F439209

General Info

Members Datasets Scaffolds Average Seq Length
418 258 836 101

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10066926|rootH1_100669263
Length 112
Sequence MKQLEVTIMGQSYILACPEGGEVALLEAVGSVDREMCAIRDAGKVKARERIAVLAALNLAYALAERPLERRSALAVHGHPASQTGAVAGGNVDLGALVRRIDAMLGDDGQLL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
66 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
165 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
173 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
213 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
214 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
224 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
225 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
226 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
227 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
228 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
231 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
232 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
233 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
234 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
238 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
239 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
240 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
252 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
257 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
258 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0.72
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.86
Nodule 0.48
Rhizoplane 4.07
Rhizosphere 70.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10066926 3300003316 Bacteria 3459
2 JGI25153J46596_10014868 3300003215 Bacteria 3209
3 JGI25153J46596_10027468 3300003215 Bacteria 1993
4 rootH1_10011454 3300003316 Bacteria 3178
5 rootH2_10000731 3300003320 Bacteria 2760
6 rootL2_10008667 3300003322 Bacteria 9480
7 rootL2_10017688 3300003322 Bacteria 6985
8 rootL2_10148462 3300003322 Bacteria 3242
9 rootH1_10090413 3300003323 Bacteria 2851
10 rootH1_10112917 3300003323 Bacteria 3106
11 Ga0055526_1021359 3300003771 Bacteria 2255
12 Ga0055524_1000080 3300003775 Bacteria 120203
13 Ga0055524_1008226 3300003775 Bacteria 4352
14 Ga0055524_1024287 3300003775 Bacteria 1927
15 Ga0055528_1043677 3300003790 Bacteria 973
16 Ga0055530_10000994 3300003791 Bacteria 22713
17 Ga0055530_10001152 3300003791 Bacteria 20524
18 Ga0055530_10066166 3300003791 Bacteria 791
19 Ga0055530_10067032 3300003791 Bacteria 784
20 Ga0055540_1000002 3300003792 Bacteria 436954
21 Ga0055540_1015148 3300003792 Bacteria 2260
22 Ga0055540_1049329 3300003792 Bacteria 874
23 Ga0055531_10000078 3300003794 Bacteria 105599
24 Ga0055531_10003492 3300003794 Bacteria 9998
25 Ga0055531_10011352 3300003794 Bacteria 4310
26 Ga0055531_10011505 3300003794 Bacteria 4257
27 Ga0055543_1004332 3300004625 Bacteria 3897
28 Ga0065165_1000613 3300005262 Bacteria 51836
29 Ga0065165_1000652 3300005262 Bacteria 50081
30 Ga0065165_1002649 3300005262 Bacteria 14491
31 Ga0070676_10004101 3300005328 Bacteria 7654
32 Ga0070677_10090156 3300005333 Bacteria 1332
33 Ga0068869_100005777 3300005334 Bacteria 7805
34 Ga0068868_100173393 3300005338 Bacteria 1786
35 Ga0070661_100305916 3300005344 Bacteria 1238
36 Ga0070668_100927340 3300005347 Bacteria 779
37 Ga0070668_101065175 3300005347 Bacteria 729
38 Ga0070669_100035231 3300005353 Bacteria 3625
39 Ga0070675_100046581 3300005354 Bacteria 3551
40 Ga0070675_100271012 3300005354 Bacteria 1490
41 Ga0070671_100029477 3300005355 Bacteria 4525
42 Ga0070671_100220075 3300005355 Bacteria 1611
43 Ga0070671_101033537 3300005355 Bacteria 721
44 Ga0070671_101301628 3300005355 Bacteria 641
45 Ga0070674_100262864 3300005356 Bacteria 1360
46 Ga0070674_100432878 3300005356 Bacteria 1082
47 Ga0070674_100481132 3300005356 Bacteria 1030
48 Ga0070673_100004218 3300005364 Bacteria 9071
49 Ga0070673_100073793 3300005364 Bacteria 2747
50 Ga0070673_100587033 3300005364 Bacteria 1015
51 Ga0070673_100591948 3300005364 Bacteria 1011
52 Ga0070673_100650995 3300005364 Bacteria 964
53 Ga0070659_100498758 3300005366 Bacteria 1037
54 Ga0070667_100239959 3300005367 Bacteria 1618
55 Ga0070703_10188696 3300005406 Bacteria 801
56 Ga0070700_100687823 3300005441 Bacteria 812
57 Ga0070708_100794020 3300005445 Bacteria 890
58 Ga0070678_100083933 3300005456 Bacteria 2423
59 Ga0070678_100097012 3300005456 Bacteria 2275
60 Ga0070678_100812518 3300005456 Bacteria 850
61 Ga0070662_100332899 3300005457 Bacteria 1241
62 Ga0070662_101313279 3300005457 Bacteria 623
63 Ga0070662_101732990 3300005457 Bacteria 539
64 Ga0068867_100000085 3300005459 Bacteria 58473
65 Ga0068867_100009225 3300005459 Bacteria 6965
66 Ga0068867_100073810 3300005459 Bacteria 2555
67 Ga0068867_100180375 3300005459 Bacteria 1678
68 Ga0068867_101999155 3300005459 Bacteria 548
69 Ga0070685_10732236 3300005466 Bacteria 723
70 Ga0070706_100090848 3300005467 Bacteria 2832
71 Ga0070672_100006214 3300005543 Bacteria 8001
72 Ga0070672_100333603 3300005543 Bacteria 1290
73 Ga0070672_100527507 3300005543 Bacteria 1023
74 Ga0068855_100013752 3300005563 Bacteria 9756
75 Ga0070664_100101389 3300005564 Bacteria 2503
76 Ga0068856_100072520 3300005614 Bacteria 3409
77 Ga0068852_100104339 3300005616 Bacteria 2566
78 Ga0068852_100315838 3300005616 Bacteria 1516
79 Ga0068852_102071271 3300005616 Bacteria 591
80 Ga0068852_102361084 3300005616 Bacteria 553
81 Ga0068852_102669334 3300005616 Bacteria 519
82 Ga0068864_102224749 3300005618 Bacteria 555
83 Ga0068861_100704577 3300005719 Bacteria 938
84 Ga0068861_101119604 3300005719 Bacteria 757
85 Ga0068870_10395373 3300005840 Bacteria 898
86 Ga0068863_100856442 3300005841 Bacteria 908
87 Ga0068863_101441426 3300005841 Bacteria 697
88 Ga0068860_100132138 3300005843 Bacteria 2396
89 Ga0068860_100301962 3300005843 Bacteria 1568
90 Ga0068862_100276483 3300005844 Bacteria 1538
91 Ga0068862_100340038 3300005844 Bacteria 1390
92 Ga0075362_10161547 3300006177 Bacteria 1079
93 Ga0075362_10786777 3300006177 Bacteria 500
94 Ga0075367_10146501 3300006178 Bacteria 1464
95 Ga0075366_10003083 3300006195 Bacteria 8701
96 Ga0075366_10013243 3300006195 Bacteria 4691
97 Ga0075366_10050506 3300006195 Bacteria 2469
98 Ga0075366_10064262 3300006195 Bacteria 2182
99 Ga0075366_10071825 3300006195 Bacteria 2062
100 Ga0075366_10114923 3300006195 Bacteria 1621
101 Ga0075366_10283581 3300006195 Bacteria 1012
102 Ga0075370_10003217 3300006353 Bacteria 7726
103 Ga0075370_10008554 3300006353 Bacteria 5274
104 Ga0075370_10013187 3300006353 Bacteria 4387
105 Ga0075370_10058982 3300006353 Bacteria 2183
106 Ga0075370_10082631 3300006353 Bacteria 1848
107 Ga0075370_11023346 3300006353 Bacteria 506
108 Ga0075428_101042577 3300006844 Bacteria 865
109 Ga0075429_100028754 3300006880 Bacteria 4828
110 Ga0068865_100101740 3300006881 Bacteria 2105
111 Ga0099823_1013693 3300006944 Bacteria 8145
112 Ga0105240_10136312 3300009093 Bacteria 2939
113 Ga0111539_10838042 3300009094 Bacteria 1070
114 Ga0105245_11609560 3300009098 Bacteria 701
115 Ga0114129_10184032 3300009147 Bacteria 2841
116 Ga0114129_12581050 3300009147 Bacteria 607
117 Ga0105243_10049417 3300009148 Bacteria 3318
118 Ga0105243_10063447 3300009148 Bacteria 2960
119 Ga0105243_10152760 3300009148 Bacteria 1982
120 Ga0105243_11852157 3300009148 Bacteria 635
121 Ga0105243_12455341 3300009148 Bacteria 560
122 Ga0105242_10157863 3300009176 Bacteria 1983
123 Ga0105248_10000445 3300009177 Bacteria 46980
124 Ga0105248_11520609 3300009177 Bacteria 758
125 Ga0105248_11962185 3300009177 Bacteria 665
126 Ga0105237_10005747 3300009545 Bacteria 13937
127 Ga0105237_11412169 3300009545 Bacteria 702
128 Ga0105238_10009909 3300009551 Bacteria 9554
129 Ga0105249_10169404 3300009553 Bacteria 2117
130 Ga0105249_11153119 3300009553 Bacteria 846
131 Ga0105239_10002919 3300010375 Bacteria 21354
132 Ga0157319_1000006 3300012497 Bacteria 361506
133 Ga0157327_1001183 3300012512 Bacteria 1587
134 Ga0157374_10010970 3300013296 Bacteria 7825
135 Ga0157374_11027902 3300013296 Bacteria 843
136 Ga0157378_10700889 3300013297 Bacteria 1032
137 Ga0163162_11021907 3300013306 Bacteria 935
138 Ga0163162_11473941 3300013306 Bacteria 775
139 Ga0157375_10290021 3300013308 Bacteria 1799
140 Ga0157375_10480783 3300013308 Bacteria 1407
141 Ga0157380_10362311 3300014326 Bacteria 1361
142 Ga0157380_11112491 3300014326 Bacteria 829
143 Ga0157380_11797210 3300014326 Bacteria 672
144 Ga0157380_11812943 3300014326 Bacteria 669
145 Ga0157377_10000028 3300014745 Bacteria 134810
146 Ga0157377_10465004 3300014745 Bacteria 876
147 Ga0157379_10089159 3300014968 Bacteria 2767
148 Ga0163161_10832877 3300017792 Bacteria 777
149 Ga0213872_10000013 3300021361 Bacteria 182866
150 Ga0213872_10000172 3300021361 Bacteria 58334
151 Ga0213872_10024566 3300021361 Bacteria 2773
152 Ga0213872_10028082 3300021361 Bacteria 2582
153 Ga0213872_10055851 3300021361 Bacteria 1789
154 Ga0209258_106644 3300025242 Bacteria 1790
155 Ga0207425_1000705 3300025245 Bacteria 18059
156 Ga0209129_1000468 3300025258 Bacteria 29705
157 Ga0209565_1015851 3300025263 Bacteria 1689
158 Ga0209673_1004857 3300025273 Bacteria 7022
159 Ga0209673_1005951 3300025273 Bacteria 6013
160 Ga0209673_1006240 3300025273 Bacteria 5813
161 Ga0209673_1019338 3300025273 Bacteria 2449
162 Ga0209675_1006999 3300025291 Bacteria 4406
163 Ga0209564_1000046 3300025295 Bacteria 373787
164 Ga0209758_1000369 3300025297 Bacteria 79541
165 Ga0209758_1000709 3300025297 Bacteria 49238
166 Ga0209050_1000651 3300025298 Bacteria 53742
167 Ga0209050_1002123 3300025298 Bacteria 18059
168 Ga0209050_1004287 3300025298 Bacteria 9759
169 Ga0209050_1026469 3300025298 Bacteria 1940
170 Ga0209256_1000011 3300025299 Bacteria 865309
171 Ga0209256_1001979 3300025299 Bacteria 18465
172 Ga0209256_1005905 3300025299 Bacteria 6770
173 Ga0209256_1054106 3300025299 Bacteria 957
174 Ga0209051_1000024 3300025303 Bacteria 437007
175 Ga0209051_1003875 3300025303 Bacteria 9554
176 Ga0209051_1004008 3300025303 Bacteria 9332
177 Ga0209257_1000032 3300025304 Bacteria 680354
178 Ga0209257_1000079 3300025304 Bacteria 316420
179 Ga0209257_1002360 3300025304 Bacteria 18953
180 Ga0209257_1009881 3300025304 Bacteria 4980
181 Ga0209257_1082360 3300025304 Bacteria 822
182 Ga0207697_10193352 3300025315 Bacteria 894
183 Ga0207682_10034241 3300025893 Bacteria 2047
184 Ga0207682_10075286 3300025893 Bacteria 1437
185 Ga0207688_10393560 3300025901 Bacteria 859
186 Ga0207645_10005973 3300025907 Bacteria 8767
187 Ga0207645_10114057 3300025907 Bacteria 1751
188 Ga0207684_10318409 3300025910 Bacteria 1341
189 Ga0207695_10185833 3300025913 Bacteria 1997
190 Ga0207671_10055499 3300025914 Bacteria 2935
191 Ga0207662_11010626 3300025918 Bacteria 590
192 Ga0207681_10319941 3300025923 Bacteria 1233
193 Ga0207694_10007219 3300025924 Bacteria 8436
194 Ga0207694_10804668 3300025924 Bacteria 794
195 Ga0207650_10970971 3300025925 Bacteria 722
196 Ga0207659_10201800 3300025926 Bacteria 1589
197 Ga0207644_10185432 3300025931 Bacteria 1633
198 Ga0207644_10568800 3300025931 Bacteria 939
199 Ga0207690_10374692 3300025932 Bacteria 1130
200 Ga0207706_10223800 3300025933 Bacteria 1647
201 Ga0207706_10269256 3300025933 Bacteria 1487
202 Ga0207706_10937922 3300025933 Bacteria 730
203 Ga0207709_10000556 3300025935 Bacteria 31885
204 Ga0207709_10105519 3300025935 Bacteria 1872
205 Ga0207709_10195243 3300025935 Bacteria 1441
206 Ga0207709_11253466 3300025935 Bacteria 612
207 Ga0207709_11285391 3300025935 Bacteria 604
208 Ga0207669_10355616 3300025937 Bacteria 1133
209 Ga0207669_10471705 3300025937 Bacteria 999
210 Ga0207704_10169183 3300025938 Bacteria 1565
211 Ga0207691_10005725 3300025940 Bacteria 12016
212 Ga0207691_10500639 3300025940 Bacteria 1032
213 Ga0207711_10049003 3300025941 Bacteria 3615
214 Ga0207711_11010862 3300025941 Bacteria 771
215 Ga0207689_10464373 3300025942 Bacteria 1059
216 Ga0207679_10561491 3300025945 Bacteria 1025
217 Ga0207667_10040717 3300025949 Bacteria 4947
218 Ga0207651_10109006 3300025960 Bacteria 2074
219 Ga0207651_10166808 3300025960 Bacteria 1732
220 Ga0207651_11437607 3300025960 Bacteria 621
221 Ga0207712_11004471 3300025961 Bacteria 740
222 Ga0207668_10248919 3300025972 Bacteria 1442
223 Ga0207668_10252972 3300025972 Bacteria 1432
224 Ga0207668_10732114 3300025972 Bacteria 871
225 Ga0207640_10429358 3300025981 Bacteria 1083
226 Ga0207658_10353511 3300025986 Bacteria 1280
227 Ga0207677_10082358 3300026023 Bacteria 2312
228 Ga0207703_11666386 3300026035 Bacteria 613
229 Ga0207678_10002031 3300026067 Bacteria 18369
230 Ga0207702_10426982 3300026078 Bacteria 1282
231 Ga0207641_10154087 3300026088 Bacteria 2084
232 Ga0207641_10664430 3300026088 Bacteria 1024
233 Ga0207648_10000146 3300026089 Bacteria 70573
234 Ga0207648_10015544 3300026089 Bacteria 6995
235 Ga0207648_10144654 3300026089 Bacteria 2097
236 Ga0207683_10035324 3300026121 Bacteria 4346
237 Ga0207683_10091285 3300026121 Bacteria 2713
238 Ga0207683_10154157 3300026121 Bacteria 2074
239 Ga0207698_10095438 3300026142 Bacteria 2448
240 Ga0209389_1024054 3300027296 Bacteria 5356
241 Ga0209371_1016014 3300027312 Bacteria 1992
242 Ga0209974_10000885 3300027876 Bacteria 10405
243 Ga0268266_12101764 3300028379 Bacteria 537
244 Ga0268265_10877943 3300028380 Bacteria 879
245 Ga0268264_10073781 3300028381 Bacteria 2897
246 Ga0307517_10146386 3300028786 Bacteria 1637
247 Ga0307515_10001342 3300028794 Bacteria 55698
248 Ga0307515_10031150 3300028794 Bacteria 8906
249 Ga0307515_10159208 3300028794 Bacteria 2313
250 Ga0268256_1017782 3300030500 Bacteria 1992
251 Ga0265331_10010417 3300031250 Bacteria 5146
252 Ga0265327_10000355 3300031251 Bacteria 87181
253 Ga0307513_10440068 3300031456 Bacteria 1030
254 Ga0307509_10150531 3300031507 Bacteria 2243
255 Ga0307408_100000150 3300031548 Bacteria 77682
256 Ga0307408_100098452 3300031548 Bacteria 2223
257 Ga0307408_100272590 3300031548 Bacteria 1406
258 Ga0307408_100714121 3300031548 Bacteria 902
259 Ga0307516_10001873 3300031730 Bacteria 28776
260 Ga0307516_10006937 3300031730 Bacteria 13146
261 Ga0307405_10133711 3300031731 Bacteria 1718
262 Ga0307405_10278919 3300031731 Bacteria 1257
263 Ga0307413_10770582 3300031824 Bacteria 806
264 Ga0307413_10929314 3300031824 Bacteria 741
265 Ga0307410_10294604 3300031852 Bacteria 1278
266 Ga0307406_10066799 3300031901 Bacteria 2342
267 Ga0307406_10586219 3300031901 Bacteria 917
268 Ga0307406_11301168 3300031901 Bacteria 634
269 Ga0307407_10263317 3300031903 Bacteria 1187
270 Ga0307412_10562184 3300031911 Bacteria 960
271 Ga0307412_12300887 3300031911 Bacteria 503
272 Ga0307416_100216085 3300032002 Bacteria 1834
273 Ga0307416_102349270 3300032002 Bacteria 633
274 Ga0307411_10262263 3300032005 Bacteria 1365
275 Ga0307510_10008844 3300033180 Bacteria 12005
276 Ga0373948_0006350 3300034817 Bacteria 1951
277 Ga0373950_0042288 3300034818 Bacteria 875
278 Ga0373959_0009210 3300034820 Bacteria 1697
279 Ga0373940_0010682 3300035088 Bacteria 2165
280 Ga0373951_0083851 3300035091 Bacteria 828
281 Ga0373939_0000620 3300035114 Bacteria 8811
282 Ga0373960_0004076 3300035121 Bacteria 3338
283 Ga0373961_0011098 3300035241 Bacteria 2232
284 Ga0373962_0018100 3300035242 Bacteria 1830
285 Ga0373931_0003162 3300035691 Bacteria 7352
286 Ga0373937_0573678 3300036401 Bacteria 1071
287 Ga0373925_1337198 3300037068 Bacteria 588
288 Ga0395898_1074093 3300037466 Bacteria 739
289 Ga0395905_0004339 3300037471 Bacteria 14769
290 Ga0395905_0021323 3300037471 Bacteria 6129
291 Ga0395905_0246335 3300037471 Bacteria 1670
292 Ga0395905_0525005 3300037471 Bacteria 1084
293 Ga0395905_1484245 3300037471 Bacteria 582
294 Ga0436361_0167979 3300039447 Bacteria 86419
295 Ga0436361_0217332 3300039447 Bacteria 23737
296 Ga0436361_0236342 3300039447 Bacteria 16847
297 Ga0436361_0359670 3300039447 Bacteria 47250
298 Ga0436361_0466394 3300039447 Bacteria 5236
299 Ga0436361_0557181 3300039447 Bacteria 1120
300 Ga0436361_0679893 3300039447 Bacteria 2794
301 Ga0451791_1054030 3300041451 Bacteria 1182
302 Ga0451797_1464181 3300041453 Bacteria 771
303 Ga0451798_0551381 3300041458 Bacteria 542
304 Ga0451800_0761763 3300041459 Bacteria 847
305 Ga0451807_1079964 3300041486 Bacteria 1509
306 Ga0451853_1011073 3300041512 Bacteria 523
307 Ga0439445_0061871 3300042004 Bacteria 1025
308 Ga0439454_053408 3300042011 Bacteria 687
309 Ga0439457_039274 3300042014 Bacteria 1054
310 Ga0439457_119844 3300042014 Bacteria 621
311 Ga0450919_004085 3300042121 Bacteria 1793
312 Ga0450890_001817 3300042127 Bacteria 3023
313 Ga0450898_020620 3300042134 Bacteria 1156
314 Ga0439459_0005580 3300042438 Bacteria 2072
315 Ga0450918_000812 3300042531 Bacteria 6551
316 Ga0451577_0001509 3300042876 Bacteria 30757
317 Ga0451577_0011935 3300042876 Bacteria 8189
318 Ga0466969_0000395 3300044656 Bacteria 23961
319 Ga0466969_0108604 3300044656 Bacteria 1300
320 Ga0466966_0005482 3300044684 Bacteria 8338
321 Ga0466966_0030684 3300044684 Bacteria 3487
322 Ga0466961_0033866 3300044693 Bacteria 3282
323 Ga0466963_0019955 3300044694 Bacteria 4211
324 Ga0466964_0003170 3300044706 Bacteria 5975
325 Ga0466964_0554344 3300044706 Bacteria 624
326 Ga0453684_0024040 3300044712 Bacteria 8932
327 Ga0466968_0343751 3300044735 Bacteria 724
328 Ga0466970_0038627 3300044765 Bacteria 2532
329 Ga0466970_0064331 3300044765 Bacteria 1967
330 Ga0466957_0016859 3300044842 Bacteria 4274
331 Ga0466959_0000371 3300045049 Bacteria 26505
332 Ga0466959_0012699 3300045049 Bacteria 6092
333 Ga0451576_0132428 3300045051 Bacteria 2599
334 Ga0451576_2601213 3300045051 Bacteria 516
335 Ga0466958_0012315 3300045836 Bacteria 4843
336 Ga0466967_0109726 3300045976 Bacteria 2533
337 Ga0495638_0391003 3300046460 Bacteria 724
338 Ga0495628_0580755 3300046516 Bacteria 802
339 Ga0495633_0432829 3300046558 Bacteria 594
340 Ga0495668_0050889 3300046616 Bacteria 2295
341 Ga0495613_0295679 3300046689 Bacteria 1122
342 Ga0495670_0120531 3300046691 Bacteria 1362
343 Ga0495676_0681752 3300047321 Bacteria 666
344 Ga0495686_0009497 3300047472 Bacteria 6996
345 Ga0496102_0042456 3300048905 Bacteria 4121
346 Ga0496104_0185935 3300048907 Bacteria 1988
347 Ga0496104_1442312 3300048907 Bacteria 591
348 Ga0496105_0127197 3300048908 Bacteria 2101
349 Ga0496109_0196518 3300048912 Bacteria 1896
350 Ga0496110_0009795 3300048913 Bacteria 7760
351 Ga0496110_0194236 3300048913 Bacteria 1843
352 Ga0496110_0705943 3300048913 Bacteria 910
353 Ga0496111_0049707 3300048914 Bacteria 3024
354 Ga0496113_0047342 3300048916 Bacteria 3195
355 Ga0496113_0303017 3300048916 Bacteria 1280
356 Ga0496114_0014691 3300048917 Bacteria 6292
357 Ga0496118_0389006 3300048921 Bacteria 729
358 Ga0496124_0202897 3300048927 Bacteria 1506
359 Ga0496125_0254946 3300048928 Bacteria 1104
360 Ga0501291_030134 3300049514 Bacteria 911
361 Ga0501292_002690 3300049515 Bacteria 2314
362 Ga0501294_015964 3300049517 Bacteria 779
363 Ga0501300_001631 3300049523 Bacteria 3360
364 Ga0501313_021940 3300049529 Bacteria 794
365 Ga0501318_030653 3300049534 Bacteria 730
366 Ga0501320_061231 3300049536 Bacteria 530
367 Ga0501032_0439545 3300049569 Bacteria 836
368 Ga0501042_0579697 3300049578 Bacteria 816
369 Ga0501043_0000023 3300049579 Bacteria 154331
370 Ga0501046_0000018 3300049580 Bacteria 220589
371 Ga0501047_0000020 3300049581 Bacteria 259377
372 Ga0501048_0001150 3300049582 Bacteria 19873
373 Ga0501206_002273 3300049653 Bacteria 2420
374 Ga0501207_003589 3300049654 Bacteria 2074
375 Ga0501217_080117 3300049661 Bacteria 903
376 Ga0501222_000386 3300049662 Bacteria 6737
377 Ga0501223_023959 3300049663 Bacteria 1189
378 Ga0501227_045197 3300049665 Bacteria 1099
379 Ga0501233_009170 3300049668 Bacteria 1925
380 Ga0501253_012476 3300049683 Bacteria 1332
381 Ga0501258_007508 3300049687 Bacteria 1103
382 Ga0501260_053189 3300049689 Bacteria 514
383 Ga0501261_111298 3300049690 Bacteria 532
384 Ga0501221_000437 3300049704 Bacteria 6467
385 Ga0501225_0021950 3300049705 Bacteria 1762
386 Ga0501083_0197878 3300049744 Bacteria 1311
387 Ga0501262_038322 3300049759 Bacteria 709
388 Ga0501265_001773 3300049762 Bacteria 2447
389 Ga0501269_004813 3300049766 Bacteria 1624
390 Ga0501281_13151 3300049777 Bacteria 598
391 Ga0501044_0449210 3300049823 Bacteria 1196
392 Ga0501045_0003480 3300049824 Bacteria 10771
393 nmdc:mga03683_145612_c1 3300050489 Bacteria 1067
394 nmdc:mga0k408_203_c2 3300050493 Bacteria 31214
395 nmdc:mga0k408_26403_c1 3300050493 Bacteria 3292
396 nmdc:mga0k408_34825_c1 3300050493 Bacteria 2884
397 nmdc:mga0k408_357311_c1 3300050493 Bacteria 871
398 nmdc:mga0k408_5310_c2 3300050493 Bacteria 3455
399 nmdc:mga0k408_60465_c1 3300050493 Bacteria 2202
400 nmdc:mga0k408_99363_c1 3300050493 Bacteria 1715
401 nmdc:mga07m45_110064_c1 3300050496 Bacteria 1586
402 nmdc:mga07m45_1438_c1 3300050496 Bacteria 10919
403 nmdc:mga07m45_222_c1 3300050496 Bacteria 22600
404 nmdc:mga07m45_43670_c1 3300050496 Bacteria 2513
405 nmdc:mga05p37_159387_c1 3300050507 Bacteria 2181
406 nmdc:mga05p37_1689576_c1 3300050507 Bacteria 618
407 nmdc:mga09592_4171_c1 3300050508 Bacteria 11674
408 nmdc:mga0qj67_25344_c2 3300050509 Bacteria 1945
409 Ga0495595_0209612 3300053084 Bacteria 971
410 Ga0500651_0166003 3300053093 Bacteria 1318
411 Ga0500593_000236 3300053117 Bacteria 22651
412 Ga0500597_205661 3300053120 Bacteria 825
413 Ga0500604_0204404 3300053151 Bacteria 679
414 Ga0500622_0001554 3300053156 Bacteria 18138
415 Ga0590071_007388 3300059421 Bacteria 2597
416 2587730449 2585428057 Bacteria 6737412
417 2644249123 2643221644 Bacteria 6865017
418 2886852128 2886848708 Bacteria 5632523
419 rootH1_10066926
420 JGI25153J46596_10014868
421 JGI25153J46596_10027468
422 rootH1_10011454
423 rootH2_10000731
424 rootL2_10008667
425 rootL2_10017688
426 rootL2_10148462
427 rootH1_10090413
428 rootH1_10112917
429 Ga0055526_1021359
430 Ga0055524_1000080
431 Ga0055524_1008226
432 Ga0055524_1024287
433 Ga0055528_1043677
434 Ga0055530_10000994
435 Ga0055530_10001152
436 Ga0055530_10066166
437 Ga0055530_10067032
438 Ga0055540_1000002
439 Ga0055540_1015148
440 Ga0055540_1049329
441 Ga0055531_10000078
442 Ga0055531_10003492
443 Ga0055531_10011352
444 Ga0055531_10011505
445 Ga0055543_1004332
446 Ga0065165_1000613
447 Ga0065165_1000652
448 Ga0065165_1002649
449 Ga0070676_10004101
450 Ga0070677_10090156
451 Ga0068869_100005777
452 Ga0068868_100173393
453 Ga0070661_100305916
454 Ga0070668_100927340
455 Ga0070668_101065175
456 Ga0070669_100035231
457 Ga0070675_100046581
458 Ga0070675_100271012
459 Ga0070671_100029477
460 Ga0070671_100220075
461 Ga0070671_101033537
462 Ga0070671_101301628
463 Ga0070674_100262864
464 Ga0070674_100432878
465 Ga0070674_100481132
466 Ga0070673_100004218
467 Ga0070673_100073793
468 Ga0070673_100587033
469 Ga0070673_100591948
470 Ga0070673_100650995
471 Ga0070659_100498758
472 Ga0070667_100239959
473 Ga0070703_10188696
474 Ga0070700_100687823
475 Ga0070708_100794020
476 Ga0070678_100083933
477 Ga0070678_100097012
478 Ga0070678_100812518
479 Ga0070662_100332899
480 Ga0070662_101313279
481 Ga0070662_101732990
482 Ga0068867_100000085
483 Ga0068867_100009225
484 Ga0068867_100073810
485 Ga0068867_100180375
486 Ga0068867_101999155
487 Ga0070685_10732236
488 Ga0070706_100090848
489 Ga0070672_100006214
490 Ga0070672_100333603
491 Ga0070672_100527507
492 Ga0068855_100013752
493 Ga0070664_100101389
494 Ga0068856_100072520
495 Ga0068852_100104339
496 Ga0068852_100315838
497 Ga0068852_102071271
498 Ga0068852_102361084
499 Ga0068852_102669334
500 Ga0068864_102224749
501 Ga0068861_100704577
502 Ga0068861_101119604
503 Ga0068870_10395373
504 Ga0068863_100856442
505 Ga0068863_101441426
506 Ga0068860_100132138
507 Ga0068860_100301962
508 Ga0068862_100276483
509 Ga0068862_100340038
510 Ga0075362_10161547
511 Ga0075362_10786777
512 Ga0075367_10146501
513 Ga0075366_10003083
514 Ga0075366_10013243
515 Ga0075366_10050506
516 Ga0075366_10064262
517 Ga0075366_10071825
518 Ga0075366_10114923
519 Ga0075366_10283581
520 Ga0075370_10003217
521 Ga0075370_10008554
522 Ga0075370_10013187
523 Ga0075370_10058982
524 Ga0075370_10082631
525 Ga0075370_11023346
526 Ga0075428_101042577
527 Ga0075429_100028754
528 Ga0068865_100101740
529 Ga0099823_1013693
530 Ga0105240_10136312
531 Ga0111539_10838042
532 Ga0105245_11609560
533 Ga0114129_10184032
534 Ga0114129_12581050
535 Ga0105243_10049417
536 Ga0105243_10063447
537 Ga0105243_10152760
538 Ga0105243_11852157
539 Ga0105243_12455341
540 Ga0105242_10157863
541 Ga0105248_10000445
542 Ga0105248_11520609
543 Ga0105248_11962185
544 Ga0105237_10005747
545 Ga0105237_11412169
546 Ga0105238_10009909
547 Ga0105249_10169404
548 Ga0105249_11153119
549 Ga0105239_10002919
550 Ga0157319_1000006
551 Ga0157327_1001183
552 Ga0157374_10010970
553 Ga0157374_11027902
554 Ga0157378_10700889
555 Ga0163162_11021907
556 Ga0163162_11473941
557 Ga0157375_10290021
558 Ga0157375_10480783
559 Ga0157380_10362311
560 Ga0157380_11112491
561 Ga0157380_11797210
562 Ga0157380_11812943
563 Ga0157377_10000028
564 Ga0157377_10465004
565 Ga0157379_10089159
566 Ga0163161_10832877
567 Ga0213872_10000013
568 Ga0213872_10000172
569 Ga0213872_10024566
570 Ga0213872_10028082
571 Ga0213872_10055851
572 Ga0209258_106644
573 Ga0207425_1000705
574 Ga0209129_1000468
575 Ga0209565_1015851
576 Ga0209673_1004857
577 Ga0209673_1005951
578 Ga0209673_1006240
579 Ga0209673_1019338
580 Ga0209675_1006999
581 Ga0209564_1000046
582 Ga0209758_1000369
583 Ga0209758_1000709
584 Ga0209050_1000651
585 Ga0209050_1002123
586 Ga0209050_1004287
587 Ga0209050_1026469
588 Ga0209256_1000011
589 Ga0209256_1001979
590 Ga0209256_1005905
591 Ga0209256_1054106
592 Ga0209051_1000024
593 Ga0209051_1003875
594 Ga0209051_1004008
595 Ga0209257_1000032
596 Ga0209257_1000079
597 Ga0209257_1002360
598 Ga0209257_1009881
599 Ga0209257_1082360
600 Ga0207697_10193352
601 Ga0207682_10034241
602 Ga0207682_10075286
603 Ga0207688_10393560
604 Ga0207645_10005973
605 Ga0207645_10114057
606 Ga0207684_10318409
607 Ga0207695_10185833
608 Ga0207671_10055499
609 Ga0207662_11010626
610 Ga0207681_10319941
611 Ga0207694_10007219
612 Ga0207694_10804668
613 Ga0207650_10970971
614 Ga0207659_10201800
615 Ga0207644_10185432
616 Ga0207644_10568800
617 Ga0207690_10374692
618 Ga0207706_10223800
619 Ga0207706_10269256
620 Ga0207706_10937922
621 Ga0207709_10000556
622 Ga0207709_10105519
623 Ga0207709_10195243
624 Ga0207709_11253466
625 Ga0207709_11285391
626 Ga0207669_10355616
627 Ga0207669_10471705
628 Ga0207704_10169183
629 Ga0207691_10005725
630 Ga0207691_10500639
631 Ga0207711_10049003
632 Ga0207711_11010862
633 Ga0207689_10464373
634 Ga0207679_10561491
635 Ga0207667_10040717
636 Ga0207651_10109006
637 Ga0207651_10166808
638 Ga0207651_11437607
639 Ga0207712_11004471
640 Ga0207668_10248919
641 Ga0207668_10252972
642 Ga0207668_10732114
643 Ga0207640_10429358
644 Ga0207658_10353511
645 Ga0207677_10082358
646 Ga0207703_11666386
647 Ga0207678_10002031
648 Ga0207702_10426982
649 Ga0207641_10154087
650 Ga0207641_10664430
651 Ga0207648_10000146
652 Ga0207648_10015544
653 Ga0207648_10144654
654 Ga0207683_10035324
655 Ga0207683_10091285
656 Ga0207683_10154157
657 Ga0207698_10095438
658 Ga0209389_1024054
659 Ga0209371_1016014
660 Ga0209974_10000885
661 Ga0268266_12101764
662 Ga0268265_10877943
663 Ga0268264_10073781
664 Ga0307517_10146386
665 Ga0307515_10001342
666 Ga0307515_10031150
667 Ga0307515_10159208
668 Ga0268256_1017782
669 Ga0265331_10010417
670 Ga0265327_10000355
671 Ga0307513_10440068
672 Ga0307509_10150531
673 Ga0307408_100000150
674 Ga0307408_100098452
675 Ga0307408_100272590
676 Ga0307408_100714121
677 Ga0307516_10001873
678 Ga0307516_10006937
679 Ga0307405_10133711
680 Ga0307405_10278919
681 Ga0307413_10770582
682 Ga0307413_10929314
683 Ga0307410_10294604
684 Ga0307406_10066799
685 Ga0307406_10586219
686 Ga0307406_11301168
687 Ga0307407_10263317
688 Ga0307412_10562184
689 Ga0307412_12300887
690 Ga0307416_100216085
691 Ga0307416_102349270
692 Ga0307411_10262263
693 Ga0307510_10008844
694 Ga0373948_0006350
695 Ga0373950_0042288
696 Ga0373959_0009210
697 Ga0373940_0010682
698 Ga0373951_0083851
699 Ga0373939_0000620
700 Ga0373960_0004076
701 Ga0373961_0011098
702 Ga0373962_0018100
703 Ga0373931_0003162
704 Ga0373937_0573678
705 Ga0373925_1337198
706 Ga0395898_1074093
707 Ga0395905_0004339
708 Ga0395905_0021323
709 Ga0395905_0246335
710 Ga0395905_0525005
711 Ga0395905_1484245
712 Ga0436361_0167979
713 Ga0436361_0217332
714 Ga0436361_0236342
715 Ga0436361_0359670
716 Ga0436361_0466394
717 Ga0436361_0557181
718 Ga0436361_0679893
719 Ga0451791_1054030
720 Ga0451797_1464181
721 Ga0451798_0551381
722 Ga0451800_0761763
723 Ga0451807_1079964
724 Ga0451853_1011073
725 Ga0439445_0061871
726 Ga0439454_053408
727 Ga0439457_039274
728 Ga0439457_119844
729 Ga0450919_004085
730 Ga0450890_001817
731 Ga0450898_020620
732 Ga0439459_0005580
733 Ga0450918_000812
734 Ga0451577_0001509
735 Ga0451577_0011935
736 Ga0466969_0000395
737 Ga0466969_0108604
738 Ga0466966_0005482
739 Ga0466966_0030684
740 Ga0466961_0033866
741 Ga0466963_0019955
742 Ga0466964_0003170
743 Ga0466964_0554344
744 Ga0453684_0024040
745 Ga0466968_0343751
746 Ga0466970_0038627
747 Ga0466970_0064331
748 Ga0466957_0016859
749 Ga0466959_0000371
750 Ga0466959_0012699
751 Ga0451576_0132428
752 Ga0451576_2601213
753 Ga0466958_0012315
754 Ga0466967_0109726
755 Ga0495638_0391003
756 Ga0495628_0580755
757 Ga0495633_0432829
758 Ga0495668_0050889
759 Ga0495613_0295679
760 Ga0495670_0120531
761 Ga0495676_0681752
762 Ga0495686_0009497
763 Ga0496102_0042456
764 Ga0496104_0185935
765 Ga0496104_1442312
766 Ga0496105_0127197
767 Ga0496109_0196518
768 Ga0496110_0009795
769 Ga0496110_0194236
770 Ga0496110_0705943
771 Ga0496111_0049707
772 Ga0496113_0047342
773 Ga0496113_0303017
774 Ga0496114_0014691
775 Ga0496118_0389006
776 Ga0496124_0202897
777 Ga0496125_0254946
778 Ga0501291_030134
779 Ga0501292_002690
780 Ga0501294_015964
781 Ga0501300_001631
782 Ga0501313_021940
783 Ga0501318_030653
784 Ga0501320_061231
785 Ga0501032_0439545
786 Ga0501042_0579697
787 Ga0501043_0000023
788 Ga0501046_0000018
789 Ga0501047_0000020
790 Ga0501048_0001150
791 Ga0501206_002273
792 Ga0501207_003589
793 Ga0501217_080117
794 Ga0501222_000386
795 Ga0501223_023959
796 Ga0501227_045197
797 Ga0501233_009170
798 Ga0501253_012476
799 Ga0501258_007508
800 Ga0501260_053189
801 Ga0501261_111298
802 Ga0501221_000437
803 Ga0501225_0021950
804 Ga0501083_0197878
805 Ga0501262_038322
806 Ga0501265_001773
807 Ga0501269_004813
808 Ga0501281_13151
809 Ga0501044_0449210
810 Ga0501045_0003480
811 nmdc:mga03683_145612_c1
812 nmdc:mga0k408_203_c2
813 nmdc:mga0k408_26403_c1
814 nmdc:mga0k408_34825_c1
815 nmdc:mga0k408_357311_c1
816 nmdc:mga0k408_5310_c2
817 nmdc:mga0k408_60465_c1
818 nmdc:mga0k408_99363_c1
819 nmdc:mga07m45_110064_c1
820 nmdc:mga07m45_1438_c1
821 nmdc:mga07m45_222_c1
822 nmdc:mga07m45_43670_c1
823 nmdc:mga05p37_159387_c1
824 nmdc:mga05p37_1689576_c1
825 nmdc:mga09592_4171_c1
826 nmdc:mga0qj67_25344_c2
827 Ga0495595_0209612
828 Ga0500651_0166003
829 Ga0500593_000236
830 Ga0500597_205661
831 Ga0500604_0204404
832 Ga0500622_0001554
833 Ga0590071_007388
834 2587730449
835 2644249123
836 2886852128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05164

ZapA

Cell division protein ZapA

4

104

0.92

Map