 | Ga0207712_10050677 | Ga0207712_100506772 | 124 |
| 187 | 3300025961 | Ga0207712_11383037 | Ga0207712_113830372 | 124 |
| 188 | 3300025972 | Ga0207668_10073062 | Ga0207668_100730623 | 124 |
| 189 | 3300025972 | Ga0207668_11364262 | Ga0207668_113642622 | 124 |
| 190 | 3300025986 | Ga0207658_10879161 | Ga0207658_108791611 | 124 |
| 191 | 3300025986 | Ga0207658_11133011 | Ga0207658_111330112 | 124 |
| 192 | 3300026041 | Ga0207639_10082247 | Ga0207639_100822472 | 124 |
| 193 | 3300026041 | Ga0207639_11029962 | Ga0207639_110299622 | 124 |
| 194 | 3300026067 | Ga0207678_10243027 | Ga0207678_102430272 | 124 |
| 195 | 3300026067 | Ga0207678_10314679 | Ga0207678_103146792 | 124 |
| 196 | 3300026067 | Ga0207678_10549058 | Ga0207678_105490582 | 124 |
| 197 | 3300026075 | Ga0207708_10020945 | Ga0207708_100209454 | 124 |
| 198 | 3300026078 | Ga0207702_10000779 | Ga0207702_100007795 | 124 |
| 199 | 3300026089 | Ga0207648_10295404 | Ga0207648_102954042 | 124 |
| 200 | 3300026116 | Ga0207674_10026227 | Ga0207674_100262273 | 124 |
| 201 | 3300026118 | Ga0207675_100054504 | Ga0207675_1000545042 | 124 |
| 202 | 3300026118 | Ga0207675_101588932 | Ga0207675_1015889321 | 124 |
| 203 | 3300026121 | Ga0207683_10135032 | Ga0207683_101350321 | 124 |
| 204 | 3300026121 | Ga0207683_10417393 | Ga0207683_104173932 | 124 |
| 205 | 3300028379 | Ga0268266_10804910 | Ga0268266_108049102 | 124 |
| 206 | 3300028381 | Ga0268264_10246093 | Ga0268264_102460932 | 124 |
| 207 | 3300028381 | Ga0268264_11302069 | Ga0268264_113020691 | 124 |
| 208 | 3300028786 | Ga0307517_10222087 | Ga0307517_102220872 | 124 |
| 209 | 3300028794 | Ga0307515_10160916 | Ga0307515_101609163 | 124 |
| 210 | 3300030521 | Ga0307511_10257392 | Ga0307511_102573922 | 124 |
| 211 | 3300031235 | Ga0265330_10080250 | Ga0265330_100802502 | 124 |
| 212 | 3300031250 | Ga0265331_10085570 | Ga0265331_100855702 | 124 |
| 213 | 3300031456 | Ga0307513_10303541 | Ga0307513_103035412 | 124 |
| 214 | 3300031507 | Ga0307509_10005003 | Ga0307509_1000500311 | 124 |
| 215 | 3300031507 | Ga0307509_10506323 | Ga0307509_105063232 | 124 |
| 216 | 3300031548 | Ga0307408_101759755 | Ga0307408_1017597551 | 124 |
| 217 | 3300031616 | Ga0307508_10156499 | Ga0307508_101564993 | 124 |
| 218 | 3300031711 | Ga0265314_10003829 | Ga0265314_100038297 | 124 |
| 219 | 3300033179 | Ga0307507_10135440 | Ga0307507_101354402 | 124 |
| 220 | 3300033180 | Ga0307510_10304132 | Ga0307510_103041321 | 124 |
| 221 | 3300035083 | Ga0373926_0170328 | Ga0373926_0170328_347_727 | 124 |
| 222 | 3300035121 | Ga0373960_0237389 | Ga0373960_0237389_76_450 | 124 |
| 223 | 3300035695 | Ga0373927_0004710 | Ga0373927_0004710_4804_5184 | 124 |
| 224 | 3300035695 | Ga0373927_0370666 | Ga0373927_0370666_122_508 | 124 |
| 225 | 3300035695 | Ga0373927_0639096 | Ga0373927_0639096_207_587 | 124 |
| 226 | 3300035724 | Ga0373933_0312628 | Ga0373933_0312628_579_962 | 124 |
| 227 | 3300035725 | Ga0373947_0028170 | Ga0373947_0028170_1668_2048 | 124 |
| 228 | 3300035725 | Ga0373947_0435920 | Ga0373947_0435920_126_509 | 124 |
| 229 | 3300037853 | Ga0436364_0235057 | Ga0436364_0235057_136_513 | 124 |
| 230 | 3300037853 | Ga0436364_0342884 | Ga0436364_0342884_2712_3092 | 124 |
| 231 | 3300037853 | Ga0436364_1488077 | Ga0436364_1488077_379_753 | 124 |
| 232 | 3300039437 | Ga0436365_0236628 | Ga0436365_0236628_36_416 | 124 |
| 233 | 3300039437 | Ga0436365_0602497 | Ga0436365_0602497_345_719 | 124 |
| 234 | 3300039437 | Ga0436365_1775282 | Ga0436365_1775282_224_598 | 124 |
| 235 | 3300039447 | Ga0436361_0113118 | Ga0436361_0113118_19_393 | 124 |
| 236 | 3300041503 | Ga0451847_0693823 | Ga0451847_0693823_104_478 | 124 |
| 237 | 3300044765 | Ga0466970_0236486 | Ga0466970_0236486_618_992 | 124 |
| 238 | 3300044842 | Ga0466957_0020953 | Ga0466957_0020953_3362_3736 | 124 |
| 239 | 3300045049 | Ga0466959_0008200 | Ga0466959_0008200_6491_6865 | 124 |
| 240 | 3300045976 | Ga0466967_0052094 | Ga0466967_0052094_998_1381 | 124 |
| 241 | 3300045976 | Ga0466967_0291737 | Ga0466967_0291737_946_1320 | 124 |
| 242 | 3300045976 | Ga0466967_1033854 | Ga0466967_1033854_129_515 | 124 |
| 243 | 3300046457 | Ga0495590_0372221 | Ga0495590_0372221_110_484 | 124 |
| 244 | 3300046460 | Ga0495638_0006147 | Ga0495638_0006147_731_1105 | 124 |
| 245 | 3300046460 | Ga0495638_0021606 | Ga0495638_0021606_1870_2244 | 124 |
| 246 | 3300046460 | Ga0495638_0156399 | Ga0495638_0156399_768_1142 | 124 |
| 247 | 3300046492 | Ga0495585_0529522 | Ga0495585_0529522_35_409 | 124 |
| 248 | 3300046500 | Ga0495596_0206394 | Ga0495596_0206394_44_418 | 124 |
| 249 | 3300046500 | Ga0495596_0326209 | Ga0495596_0326209_69_443 | 124 |
| 250 | 3300046501 | Ga0495607_0021583 | Ga0495607_0021583_210_584 | 124 |
| 251 | 3300046501 | Ga0495607_0411769 | Ga0495607_0411769_127_501 | 124 |
| 252 | 3300046506 | Ga0495583_0074598 | Ga0495583_0074598_299_673 | 124 |
| 253 | 3300046506 | Ga0495583_0351697 | Ga0495583_0351697_102_476 | 124 |
| 254 | 3300046507 | Ga0495606_0497871 | Ga0495606_0497871_136_510 | 124 |
| 255 | 3300046512 | Ga0495610_0052281 | Ga0495610_0052281_108_482 | 124 |
| 256 | 3300046513 | Ga0495616_0387549 | Ga0495616_0387549_83_457 | 124 |
| 257 | 3300046515 | Ga0495620_0027189 | Ga0495620_0027189_1288_1662 | 124 |
| 258 | 3300046518 | Ga0495631_0170698 | Ga0495631_0170698_143_517 | 124 |
| 259 | 3300046518 | Ga0495631_0174257 | Ga0495631_0174257_145_519 | 124 |
| 260 | 3300046518 | Ga0495631_0309673 | Ga0495631_0309673_43_417 | 124 |
| 261 | 3300046519 | Ga0495632_0058973 | Ga0495632_0058973_1313_1687 | 124 |
| 262 | 3300046522 | Ga0495643_0478199 | Ga0495643_0478199_130_504 | 124 |
| 263 | 3300046524 | Ga0495648_0001581 | Ga0495648_0001581_11432_11809 | 124 |
| 264 | 3300046524 | Ga0495648_0106511 | Ga0495648_0106511_1041_1415 | 124 |
| 265 | 3300046526 | Ga0495666_0406740 | Ga0495666_0406740_69_443 | 124 |
| 266 | 3300046530 | Ga0495654_0057472 | Ga0495654_0057472_58_432 | 124 |
| 267 | 3300046530 | Ga0495654_0316291 | Ga0495654_0316291_160_534 | 124 |
| 268 | 3300046535 | Ga0495586_0214964 | Ga0495586_0214964_170_547 | 124 |
| 269 | 3300046542 | Ga0495597_0195007 | Ga0495597_0195007_238_612 | 124 |
| 270 | 3300046543 | Ga0495645_0141104 | Ga0495645_0141104_791_1174 | 124 |
| 271 | 3300046557 | Ga0495622_0351620 | Ga0495622_0351620_163_543 | 124 |
| 272 | 3300046660 | Ga0495625_0378990 | Ga0495625_0378990_502_876 | 124 |
| 273 | 3300046660 | Ga0495625_0396425 | Ga0495625_0396425_325_699 | 124 |
| 274 | 3300046660 | Ga0495625_0603085 | Ga0495625_0603085_102_476 | 124 |
| 275 | 3300046665 | Ga0495661_0087118 | Ga0495661_0087118_418_792 | 124 |
| 276 | 3300046665 | Ga0495661_0612512 | Ga0495661_0612512_14_388 | 124 |
| 277 | 3300046678 | Ga0495599_0125275 | Ga0495599_0125275_581_958 | 124 |
| 278 | 3300046684 | Ga0495669_0002591 | Ga0495669_0002591_2709_3083 | 124 |
| 279 | 3300046689 | Ga0495613_0102551 | Ga0495613_0102551_717_1097 | 124 |
| 280 | 3300046691 | Ga0495670_0069818 | Ga0495670_0069818_956_1330 | 124 |
| 281 | 3300046691 | Ga0495670_0324126 | Ga0495670_0324126_69_443 | 124 |
| 282 | 3300046692 | Ga0495671_0386506 | Ga0495671_0386506_61_435 | 124 |
| 283 | 3300046692 | Ga0495671_0443905 | Ga0495671_0443905_35_409 | 124 |
| 284 | 3300046810 | Ga0495660_0103989 | Ga0495660_0103989_124_498 | 124 |
| 285 | 3300047470 | Ga0495681_0069341 | Ga0495681_0069341_810_1184 | 124 |
| 286 | 3300047472 | Ga0495686_0023146 | Ga0495686_0023146_621_995 | 124 |
| 287 | 3300047673 | Ga0495593_0234013 | Ga0495593_0234013_117_497 | 124 |
| 288 | 3300048904 | Ga0496101_0036213 | Ga0496101_0036213_1932_2306 | 124 |
| 289 | 3300048905 | Ga0496102_1279632 | Ga0496102_1279632_38_412 | 124 |
| 290 | 3300048905 | Ga0496102_1650481 | Ga0496102_1650481_148_522 | 124 |
| 291 | 3300048914 | Ga0496111_0294099 | Ga0496111_0294099_153_530 | 124 |
| 292 | 3300048916 | Ga0496113_0434250 | Ga0496113_0434250_59_436 | 124 |
| 293 | 3300048917 | Ga0496114_0054141 | Ga0496114_0054141_2404_2778 | 124 |
| 294 | 3300048919 | Ga0496116_0001079 | Ga0496116_0001079_25619_25996 | 124 |
| 295 | 3300048920 | Ga0496117_0062392 | Ga0496117_0062392_212_589 | 124 |
| 296 | 3300048920 | Ga0496117_0072971 | Ga0496117_0072971_1100_1474 | 124 |
| 297 | 3300048920 | Ga0496117_0318226 | Ga0496117_0318226_432_806 | 124 |
| 298 | 3300048921 | Ga0496118_0054363 | Ga0496118_0054363_665_1132 | 124 |
| 299 | 3300048921 | Ga0496118_0108334 | Ga0496118_0108334_553_927 | 124 |
| 300 | 3300048921 | Ga0496118_0141975 | Ga0496118_0141975_895_1272 | 124 |
| 301 | 3300048921 | Ga0496118_0213227 | Ga0496118_0213227_19_393 | 124 |
| 302 | 3300048922 | Ga0496119_0385332 | Ga0496119_0385332_61_435 | 124 |
| 303 | 3300048924 | Ga0496121_0002000 | Ga0496121_0002000_18332_18706 | 124 |
| 304 | 3300048924 | Ga0496121_0004531 | Ga0496121_0004531_4506_4883 | 124 |
| 305 | 3300048924 | Ga0496121_0008731 | Ga0496121_0008731_10181_10561 | 124 |
| 306 | 3300048924 | Ga0496121_0036259 | Ga0496121_0036259_3836_4210 | 124 |
| 307 | 3300048924 | Ga0496121_0619636 | Ga0496121_0619636_82_456 | 124 |
| 308 | 3300048925 | Ga0496122_0026282 | Ga0496122_0026282_1480_1854 | 124 |
| 309 | 3300048925 | Ga0496122_0115865 | Ga0496122_0115865_709_1083 | 124 |
| 310 | 3300048926 | Ga0496123_0009805 | Ga0496123_0009805_1327_1701 | 124 |
| 311 | 3300048927 | Ga0496124_0016295 | Ga0496124_0016295_3144_3521 | 124 |
| 312 | 3300048927 | Ga0496124_0329718 | Ga0496124_0329718_392_766 | 124 |
| 313 | 3300048928 | Ga0496125_0010155 | Ga0496125_0010155_4533_4907 | 124 |
| 314 | 3300048928 | Ga0496125_0020224 | Ga0496125_0020224_1343_1720 | 124 |
| 315 | 3300048929 | Ga0496126_0010504 | Ga0496126_0010504_4112_4510 | 124 |
| 316 | 3300048929 | Ga0496126_0019779 | Ga0496126_0019779_1778_2152 | 124 |
| 317 | 3300048929 | Ga0496126_0038161 | Ga0496126_0038161_3551_3931 | 124 |
| 318 | 3300048929 | Ga0496126_0069195 | Ga0496126_0069195_113_562 | 124 |
| 319 | 3300048929 | Ga0496126_0249785 | Ga0496126_0249785_65_439 | 124 |
| 320 | 3300048929 | Ga0496126_0281922 | Ga0496126_0281922_951_1325 | 124 |
| 321 | 3300049459 | Ga0495678_103743 | Ga0495678_103743_250_624 | 124 |
| 322 | 3300049568 | Ga0501031_0001416 | Ga0501031_0001416_3383_3760 | 124 |
| 323 | 3300049569 | Ga0501032_0001535 | Ga0501032_0001535_15499_15876 | 124 |
| 324 | 3300049570 | Ga0501033_0000311 | Ga0501033_0000311_40320_40697 | 124 |
| 325 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_194958_195335 | 124 |
| 326 | 3300049572 | Ga0501036_0000127 | Ga0501036_0000127_42154_42531 | 124 |
| 327 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_97527_97904 | 124 |
| 328 | 3300049574 | Ga0501038_0000168 | Ga0501038_0000168_31885_32262 | 124 |
| 329 | 3300049575 | Ga0501039_0001738 | Ga0501039_0001738_12262_12639 | 124 |
| 330 | 3300049578 | Ga0501042_0100718 | Ga0501042_0100718_561_938 | 124 |
| 331 | 3300049579 | Ga0501043_0000120 | Ga0501043_0000120_3330_3707 | 124 |
| 332 | 3300049580 | Ga0501046_0000359 | Ga0501046_0000359_42173_42550 | 124 |
| 333 | 3300049581 | Ga0501047_0000379 | Ga0501047_0000379_32109_32486 | 124 |
| 334 | 3300049581 | Ga0501047_0297069 | Ga0501047_0297069_297_677 | 124 |
| 335 | 3300049581 | Ga0501047_1099645 | Ga0501047_1099645_49_423 | 124 |
| 336 | 3300049582 | Ga0501048_0005136 | Ga0501048_0005136_6252_6629 | 124 |
| 337 | 3300049583 | Ga0501067_0000025 | Ga0501067_0000025_40736_41113 | 124 |
| 338 | 3300049584 | Ga0501068_0017473 | Ga0501068_0017473_2399_2776 | 124 |
| 339 | 3300049585 | Ga0501069_0006075 | Ga0501069_0006075_1200_1577 | 124 |
| 340 | 3300049586 | Ga0501070_0000966 | Ga0501070_0000966_9089_9466 | 124 |
| 341 | 3300049586 | Ga0501070_0178694 | Ga0501070_0178694_62_439 | 124 |
| 342 | 3300049588 | Ga0501072_0002586 | Ga0501072_0002586_3394_3771 | 124 |
| 343 | 3300049589 | Ga0501073_0001352 | Ga0501073_0001352_2666_3043 | 124 |
| 344 | 3300049590 | Ga0501074_0001829 | Ga0501074_0001829_686_1063 | 124 |
| 345 | 3300049592 | Ga0501076_1551857 | Ga0501076_1551857_94_468 | 124 |
| 346 | 3300049741 | Ga0501079_0005974 | Ga0501079_0005974_3379_3756 | 124 |
| 347 | 3300049741 | Ga0501079_1413043 | Ga0501079_1413043_159_533 | 124 |
| 348 | 3300049742 | Ga0501080_0002456 | Ga0501080_0002456_3379_3756 | 124 |
| 349 | 3300049742 | Ga0501080_1014912 | Ga0501080_1014912_278_676 | 124 |
| 350 | 3300049742 | Ga0501080_1494646 | Ga0501080_1494646_48_428 | 124 |
| 351 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_5309_5686 | 124 |
| 352 | 3300049823 | Ga0501044_0002732 | Ga0501044_0002732_9195_9572 | 124 |
| 353 | 3300049823 | Ga0501044_0047552 | Ga0501044_0047552_3457_3837 | 124 |
| 354 | 3300049824 | Ga0501045_0042514 | Ga0501045_0042514_2382_2759 | 124 |
| 355 | 3300050490 | nmdc:mga03n38_173796_c1 | nmdc:mga03n38_173796_c1_120_497 | 124 |
| 356 | 3300050491 | nmdc:mga00v17_15331_c1 | nmdc:mga00v17_15331_c1_3595_3972 | 124 |
| 357 | 3300050492 | nmdc:mga0yw44_356818_c1 | nmdc:mga0yw44_356818_c1_217_591 | 124 |
| 358 | 3300050492 | nmdc:mga0yw44_76597_c1 | nmdc:mga0yw44_76597_c1_735_1112 | 124 |
| 359 | 3300050496 | nmdc:mga07m45_417537_c1 | nmdc:mga07m45_417537_c1_394_768 | 124 |
| 360 | 3300050496 | nmdc:mga07m45_96735_c1 | nmdc:mga07m45_96735_c1_223_600 | 124 |
| 361 | 3300050516 | nmdc:mga0sz30_1268_c1 | nmdc:mga0sz30_1268_c1_2491_2868 | 124 |
| 362 | 3300053079 | Ga0500610_0261104 | Ga0500610_0261104_360_734 | 124 |
| 363 | 3300053083 | Ga0495655_0214785 | Ga0495655_0214785_34_408 | 124 |
| 364 | 3300053086 | Ga0500578_0031647 | Ga0500578_0031647_1102_1476 | 124 |
| 365 | 3300053087 | Ga0500643_012208 | Ga0500643_012208_394_768 | 124 |
| 366 | 3300053088 | Ga0500644_0059857 | Ga0500644_0059857_672_1046 | 124 |
| 367 | 3300053091 | Ga0500647_0387774 | Ga0500647_0387774_56_436 | 124 |
| 368 | 3300053094 | Ga0500566_0002556 | Ga0500566_0002556_8208_8642 | 124 |
| 369 | 3300053094 | Ga0500566_0390257 | Ga0500566_0390257_80_460 | 124 |
| 370 | 3300053096 | Ga0500641_0003271 | Ga0500641_0003271_5158_5532 | 124 |
| 371 | 3300053097 | Ga0500648_037938 | Ga0500648_037938_80_457 | 124 |
| 372 | 3300053098 | Ga0500650_0001335 | Ga0500650_0001335_6035_6409 | 124 |
| 373 | 3300053104 | Ga0500556_0000093 | Ga0500556_0000093_27839_28213 | 124 |
| 374 | 3300053108 | Ga0500562_022038 | Ga0500562_022038_165_539 | 124 |
| 375 | 3300053108 | Ga0500562_159746 | Ga0500562_159746_215_589 | 124 |
| 376 | 3300053109 | Ga0500569_081914 | Ga0500569_081914_260_634 | 124 |
| 377 | 3300053111 | Ga0500572_001373 | Ga0500572_001373_2279_2659 | 124 |
| 378 | 3300053116 | Ga0500592_000949 | Ga0500592_000949_240_614 | 124 |
| 379 | 3300053119 | Ga0500595_000722 | Ga0500595_000722_19145_19519 | 124 |
| 380 | 3300053119 | Ga0500595_001932 | Ga0500595_001932_10184_10558 | 124 |
| 381 | 3300053121 | Ga0500607_069184 | Ga0500607_069184_647_1024 | 124 |
| 382 | 3300053122 | Ga0500608_115573 | Ga0500608_115573_158_592 | 124 |
| 383 | 3300053125 | Ga0500618_026755 | Ga0500618_026755_401_835 | 124 |
| 384 | 3300053130 | Ga0500642_0000013 | Ga0500642_0000013_45825_46199 | 124 |
| 385 | 3300053131 | Ga0500652_020561 | Ga0500652_020561_736_1110 | 124 |
| 386 | 3300053134 | Ga0500658_0046532 | Ga0500658_0046532_1061_1435 | 124 |
| 387 | 3300053134 | Ga0500658_0463218 | Ga0500658_0463218_127_501 | 124 |
| 388 | 3300053136 | Ga0500559_0000773 | Ga0500559_0000773_20515_20895 | 124 |
| 389 | 3300053136 | Ga0500559_0068115 | Ga0500559_0068115_205_582 | 124 |
| 390 | 3300053136 | Ga0500559_0276337 | Ga0500559_0276337_345_722 | 124 |
| 391 | 3300053138 | Ga0500564_278133 | Ga0500564_278133_205_582 | 124 |
| 392 | 3300053139 | Ga0500568_0004553 | Ga0500568_0004553_2859_3233 | 124 |
| 393 | 3300053140 | Ga0500573_0034746 | Ga0500573_0034746_611_988 | 124 |
| 394 | 3300053145 | Ga0500586_012230 | Ga0500586_012230_1271_1648 | 124 |
| 395 | 3300053148 | Ga0500590_019174 | Ga0500590_019174_2960_3394 | 124 |
| 396 | 3300053148 | Ga0500590_154910 | Ga0500590_154910_241_618 | 124 |
| 397 | 3300053151 | Ga0500604_0005473 | Ga0500604_0005473_1568_1942 | 124 |
| 398 | 3300053151 | Ga0500604_0158680 | Ga0500604_0158680_186_560 | 124 |
| 399 | 3300053153 | Ga0500616_0000288 | Ga0500616_0000288_28340_28714 | 124 |
| 400 | 3300053156 | Ga0500622_0000563 | Ga0500622_0000563_961_1335 | 124 |
| 401 | 3300053158 | Ga0500627_0114519 | Ga0500627_0114519_87_461 | 124 |
| 402 | 3300053158 | Ga0500627_0285287 | Ga0500627_0285287_110_484 | 124 |
| 403 | 3300053160 | Ga0500633_0211331 | Ga0500633_0211331_211_585 | 124 |
| 404 | 3300053162 | Ga0500638_062268 | Ga0500638_062268_542_922 | 124 |
| 405 | 3300053163 | Ga0500639_103536 | Ga0500639_103536_530_910 | 124 |
| 406 | 3300053163 | Ga0500639_223881 | Ga0500639_223881_120_497 | 124 |
| 407 | 3300053177 | Ga0500636_0002673 | Ga0500636_0002673_3842_4276 | 124 |
| 408 | 3300053177 | Ga0500636_0022695 | Ga0500636_0022695_2245_2625 | 124 |
| 409 | 3300053177 | Ga0500636_0043799 | Ga0500636_0043799_54_431 | 124 |
| 410 | 3300053178 | Ga0500637_0194619 | Ga0500637_0194619_366_800 | 124 |
| 411 | 3300053178 | Ga0500637_0284941 | Ga0500637_0284941_54_434 | 124 |
| 412 | 3300053724 | Ga0500570_192555 | Ga0500570_192555_172_546 | 124 |
| 413 | 3300053725 | Ga0500576_154472 | Ga0500576_154472_421_801 | 124 |
| 414 | 3300053730 | Ga0500645_066449 | Ga0500645_066449_33_407 | 124 |
| 415 | 3300053735 | Ga0500596_005359 | Ga0500596_005359_185_562 | 124 |
| 416 | 3300054114 | Ga0501084_0003876 | Ga0501084_0003876_9783_10160 | 124 |
| 417 | 3300060353 | Ga0501082_0005063 | Ga0501082_0005063_2306_2683 | 124 |
| 418 | 3300061719 | Ga0466962_0069484 | Ga0466962_0069484_113_487 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ztb-assembly2.cif.gz_B | structure of the salmonella trna pyrophosphokinase caprel | 0.4899 | 4 | 64 |
| 2qxl-assembly1.cif.gz_A | crystal structure analysis of sse1, a yeast hsp110 | 0.4249 | 25 | 122 |
| 2qxl-assembly1.cif.gz_B | crystal structure analysis of sse1, a yeast hsp110 | 0.4192 | 25 | 123 |
| 6gxn-assembly1.cif.gz_v | cryo-em structure of an e. coli 70s ribosome in complex with rf3-gdpcp, rf1(gaq) and pint-trna (state iii) | 0.378 | 8 | 104 |
| 8bqs-assembly1.cif.gz_BV | cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila | 0.3626 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6UWM9_1_280_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.4919 | 1 | 64 | 3.40.50.2000 |
| af_Q9VDA0_266_386_1.20.1320.20 | Mainly Alpha;Up-down Bundle;phosphoenolpyruvate carboxylase, domain 3;hef helicase domain | 0.4833 | 45 | 109 | 1.20.1320.20 |
| af_Q8ITC7_61_376_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4563 | 7 | 120 | 1.20.1070.10 |
| af_Q96DT5_1475_1622_1.20.140.100 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Dynein motor heavy chain, linker domain, N-terminal subdomain | 0.4355 | 1 | 119 | 1.20.140.100 |
| af_Q96DT5_1475_1622_1.20.140.100 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Dynein motor heavy chain, linker domain, N-terminal subdomain | 0.4206 | 1 | 119 | 1.20.140.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534WHP3-F1-model_v4 | DUF6285 domain-containing protein | 0.8901 | 1 | 68 |
|
| AF-A0A1M5M7Z4-F1-model_v4 | DUF6285 domain-containing protein | 0.8757 | 1 | 93 |
|
| AF-A0A098T391-F1-model_v4 | DUF6285 domain-containing protein | 0.8431 | 1 | 69 |
|
| AF-A0A7Y4ZH00-F1-model_v4 | DUF6285 domain-containing protein | 0.827 | 1 | 113 |
|
| AF-A0A098T391-F1-model_v4 | DUF6285 domain-containing protein | 0.8228 | 1 | 69 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar