F439113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 417 | 222 | 832 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300041408|Ga0439453_0006112|Ga0439453_0006112_887_1567 |
| Length | 226 |
| Sequence | MAPLGELPETVYVVDDHPSIRAALKRLLGSVGLACETFGSASEFIDRLDEGGVTGCLLLDVRMPGVGGLELQEKLAAAGQDLPVIFLTAYADVPLTVRVMKAGAQEVLTKPFEEQALLDAVYRALDRERVLRREREELXXDREHFETLTGREREVMQLVVTGMLNKQVADALGTAEKTIKAHRGHVMQKMRASSLVELLRMADRLRECDQRAETPSRGLTTAGRQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 128 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 129 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 130 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 138 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 139 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 140 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 147 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 148 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 149 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 150 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 151 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 152 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 153 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 154 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 155 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 156 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 159 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 160 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 161 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 162 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 163 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 164 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 165 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 166 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 167 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 170 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 171 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 184 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 215 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 216 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 217 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 218 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 219 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 220 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 221 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 222 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.24 |
| Metatranscriptomes | 3.84 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0.24 |
| Rhizoplane | 1.92 |
| Rhizosphere | 89.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439453_0006112 | 3300041408 | Bacteria | 1862 |
| 2 | Ga0065715_10150479 | 3300005293 | Bacteria | 1735 |
| 3 | Ga0065707_10221749 | 3300005295 | Bacteria | 1222 |
| 4 | Ga0070658_10625989 | 3300005327 | Bacteria | 933 |
| 5 | Ga0070676_10004525 | 3300005328 | Bacteria | 7321 |
| 6 | Ga0070676_10050507 | 3300005328 | Bacteria | 2438 |
| 7 | Ga0070676_10362411 | 3300005328 | Bacteria | 999 |
| 8 | Ga0070690_100094807 | 3300005330 | Bacteria | 1970 |
| 9 | Ga0070670_100100212 | 3300005331 | Bacteria | 2493 |
| 10 | Ga0070677_10215017 | 3300005333 | Bacteria | 935 |
| 11 | Ga0070666_10036283 | 3300005335 | Bacteria | 3271 |
| 12 | Ga0070680_100167193 | 3300005336 | Bacteria | 1850 |
| 13 | Ga0070689_100062907 | 3300005340 | Bacteria | 2888 |
| 14 | Ga0070689_100108305 | 3300005340 | Bacteria | 2207 |
| 15 | Ga0070691_10303215 | 3300005341 | Bacteria | 873 |
| 16 | Ga0070687_100006214 | 3300005343 | Bacteria | 4885 |
| 17 | Ga0070687_100075103 | 3300005343 | Bacteria | 1827 |
| 18 | Ga0070692_10071805 | 3300005345 | Bacteria | 1846 |
| 19 | Ga0070668_100065907 | 3300005347 | Bacteria | 2809 |
| 20 | Ga0070668_100112534 | 3300005347 | Bacteria | 2168 |
| 21 | Ga0070668_100145281 | 3300005347 | Bacteria | 1914 |
| 22 | Ga0070669_100000751 | 3300005353 | Bacteria | 23601 |
| 23 | Ga0070669_101096292 | 3300005353 | Bacteria | 685 |
| 24 | Ga0070675_100983541 | 3300005354 | Bacteria | 774 |
| 25 | Ga0070671_100002002 | 3300005355 | Bacteria | 15650 |
| 26 | Ga0070671_100126886 | 3300005355 | Bacteria | 2148 |
| 27 | Ga0070674_100006994 | 3300005356 | Bacteria | 6624 |
| 28 | Ga0070674_100054832 | 3300005356 | Bacteria | 2758 |
| 29 | Ga0070673_100081563 | 3300005364 | Bacteria | 2623 |
| 30 | Ga0070688_100009910 | 3300005365 | Bacteria | 5236 |
| 31 | Ga0070688_100297472 | 3300005365 | Bacteria | 1165 |
| 32 | Ga0070688_100710568 | 3300005365 | Bacteria | 779 |
| 33 | Ga0070667_100002128 | 3300005367 | Bacteria | 17464 |
| 34 | Ga0070667_100052618 | 3300005367 | Bacteria | 3436 |
| 35 | Ga0070667_100061664 | 3300005367 | Bacteria | 3175 |
| 36 | Ga0070701_10011449 | 3300005438 | Bacteria | 3967 |
| 37 | Ga0070700_100034791 | 3300005441 | Bacteria | 3044 |
| 38 | Ga0070700_100092660 | 3300005441 | Bacteria | 1975 |
| 39 | Ga0070662_100061694 | 3300005457 | Bacteria | 2738 |
| 40 | Ga0070662_100137766 | 3300005457 | Bacteria | 1889 |
| 41 | Ga0070662_100140261 | 3300005457 | Bacteria | 1872 |
| 42 | Ga0070681_10023641 | 3300005458 | Bacteria | 6183 |
| 43 | Ga0068867_100283544 | 3300005459 | Bacteria | 1359 |
| 44 | Ga0070685_10016916 | 3300005466 | Bacteria | 3892 |
| 45 | Ga0070679_100125576 | 3300005530 | Bacteria | 2548 |
| 46 | Ga0070679_100127048 | 3300005530 | Bacteria | 2532 |
| 47 | Ga0070672_100129177 | 3300005543 | Bacteria | 2075 |
| 48 | Ga0070686_100072472 | 3300005544 | Bacteria | 2259 |
| 49 | Ga0070686_100223977 | 3300005544 | Bacteria | 1361 |
| 50 | Ga0070665_101004012 | 3300005548 | Bacteria | 847 |
| 51 | Ga0070704_100071831 | 3300005549 | Unclassified | 2516 |
| 52 | Ga0070704_100461230 | 3300005549 | Bacteria | 1096 |
| 53 | Ga0068855_100048550 | 3300005563 | Bacteria | 5009 |
| 54 | Ga0068856_101472198 | 3300005614 | Bacteria | 695 |
| 55 | Ga0068859_100001335 | 3300005617 | Bacteria | 25191 |
| 56 | Ga0068859_100069468 | 3300005617 | Bacteria | 3557 |
| 57 | Ga0068864_100165245 | 3300005618 | Bacteria | 2014 |
| 58 | Ga0068864_100376886 | 3300005618 | Bacteria | 1344 |
| 59 | Ga0068866_10012818 | 3300005718 | Bacteria | 3661 |
| 60 | Ga0068866_10015698 | 3300005718 | Bacteria | 3370 |
| 61 | Ga0068861_100104522 | 3300005719 | Bacteria | 2259 |
| 62 | Ga0068870_10144846 | 3300005840 | Bacteria | 1393 |
| 63 | Ga0068863_100008177 | 3300005841 | Bacteria | 10218 |
| 64 | Ga0068858_100001317 | 3300005842 | Bacteria | 25645 |
| 65 | Ga0068858_100388027 | 3300005842 | Bacteria | 1340 |
| 66 | Ga0068860_100018325 | 3300005843 | Bacteria | 6812 |
| 67 | Ga0068860_100076973 | 3300005843 | Bacteria | 3172 |
| 68 | Ga0068860_100097170 | 3300005843 | Bacteria | 2808 |
| 69 | Ga0068860_100350423 | 3300005843 | Bacteria | 1453 |
| 70 | Ga0068860_100929329 | 3300005843 | Bacteria | 886 |
| 71 | Ga0068862_100108525 | 3300005844 | Bacteria | 2434 |
| 72 | Ga0068862_100132228 | 3300005844 | Bacteria | 2208 |
| 73 | Ga0097621_100398068 | 3300006237 | Bacteria | 1232 |
| 74 | Ga0068871_100010118 | 3300006358 | Bacteria | 6864 |
| 75 | Ga0068865_100571528 | 3300006881 | Bacteria | 952 |
| 76 | Ga0097620_100001335 | 3300006931 | Bacteria | 25191 |
| 77 | Ga0097620_100069469 | 3300006931 | Bacteria | 3557 |
| 78 | Ga0105251_10008971 | 3300009011 | Bacteria | 5970 |
| 79 | Ga0105244_10001499 | 3300009036 | Bacteria | 18722 |
| 80 | Ga0105244_10008832 | 3300009036 | Bacteria | 6256 |
| 81 | Ga0105244_10043099 | 3300009036 | Bacteria | 2330 |
| 82 | Ga0105240_10026597 | 3300009093 | Bacteria | 7593 |
| 83 | Ga0105240_10045776 | 3300009093 | Bacteria | 5548 |
| 84 | Ga0111539_10303953 | 3300009094 | Bacteria | 1856 |
| 85 | Ga0111539_10478688 | 3300009094 | Bacteria | 1450 |
| 86 | Ga0105245_10281287 | 3300009098 | Bacteria | 1626 |
| 87 | Ga0105247_10000351 | 3300009101 | Bacteria | 39984 |
| 88 | Ga0105247_10023832 | 3300009101 | Bacteria | 3688 |
| 89 | Ga0105243_10035294 | 3300009148 | Bacteria | 3876 |
| 90 | Ga0105242_10006790 | 3300009176 | Bacteria | 8825 |
| 91 | Ga0105242_10038027 | 3300009176 | Bacteria | 3867 |
| 92 | Ga0105248_10030814 | 3300009177 | Bacteria | 5992 |
| 93 | Ga0105248_10280380 | 3300009177 | Bacteria | 1876 |
| 94 | Ga0105238_10085397 | 3300009551 | Bacteria | 3144 |
| 95 | Ga0105238_10110131 | 3300009551 | Bacteria | 2735 |
| 96 | Ga0105249_10130636 | 3300009553 | Bacteria | 2397 |
| 97 | Ga0105239_10023796 | 3300010375 | Bacteria | 6745 |
| 98 | Ga0105246_10245577 | 3300011119 | Unclassified | 1418 |
| 99 | Ga0157373_10297477 | 3300013100 | Bacteria | 1145 |
| 100 | Ga0157371_10005283 | 3300013102 | Bacteria | 10942 |
| 101 | Ga0157370_10307131 | 3300013104 | Bacteria | 1464 |
| 102 | Ga0157369_10958519 | 3300013105 | Bacteria | 877 |
| 103 | Ga0157374_10318554 | 3300013296 | Bacteria | 1541 |
| 104 | Ga0157378_10099556 | 3300013297 | Bacteria | 2652 |
| 105 | Ga0157372_10068718 | 3300013307 | Bacteria | 3983 |
| 106 | Ga0157375_10119946 | 3300013308 | Bacteria | 2738 |
| 107 | Ga0157375_10593424 | 3300013308 | Bacteria | 1267 |
| 108 | Ga0163163_10004130 | 3300014325 | Bacteria | 12365 |
| 109 | Ga0163163_10072441 | 3300014325 | Bacteria | 3434 |
| 110 | Ga0157380_10018037 | 3300014326 | Bacteria | 5234 |
| 111 | Ga0157380_10068447 | 3300014326 | Bacteria | 2861 |
| 112 | Ga0157380_10457775 | 3300014326 | Bacteria | 1227 |
| 113 | Ga0157380_10615659 | 3300014326 | Bacteria | 1077 |
| 114 | Ga0157379_10001800 | 3300014968 | Bacteria | 17670 |
| 115 | Ga0157379_10008835 | 3300014968 | Bacteria | 8787 |
| 116 | Ga0157379_10055820 | 3300014968 | Bacteria | 3529 |
| 117 | Ga0157379_10301267 | 3300014968 | Bacteria | 1461 |
| 118 | Ga0163161_10043416 | 3300017792 | Bacteria | 3237 |
| 119 | Ga0163161_10069714 | 3300017792 | Bacteria | 2570 |
| 120 | Ga0207697_10005605 | 3300025315 | Bacteria | 5811 |
| 121 | Ga0207696_1001572 | 3300025711 | Bacteria | 12124 |
| 122 | Ga0207655_1049397 | 3300025728 | Bacteria | 1718 |
| 123 | Ga0207682_10006948 | 3300025893 | Bacteria | 4538 |
| 124 | Ga0207682_10009896 | 3300025893 | Bacteria | 3747 |
| 125 | Ga0207642_10073060 | 3300025899 | Bacteria | 1639 |
| 126 | Ga0207710_10000315 | 3300025900 | Bacteria | 37309 |
| 127 | Ga0207688_10005891 | 3300025901 | Bacteria | 6672 |
| 128 | Ga0207680_10030578 | 3300025903 | Bacteria | 3039 |
| 129 | Ga0207645_10037900 | 3300025907 | Bacteria | 3094 |
| 130 | Ga0207645_10134356 | 3300025907 | Bacteria | 1611 |
| 131 | Ga0207645_10429173 | 3300025907 | Bacteria | 891 |
| 132 | Ga0207643_10008054 | 3300025908 | Bacteria | 5652 |
| 133 | Ga0207643_10059198 | 3300025908 | Bacteria | 2185 |
| 134 | Ga0207643_10146560 | 3300025908 | Bacteria | 1413 |
| 135 | Ga0207695_10146402 | 3300025913 | Bacteria | 2306 |
| 136 | Ga0207695_10173196 | 3300025913 | Bacteria | 2082 |
| 137 | Ga0207660_10048025 | 3300025917 | Bacteria | 3020 |
| 138 | Ga0207662_10007570 | 3300025918 | Bacteria | 5914 |
| 139 | Ga0207662_10008114 | 3300025918 | Bacteria | 5738 |
| 140 | Ga0207649_10070312 | 3300025920 | Bacteria | 2232 |
| 141 | Ga0207652_10320001 | 3300025921 | Bacteria | 1400 |
| 142 | Ga0207681_10094294 | 3300025923 | Bacteria | 2144 |
| 143 | Ga0207694_10195097 | 3300025924 | Bacteria | 1646 |
| 144 | Ga0207650_10427810 | 3300025925 | Bacteria | 1099 |
| 145 | Ga0207659_10109095 | 3300025926 | Bacteria | 2100 |
| 146 | Ga0207659_10204364 | 3300025926 | Bacteria | 1579 |
| 147 | Ga0207659_10367537 | 3300025926 | Bacteria | 1197 |
| 148 | Ga0207659_10382030 | 3300025926 | Bacteria | 1175 |
| 149 | Ga0207644_10000993 | 3300025931 | Bacteria | 18104 |
| 150 | Ga0207644_10011107 | 3300025931 | Bacteria | 5948 |
| 151 | Ga0207706_10031573 | 3300025933 | Bacteria | 4719 |
| 152 | Ga0207706_10068833 | 3300025933 | Bacteria | 3114 |
| 153 | Ga0207706_10131942 | 3300025933 | Bacteria | 2197 |
| 154 | Ga0207686_10015146 | 3300025934 | Bacteria | 4306 |
| 155 | Ga0207709_10070599 | 3300025935 | Bacteria | 2215 |
| 156 | Ga0207670_10096845 | 3300025936 | Unclassified | 2099 |
| 157 | Ga0207669_10008184 | 3300025937 | Bacteria | 4896 |
| 158 | Ga0207669_10447780 | 3300025937 | Bacteria | 1022 |
| 159 | Ga0207691_10072994 | 3300025940 | Bacteria | 3095 |
| 160 | Ga0207711_10023066 | 3300025941 | Bacteria | 5211 |
| 161 | Ga0207689_10003437 | 3300025942 | Bacteria | 14460 |
| 162 | Ga0207689_10048514 | 3300025942 | Bacteria | 3502 |
| 163 | Ga0207667_10152072 | 3300025949 | Bacteria | 2382 |
| 164 | Ga0207651_10100389 | 3300025960 | Bacteria | 2145 |
| 165 | Ga0207712_10243824 | 3300025961 | Bacteria | 1449 |
| 166 | Ga0207668_10041561 | 3300025972 | Bacteria | 3109 |
| 167 | Ga0207668_10096448 | 3300025972 | Bacteria | 2186 |
| 168 | Ga0207668_10122287 | 3300025972 | Bacteria | 1973 |
| 169 | Ga0207658_10003492 | 3300025986 | Bacteria | 11095 |
| 170 | Ga0207658_10276979 | 3300025986 | Bacteria | 1436 |
| 171 | Ga0207677_10046342 | 3300026023 | Bacteria | 2910 |
| 172 | Ga0207703_10005337 | 3300026035 | Bacteria | 10351 |
| 173 | Ga0207703_10031784 | 3300026035 | Bacteria | 4175 |
| 174 | Ga0207708_10035670 | 3300026075 | Bacteria | 3785 |
| 175 | Ga0207708_10074201 | 3300026075 | Bacteria | 2607 |
| 176 | Ga0207702_10083265 | 3300026078 | Bacteria | 2783 |
| 177 | Ga0207702_10637250 | 3300026078 | Bacteria | 1048 |
| 178 | Ga0207641_10003040 | 3300026088 | Bacteria | 15114 |
| 179 | Ga0207641_10033856 | 3300026088 | Bacteria | 4246 |
| 180 | Ga0207641_10164486 | 3300026088 | Bacteria | 2019 |
| 181 | Ga0207641_11339823 | 3300026088 | Bacteria | 716 |
| 182 | Ga0207648_10015500 | 3300026089 | Bacteria | 7007 |
| 183 | Ga0207648_10179728 | 3300026089 | Bacteria | 1872 |
| 184 | Ga0207648_10395966 | 3300026089 | Bacteria | 1251 |
| 185 | Ga0207676_10082627 | 3300026095 | Bacteria | 2613 |
| 186 | Ga0207675_100080154 | 3300026118 | Bacteria | 3060 |
| 187 | Ga0207675_100577578 | 3300026118 | Bacteria | 1125 |
| 188 | Ga0207683_10044118 | 3300026121 | Unclassified | 3898 |
| 189 | Ga0207683_10050952 | 3300026121 | Bacteria | 3627 |
| 190 | Ga0207698_10373560 | 3300026142 | Bacteria | 1354 |
| 191 | Ga0210002_1021320 | 3300027617 | Bacteria | 1047 |
| 192 | Ga0209983_1006215 | 3300027665 | Bacteria | 2460 |
| 193 | Ga0209974_10003793 | 3300027876 | Bacteria | 5416 |
| 194 | Ga0268266_10095703 | 3300028379 | Bacteria | 2608 |
| 195 | Ga0268265_10268616 | 3300028380 | Bacteria | 1520 |
| 196 | Ga0268265_10485397 | 3300028380 | Bacteria | 1161 |
| 197 | Ga0268264_10017448 | 3300028381 | Bacteria | 5878 |
| 198 | Ga0268264_10018953 | 3300028381 | Bacteria | 5626 |
| 199 | Ga0268264_10068715 | 3300028381 | Bacteria | 2995 |
| 200 | Ga0268264_10208384 | 3300028381 | Bacteria | 1793 |
| 201 | Ga0265334_10081594 | 3300028573 | Unclassified | 1190 |
| 202 | Ga0265331_10012561 | 3300031250 | Unclassified | 4580 |
| 203 | Ga0265327_10007525 | 3300031251 | Bacteria | 8387 |
| 204 | Ga0307408_100109487 | 3300031548 | Bacteria | 2119 |
| 205 | Ga0316575_10000092 | 3300031665 | Bacteria | 21797 |
| 206 | Ga0316575_10015925 | 3300031665 | Bacteria | 2838 |
| 207 | Ga0316575_10033330 | 3300031665 | Bacteria | 2020 |
| 208 | Ga0316575_10066059 | 3300031665 | Bacteria | 1449 |
| 209 | Ga0316575_10076396 | 3300031665 | Bacteria | 1348 |
| 210 | Ga0316575_10177522 | 3300031665 | Bacteria | 884 |
| 211 | Ga0316579_10000256 | 3300031691 | Bacteria | 16283 |
| 212 | Ga0316579_10000354 | 3300031691 | Bacteria | 14402 |
| 213 | Ga0316579_10027188 | 3300031691 | Bacteria | 2595 |
| 214 | Ga0316576_10000101 | 3300031727 | Bacteria | 31298 |
| 215 | Ga0316576_10000428 | 3300031727 | Bacteria | 19499 |
| 216 | Ga0316576_10002737 | 3300031727 | Bacteria | 10103 |
| 217 | Ga0316576_10003059 | 3300031727 | Bacteria | 9731 |
| 218 | Ga0316576_10004588 | 3300031727 | Bacteria | 8309 |
| 219 | Ga0316576_10039514 | 3300031727 | Bacteria | 3387 |
| 220 | Ga0316578_10007641 | 3300031728 | Bacteria | 5440 |
| 221 | Ga0316578_10024527 | 3300031728 | Bacteria | 3383 |
| 222 | Ga0316578_10033875 | 3300031728 | Bacteria | 2929 |
| 223 | Ga0316578_10034973 | 3300031728 | Bacteria | 2886 |
| 224 | Ga0316578_10036468 | 3300031728 | Bacteria | 2830 |
| 225 | Ga0316578_10243224 | 3300031728 | Bacteria | 1080 |
| 226 | Ga0316578_10423663 | 3300031728 | Bacteria | 788 |
| 227 | Ga0307405_10220092 | 3300031731 | Bacteria | 1392 |
| 228 | Ga0316577_10000267 | 3300031733 | Bacteria | 18493 |
| 229 | Ga0316577_10000361 | 3300031733 | Bacteria | 17071 |
| 230 | Ga0316577_10001133 | 3300031733 | Bacteria | 12182 |
| 231 | Ga0316577_10158300 | 3300031733 | Bacteria | 1277 |
| 232 | Ga0316577_10166476 | 3300031733 | Bacteria | 1243 |
| 233 | Ga0307412_10222645 | 3300031911 | Bacteria | 1447 |
| 234 | Ga0307416_100210253 | 3300032002 | Bacteria | 1855 |
| 235 | Ga0307416_100428346 | 3300032002 | Bacteria | 1369 |
| 236 | Ga0307414_10557335 | 3300032004 | Bacteria | 1022 |
| 237 | Ga0307415_100004607 | 3300032126 | Bacteria | 7194 |
| 238 | Ga0316583_10002521 | 3300032133 | Bacteria | 6373 |
| 239 | Ga0316583_10015624 | 3300032133 | Bacteria | 2732 |
| 240 | Ga0316583_10062764 | 3300032133 | Bacteria | 1301 |
| 241 | Ga0316585_10000020 | 3300032137 | Bacteria | 24272 |
| 242 | Ga0316585_10028577 | 3300032137 | Bacteria | 1744 |
| 243 | Ga0316580_10000034 | 3300032139 | Bacteria | 21707 |
| 244 | Ga0316580_10000159 | 3300032139 | Bacteria | 13198 |
| 245 | Ga0316580_10024665 | 3300032139 | Bacteria | 1859 |
| 246 | Ga0316580_10025883 | 3300032139 | Bacteria | 1813 |
| 247 | Ga0316593_10007668 | 3300032168 | Bacteria | 2972 |
| 248 | Ga0316593_10030334 | 3300032168 | Bacteria | 1755 |
| 249 | Ga0316593_10050292 | 3300032168 | Bacteria | 1406 |
| 250 | Ga0316593_10194305 | 3300032168 | Bacteria | 749 |
| 251 | Ga0316592_1000005 | 3300033524 | Bacteria | 14827 |
| 252 | Ga0316592_1001761 | 3300033524 | Bacteria | 3602 |
| 253 | Ga0316586_1000684 | 3300033527 | Bacteria | 3423 |
| 254 | Ga0316586_1013221 | 3300033527 | Bacteria | 1289 |
| 255 | Ga0316588_1005403 | 3300033528 | Bacteria | 2486 |
| 256 | Ga0316588_1018203 | 3300033528 | Bacteria | 1572 |
| 257 | Ga0316588_1020696 | 3300033528 | Bacteria | 1492 |
| 258 | Ga0316588_1031968 | 3300033528 | Bacteria | 1236 |
| 259 | Ga0316596_1002688 | 3300033541 | Bacteria | 3822 |
| 260 | Ga0316596_1009117 | 3300033541 | Bacteria | 2378 |
| 261 | Ga0316596_1020913 | 3300033541 | Bacteria | 1666 |
| 262 | Ga0316596_1048126 | 3300033541 | Bacteria | 1126 |
| 263 | Ga0316574_0000006 | 3300035398 | Bacteria | 48577 |
| 264 | Ga0316574_0002032 | 3300035398 | Bacteria | 9974 |
| 265 | Ga0316574_0014709 | 3300035398 | Bacteria | 4528 |
| 266 | Ga0316574_0095677 | 3300035398 | Bacteria | 1898 |
| 267 | Ga0316574_0121515 | 3300035398 | Bacteria | 1677 |
| 268 | Ga0316574_0428533 | 3300035398 | Bacteria | 831 |
| 269 | Ga0316582_0000228 | 3300036647 | Bacteria | 18493 |
| 270 | Ga0316582_0009138 | 3300036647 | Bacteria | 5365 |
| 271 | Ga0316582_0070367 | 3300036647 | Bacteria | 2263 |
| 272 | Ga0316582_0103410 | 3300036647 | Bacteria | 1889 |
| 273 | Ga0316582_0299078 | 3300036647 | Bacteria | 1105 |
| 274 | Ga0316584_0000053 | 3300036712 | Bacteria | 43023 |
| 275 | Ga0316584_0003931 | 3300036712 | Bacteria | 9766 |
| 276 | Ga0316584_0007256 | 3300036712 | Bacteria | 7564 |
| 277 | Ga0316584_0009997 | 3300036712 | Bacteria | 6609 |
| 278 | Ga0316584_0016329 | 3300036712 | Bacteria | 5322 |
| 279 | Ga0316584_0021122 | 3300036712 | Bacteria | 4727 |
| 280 | Ga0316584_0049410 | 3300036712 | Bacteria | 3144 |
| 281 | Ga0316584_0082056 | 3300036712 | Bacteria | 2415 |
| 282 | Ga0316581_0004565 | 3300037588 | Bacteria | 3538 |
| 283 | Ga0400484_05404 | 3300038725 | Bacteria | 2226 |
| 284 | Ga0400484_06387 | 3300038725 | Bacteria | 35858 |
| 285 | Ga0400484_28538 | 3300038725 | Bacteria | 3514 |
| 286 | Ga0400490_00715 | 3300038726 | Bacteria | 87348 |
| 287 | Ga0400490_28306 | 3300038726 | Bacteria | 18010 |
| 288 | Ga0400490_50473 | 3300038726 | Bacteria | 15220 |
| 289 | Ga0400491_08086 | 3300038727 | Bacteria | 6795 |
| 290 | Ga0400485_15626 | 3300038735 | Bacteria | 27235 |
| 291 | Ga0400485_19863 | 3300038735 | Bacteria | 101440 |
| 292 | Ga0400488_16050 | 3300038741 | Unclassified | 3963 |
| 293 | Ga0400488_21541 | 3300038741 | Bacteria | 8203 |
| 294 | Ga0400488_46961 | 3300038741 | Bacteria | 19550 |
| 295 | Ga0400486_10291 | 3300038742 | Bacteria | 28199 |
| 296 | Ga0400486_13306 | 3300038742 | Bacteria | 8335 |
| 297 | Ga0400486_19188 | 3300038742 | Bacteria | 196185 |
| 298 | Ga0400486_31726 | 3300038742 | Bacteria | 4226 |
| 299 | Ga0400483_002592 | 3300039062 | Bacteria | 32038 |
| 300 | Ga0400483_008530 | 3300039062 | Bacteria | 4067 |
| 301 | Ga0400483_032108 | 3300039062 | Bacteria | 16142 |
| 302 | Ga0400483_095524 | 3300039062 | Bacteria | 1211 |
| 303 | Ga0400483_102797 | 3300039062 | Bacteria | 11177 |
| 304 | Ga0400483_164432 | 3300039062 | Bacteria | 3281 |
| 305 | Ga0400483_196159 | 3300039062 | Bacteria | 15835 |
| 306 | Ga0400483_200291 | 3300039062 | Bacteria | 5210 |
| 307 | Ga0400487_04570 | 3300039110 | Bacteria | 4121 |
| 308 | Ga0400487_35120 | 3300039110 | Bacteria | 88723 |
| 309 | Ga0400487_38000 | 3300039110 | Bacteria | 182775 |
| 310 | Ga0400487_57813 | 3300039110 | Bacteria | 3605 |
| 311 | Ga0400487_65420 | 3300039110 | Bacteria | 8871 |
| 312 | Ga0436365_0065638 | 3300039437 | Bacteria | 6864 |
| 313 | Ga0439438_000005 | 3300041405 | Bacteria | 408610 |
| 314 | Ga0439447_009653 | 3300041407 | Bacteria | 2909 |
| 315 | Ga0439461_0021999 | 3300041410 | Bacteria | 1274 |
| 316 | Ga0439432_003715 | 3300042006 | Bacteria | 5647 |
| 317 | Ga0439432_135905 | 3300042006 | Unclassified | 724 |
| 318 | Ga0450888_004005 | 3300042126 | Bacteria | 1521 |
| 319 | Ga0439434_0131785 | 3300042435 | Bacteria | 820 |
| 320 | Ga0439444_0000401 | 3300042437 | Bacteria | 4753 |
| 321 | Ga0439444_0068621 | 3300042437 | Bacteria | 755 |
| 322 | Ga0451577_0006343 | 3300042876 | Bacteria | 11814 |
| 323 | Ga0451577_0127307 | 3300042876 | Bacteria | 2283 |
| 324 | Ga0451577_0312491 | 3300042876 | Bacteria | 1424 |
| 325 | Ga0451577_0973245 | 3300042876 | Bacteria | 763 |
| 326 | Ga0466969_0049275 | 3300044656 | Bacteria | 2079 |
| 327 | Ga0453683_0227947 | 3300044673 | Bacteria | 1185 |
| 328 | Ga0453684_0000692 | 3300044712 | Bacteria | 120085 |
| 329 | Ga0453684_0755607 | 3300044712 | Bacteria | 1052 |
| 330 | Ga0466959_0011052 | 3300045049 | Bacteria | 6479 |
| 331 | Ga0451576_0025298 | 3300045051 | Bacteria | 6397 |
| 332 | Ga0451576_0229576 | 3300045051 | Bacteria | 1938 |
| 333 | Ga0451576_0279232 | 3300045051 | Bacteria | 1746 |
| 334 | Ga0495597_0001631 | 3300046542 | Bacteria | 15710 |
| 335 | Ga0495625_0026543 | 3300046660 | Bacteria | 4376 |
| 336 | Ga0495588_0028101 | 3300046674 | Bacteria | 2814 |
| 337 | Ga0495672_0000020 | 3300047320 | Bacteria | 432845 |
| 338 | Ga0495679_000282 | 3300047446 | Bacteria | 42194 |
| 339 | Ga0495681_0139294 | 3300047470 | Bacteria | 1026 |
| 340 | Ga0496101_0778317 | 3300048904 | Bacteria | 755 |
| 341 | Ga0496102_0205226 | 3300048905 | Bacteria | 1858 |
| 342 | Ga0496103_0066153 | 3300048906 | Bacteria | 2256 |
| 343 | Ga0496107_0216009 | 3300048910 | Bacteria | 1426 |
| 344 | Ga0496108_0181648 | 3300048911 | Bacteria | 1822 |
| 345 | Ga0496110_0323083 | 3300048913 | Bacteria | 1406 |
| 346 | Ga0496121_0005167 | 3300048924 | Bacteria | 16942 |
| 347 | Ga0496125_0003124 | 3300048928 | Bacteria | 20578 |
| 348 | Ga0501036_0057020 | 3300049572 | Bacteria | 3309 |
| 349 | Ga0501037_0036661 | 3300049573 | Bacteria | 3613 |
| 350 | Ga0501038_0000767 | 3300049574 | Bacteria | 28528 |
| 351 | Ga0501038_0004640 | 3300049574 | Bacteria | 12788 |
| 352 | Ga0501038_0264298 | 3300049574 | Bacteria | 1359 |
| 353 | Ga0501039_0000428 | 3300049575 | Bacteria | 30396 |
| 354 | Ga0501039_0011873 | 3300049575 | Bacteria | 6637 |
| 355 | Ga0501039_0518461 | 3300049575 | Bacteria | 936 |
| 356 | Ga0501040_0016438 | 3300049576 | Bacteria | 4898 |
| 357 | Ga0501040_0091350 | 3300049576 | Bacteria | 2116 |
| 358 | Ga0501041_0000067 | 3300049577 | Bacteria | 39230 |
| 359 | Ga0501041_0080304 | 3300049577 | Bacteria | 2008 |
| 360 | Ga0501041_0112257 | 3300049577 | Bacteria | 1691 |
| 361 | Ga0501042_0002265 | 3300049578 | Bacteria | 11745 |
| 362 | Ga0501042_0432049 | 3300049578 | Bacteria | 954 |
| 363 | Ga0501043_0023417 | 3300049579 | Bacteria | 4844 |
| 364 | Ga0501043_0294827 | 3300049579 | Bacteria | 1241 |
| 365 | Ga0501046_0008309 | 3300049580 | Bacteria | 9059 |
| 366 | Ga0501046_0008579 | 3300049580 | Bacteria | 8894 |
| 367 | Ga0501048_0022086 | 3300049582 | Bacteria | 4656 |
| 368 | Ga0501048_0571264 | 3300049582 | Bacteria | 812 |
| 369 | Ga0501068_0067767 | 3300049584 | Bacteria | 2175 |
| 370 | Ga0501068_0268289 | 3300049584 | Bacteria | 1089 |
| 371 | Ga0501071_0001370 | 3300049587 | Bacteria | 13971 |
| 372 | Ga0501071_0007224 | 3300049587 | Bacteria | 7267 |
| 373 | Ga0501072_0000207 | 3300049588 | Bacteria | 42907 |
| 374 | Ga0501072_0009788 | 3300049588 | Bacteria | 7288 |
| 375 | Ga0501073_0157809 | 3300049589 | Bacteria | 1572 |
| 376 | Ga0501073_0521266 | 3300049589 | Bacteria | 821 |
| 377 | Ga0501074_0029077 | 3300049590 | Bacteria | 4003 |
| 378 | Ga0501075_0004851 | 3300049591 | Bacteria | 9155 |
| 379 | Ga0501075_0027462 | 3300049591 | Bacteria | 4194 |
| 380 | Ga0501075_0028123 | 3300049591 | Bacteria | 4148 |
| 381 | Ga0501076_0000060 | 3300049592 | Bacteria | 54005 |
| 382 | Ga0501076_0009649 | 3300049592 | Bacteria | 7131 |
| 383 | Ga0501077_0000072 | 3300049593 | Bacteria | 50803 |
| 384 | Ga0501077_0001282 | 3300049593 | Bacteria | 15191 |
| 385 | Ga0501079_0000665 | 3300049741 | Bacteria | 23026 |
| 386 | Ga0501079_0010533 | 3300049741 | Bacteria | 7030 |
| 387 | Ga0501079_0073132 | 3300049741 | Bacteria | 2650 |
| 388 | Ga0501080_0001793 | 3300049742 | Bacteria | 18401 |
| 389 | Ga0501080_0039368 | 3300049742 | Bacteria | 4412 |
| 390 | Ga0501081_0000277 | 3300049743 | Bacteria | 27024 |
| 391 | Ga0501081_0184582 | 3300049743 | Bacteria | 1509 |
| 392 | Ga0501083_0022506 | 3300049744 | Bacteria | 4373 |
| 393 | Ga0501035_0002190 | 3300049822 | Bacteria | 19394 |
| 394 | Ga0501035_0023570 | 3300049822 | Bacteria | 5647 |
| 395 | Ga0501044_0121312 | 3300049823 | Bacteria | 2615 |
| 396 | Ga0501045_0000150 | 3300049824 | Bacteria | 37092 |
| 397 | Ga0501045_0013504 | 3300049824 | Bacteria | 5769 |
| 398 | Ga0501045_0083453 | 3300049824 | Bacteria | 2357 |
| 399 | nmdc:mga00v17_401918_c1 | 3300050491 | Bacteria | 890 |
| 400 | nmdc:mga08y16_346775_c1 | 3300050511 | Bacteria | 1526 |
| 401 | nmdc:mga08y16_76593_c1 | 3300050511 | Bacteria | 3486 |
| 402 | Ga0501084_0010500 | 3300054114 | Bacteria | 7656 |
| 403 | Ga0501084_0058861 | 3300054114 | Bacteria | 3215 |
| 404 | Ga0501082_0000505 | 3300060353 | Bacteria | 34566 |
| 405 | Ga0501082_0384859 | 3300060353 | Bacteria | 1224 |
| 406 | Ga0501082_0576752 | 3300060353 | Bacteria | 984 |
| 407 | Ga0530510_0000570 | 3300061734 | Bacteria | 23735 |
| 408 | Ga0530510_0552879 | 3300061734 | Bacteria | 874 |
| 409 | 2509391413 | 2509276021 | Bacteria | 7634384 |
| 410 | 2599723418 | 2599185236 | Bacteria | 6875203 |
| 411 | 2603866770 | 2602042109 | Bacteria | 5152801 |
| 412 | 2869553025 | 2869551831 | Bacteria | 5474685 |
| 413 | 2883292125 | 2883291878 | Bacteria | 5894118 |
| 414 | 2891672929 | 2891670763 | Bacteria | 4967099 |
| 415 | 8005651181 | 8005645114 | Bacteria | 6950293 |
| 416 | 8054853014 | 8054849141 | Bacteria | 5232694 |
| 417 | Ga0439453_0006112 | |||
| 418 | Ga0065715_10150479 | |||
| 419 | Ga0065707_10221749 | |||
| 420 | Ga0070658_10625989 | |||
| 421 | Ga0070676_10004525 | |||
| 422 | Ga0070676_10050507 | |||
| 423 | Ga0070676_10362411 | |||
| 424 | Ga0070690_100094807 | |||
| 425 | Ga0070670_100100212 | |||
| 426 | Ga0070677_10215017 | |||
| 427 | Ga0070666_10036283 | |||
| 428 | Ga0070680_100167193 | |||
| 429 | Ga0070689_100062907 | |||
| 430 | Ga0070689_100108305 | |||
| 431 | Ga0070691_10303215 | |||
| 432 | Ga0070687_100006214 | |||
| 433 | Ga0070687_100075103 | |||
| 434 | Ga0070692_10071805 | |||
| 435 | Ga0070668_100065907 | |||
| 436 | Ga0070668_100112534 | |||
| 437 | Ga0070668_100145281 | |||
| 438 | Ga0070669_100000751 | |||
| 439 | Ga0070669_101096292 | |||
| 440 | Ga0070675_100983541 | |||
| 441 | Ga0070671_100002002 | |||
| 442 | Ga0070671_100126886 | |||
| 443 | Ga0070674_100006994 | |||
| 444 | Ga0070674_100054832 | |||
| 445 | Ga0070673_100081563 | |||
| 446 | Ga0070688_100009910 | |||
| 447 | Ga0070688_100297472 | |||
| 448 | Ga0070688_100710568 | |||
| 449 | Ga0070667_100002128 | |||
| 450 | Ga0070667_100052618 | |||
| 451 | Ga0070667_100061664 | |||
| 452 | Ga0070701_10011449 | |||
| 453 | Ga0070700_100034791 | |||
| 454 | Ga0070700_100092660 | |||
| 455 | Ga0070662_100061694 | |||
| 456 | Ga0070662_100137766 | |||
| 457 | Ga0070662_100140261 | |||
| 458 | Ga0070681_10023641 | |||
| 459 | Ga0068867_100283544 | |||
| 460 | Ga0070685_10016916 | |||
| 461 | Ga0070679_100125576 | |||
| 462 | Ga0070679_100127048 | |||
| 463 | Ga0070672_100129177 | |||
| 464 | Ga0070686_100072472 | |||
| 465 | Ga0070686_100223977 | |||
| 466 | Ga0070665_101004012 | |||
| 467 | Ga0070704_100071831 | |||
| 468 | Ga0070704_100461230 | |||
| 469 | Ga0068855_100048550 | |||
| 470 | Ga0068856_101472198 | |||
| 471 | Ga0068859_100001335 | |||
| 472 | Ga0068859_100069468 | |||
| 473 | Ga0068864_100165245 | |||
| 474 | Ga0068864_100376886 | |||
| 475 | Ga0068866_10012818 | |||
| 476 | Ga0068866_10015698 | |||
| 477 | Ga0068861_100104522 | |||
| 478 | Ga0068870_10144846 | |||
| 479 | Ga0068863_100008177 | |||
| 480 | Ga0068858_100001317 | |||
| 481 | Ga0068858_100388027 | |||
| 482 | Ga0068860_100018325 | |||
| 483 | Ga0068860_100076973 | |||
| 484 | Ga0068860_100097170 | |||
| 485 | Ga0068860_100350423 | |||
| 486 | Ga0068860_100929329 | |||
| 487 | Ga0068862_100108525 | |||
| 488 | Ga0068862_100132228 | |||
| 489 | Ga0097621_100398068 | |||
| 490 | Ga0068871_100010118 | |||
| 491 | Ga0068865_100571528 | |||
| 492 | Ga0097620_100001335 | |||
| 493 | Ga0097620_100069469 | |||
| 494 | Ga0105251_10008971 | |||
| 495 | Ga0105244_10001499 | |||
| 496 | Ga0105244_10008832 | |||
| 497 | Ga0105244_10043099 | |||
| 498 | Ga0105240_10026597 | |||
| 499 | Ga0105240_10045776 | |||
| 500 | Ga0111539_10303953 | |||
| 501 | Ga0111539_10478688 | |||
| 502 | Ga0105245_10281287 | |||
| 503 | Ga0105247_10000351 | |||
| 504 | Ga0105247_10023832 | |||
| 505 | Ga0105243_10035294 | |||
| 506 | Ga0105242_10006790 | |||
| 507 | Ga0105242_10038027 | |||
| 508 | Ga0105248_10030814 | |||
| 509 | Ga0105248_10280380 | |||
| 510 | Ga0105238_10085397 | |||
| 511 | Ga0105238_10110131 | |||
| 512 | Ga0105249_10130636 | |||
| 513 | Ga0105239_10023796 | |||
| 514 | Ga0105246_10245577 | |||
| 515 | Ga0157373_10297477 | |||
| 516 | Ga0157371_10005283 | |||
| 517 | Ga0157370_10307131 | |||
| 518 | Ga0157369_10958519 | |||
| 519 | Ga0157374_10318554 | |||
| 520 | Ga0157378_10099556 | |||
| 521 | Ga0157372_10068718 | |||
| 522 | Ga0157375_10119946 | |||
| 523 | Ga0157375_10593424 | |||
| 524 | Ga0163163_10004130 | |||
| 525 | Ga0163163_10072441 | |||
| 526 | Ga0157380_10018037 | |||
| 527 | Ga0157380_10068447 | |||
| 528 | Ga0157380_10457775 | |||
| 529 | Ga0157380_10615659 | |||
| 530 | Ga0157379_10001800 | |||
| 531 | Ga0157379_10008835 | |||
| 532 | Ga0157379_10055820 | |||
| 533 | Ga0157379_10301267 | |||
| 534 | Ga0163161_10043416 | |||
| 535 | Ga0163161_10069714 | |||
| 536 | Ga0207697_10005605 | |||
| 537 | Ga0207696_1001572 | |||
| 538 | Ga0207655_1049397 | |||
| 539 | Ga0207682_10006948 | |||
| 540 | Ga0207682_10009896 | |||
| 541 | Ga0207642_10073060 | |||
| 542 | Ga0207710_10000315 | |||
| 543 | Ga0207688_10005891 | |||
| 544 | Ga0207680_10030578 | |||
| 545 | Ga0207645_10037900 | |||
| 546 | Ga0207645_10134356 | |||
| 547 | Ga0207645_10429173 | |||
| 548 | Ga0207643_10008054 | |||
| 549 | Ga0207643_10059198 | |||
| 550 | Ga0207643_10146560 | |||
| 551 | Ga0207695_10146402 | |||
| 552 | Ga0207695_10173196 | |||
| 553 | Ga0207660_10048025 | |||
| 554 | Ga0207662_10007570 | |||
| 555 | Ga0207662_10008114 | |||
| 556 | Ga0207649_10070312 | |||
| 557 | Ga0207652_10320001 | |||
| 558 | Ga0207681_10094294 | |||
| 559 | Ga0207694_10195097 | |||
| 560 | Ga0207650_10427810 | |||
| 561 | Ga0207659_10109095 | |||
| 562 | Ga0207659_10204364 | |||
| 563 | Ga0207659_10367537 | |||
| 564 | Ga0207659_10382030 | |||
| 565 | Ga0207644_10000993 | |||
| 566 | Ga0207644_10011107 | |||
| 567 | Ga0207706_10031573 | |||
| 568 | Ga0207706_10068833 | |||
| 569 | Ga0207706_10131942 | |||
| 570 | Ga0207686_10015146 | |||
| 571 | Ga0207709_10070599 | |||
| 572 | Ga0207670_10096845 | |||
| 573 | Ga0207669_10008184 | |||
| 574 | Ga0207669_10447780 | |||
| 575 | Ga0207691_10072994 | |||
| 576 | Ga0207711_10023066 | |||
| 577 | Ga0207689_10003437 | |||
| 578 | Ga0207689_10048514 | |||
| 579 | Ga0207667_10152072 | |||
| 580 | Ga0207651_10100389 | |||
| 581 | Ga0207712_10243824 | |||
| 582 | Ga0207668_10041561 | |||
| 583 | Ga0207668_10096448 | |||
| 584 | Ga0207668_10122287 | |||
| 585 | Ga0207658_10003492 | |||
| 586 | Ga0207658_10276979 | |||
| 587 | Ga0207677_10046342 | |||
| 588 | Ga0207703_10005337 | |||
| 589 | Ga0207703_10031784 | |||
| 590 | Ga0207708_10035670 | |||
| 591 | Ga0207708_10074201 | |||
| 592 | Ga0207702_10083265 | |||
| 593 | Ga0207702_10637250 | |||
| 594 | Ga0207641_10003040 | |||
| 595 | Ga0207641_10033856 | |||
| 596 | Ga0207641_10164486 | |||
| 597 | Ga0207641_11339823 | |||
| 598 | Ga0207648_10015500 | |||
| 599 | Ga0207648_10179728 | |||
| 600 | Ga0207648_10395966 | |||
| 601 | Ga0207676_10082627 | |||
| 602 | Ga0207675_100080154 | |||
| 603 | Ga0207675_100577578 | |||
| 604 | Ga0207683_10044118 | |||
| 605 | Ga0207683_10050952 | |||
| 606 | Ga0207698_10373560 | |||
| 607 | Ga0210002_1021320 | |||
| 608 | Ga0209983_1006215 | |||
| 609 | Ga0209974_10003793 | |||
| 610 | Ga0268266_10095703 | |||
| 611 | Ga0268265_10268616 | |||
| 612 | Ga0268265_10485397 | |||
| 613 | Ga0268264_10017448 | |||
| 614 | Ga0268264_10018953 | |||
| 615 | Ga0268264_10068715 | |||
| 616 | Ga0268264_10208384 | |||
| 617 | Ga0265334_10081594 | |||
| 618 | Ga0265331_10012561 | |||
| 619 | Ga0265327_10007525 | |||
| 620 | Ga0307408_100109487 | |||
| 621 | Ga0316575_10000092 | |||
| 622 | Ga0316575_10015925 | |||
| 623 | Ga0316575_10033330 | |||
| 624 | Ga0316575_10066059 | |||
| 625 | Ga0316575_10076396 | |||
| 626 | Ga0316575_10177522 | |||
| 627 | Ga0316579_10000256 | |||
| 628 | Ga0316579_10000354 | |||
| 629 | Ga0316579_10027188 | |||
| 630 | Ga0316576_10000101 | |||
| 631 | Ga0316576_10000428 | |||
| 632 | Ga0316576_10002737 | |||
| 633 | Ga0316576_10003059 | |||
| 634 | Ga0316576_10004588 | |||
| 635 | Ga0316576_10039514 | |||
| 636 | Ga0316578_10007641 | |||
| 637 | Ga0316578_10024527 | |||
| 638 | Ga0316578_10033875 | |||
| 639 | Ga0316578_10034973 | |||
| 640 | Ga0316578_10036468 | |||
| 641 | Ga0316578_10243224 | |||
| 642 | Ga0316578_10423663 | |||
| 643 | Ga0307405_10220092 | |||
| 644 | Ga0316577_10000267 | |||
| 645 | Ga0316577_10000361 | |||
| 646 | Ga0316577_10001133 | |||
| 647 | Ga0316577_10158300 | |||
| 648 | Ga0316577_10166476 | |||
| 649 | Ga0307412_10222645 | |||
| 650 | Ga0307416_100210253 | |||
| 651 | Ga0307416_100428346 | |||
| 652 | Ga0307414_10557335 | |||
| 653 | Ga0307415_100004607 | |||
| 654 | Ga0316583_10002521 | |||
| 655 | Ga0316583_10015624 | |||
| 656 | Ga0316583_10062764 | |||
| 657 | Ga0316585_10000020 | |||
| 658 | Ga0316585_10028577 | |||
| 659 | Ga0316580_10000034 | |||
| 660 | Ga0316580_10000159 | |||
| 661 | Ga0316580_10024665 | |||
| 662 | Ga0316580_10025883 | |||
| 663 | Ga0316593_10007668 | |||
| 664 | Ga0316593_10030334 | |||
| 665 | Ga0316593_10050292 | |||
| 666 | Ga0316593_10194305 | |||
| 667 | Ga0316592_1000005 | |||
| 668 | Ga0316592_1001761 | |||
| 669 | Ga0316586_1000684 | |||
| 670 | Ga0316586_1013221 | |||
| 671 | Ga0316588_1005403 | |||
| 672 | Ga0316588_1018203 | |||
| 673 | Ga0316588_1020696 | |||
| 674 | Ga0316588_1031968 | |||
| 675 | Ga0316596_1002688 | |||
| 676 | Ga0316596_1009117 | |||
| 677 | Ga0316596_1020913 | |||
| 678 | Ga0316596_1048126 | |||
| 679 | Ga0316574_0000006 | |||
| 680 | Ga0316574_0002032 | |||
| 681 | Ga0316574_0014709 | |||
| 682 | Ga0316574_0095677 | |||
| 683 | Ga0316574_0121515 | |||
| 684 | Ga0316574_0428533 | |||
| 685 | Ga0316582_0000228 | |||
| 686 | Ga0316582_0009138 | |||
| 687 | Ga0316582_0070367 | |||
| 688 | Ga0316582_0103410 | |||
| 689 | Ga0316582_0299078 | |||
| 690 | Ga0316584_0000053 | |||
| 691 | Ga0316584_0003931 | |||
| 692 | Ga0316584_0007256 | |||
| 693 | Ga0316584_0009997 | |||
| 694 | Ga0316584_0016329 | |||
| 695 | Ga0316584_0021122 | |||
| 696 | Ga0316584_0049410 | |||
| 697 | Ga0316584_0082056 | |||
| 698 | Ga0316581_0004565 | |||
| 699 | Ga0400484_05404 | |||
| 700 | Ga0400484_06387 | |||
| 701 | Ga0400484_28538 | |||
| 702 | Ga0400490_00715 | |||
| 703 | Ga0400490_28306 | |||
| 704 | Ga0400490_50473 | |||
| 705 | Ga0400491_08086 | |||
| 706 | Ga0400485_15626 | |||
| 707 | Ga0400485_19863 | |||
| 708 | Ga0400488_16050 | |||
| 709 | Ga0400488_21541 | |||
| 710 | Ga0400488_46961 | |||
| 711 | Ga0400486_10291 | |||
| 712 | Ga0400486_13306 | |||
| 713 | Ga0400486_19188 | |||
| 714 | Ga0400486_31726 | |||
| 715 | Ga0400483_002592 | |||
| 716 | Ga0400483_008530 | |||
| 717 | Ga0400483_032108 | |||
| 718 | Ga0400483_095524 | |||
| 719 | Ga0400483_102797 | |||
| 720 | Ga0400483_164432 | |||
| 721 | Ga0400483_196159 | |||
| 722 | Ga0400483_200291 | |||
| 723 | Ga0400487_04570 | |||
| 724 | Ga0400487_35120 | |||
| 725 | Ga0400487_38000 | |||
| 726 | Ga0400487_57813 | |||
| 727 | Ga0400487_65420 | |||
| 728 | Ga0436365_0065638 | |||
| 729 | Ga0439438_000005 | |||
| 730 | Ga0439447_009653 | |||
| 731 | Ga0439461_0021999 | |||
| 732 | Ga0439432_003715 | |||
| 733 | Ga0439432_135905 | |||
| 734 | Ga0450888_004005 | |||
| 735 | Ga0439434_0131785 | |||
| 736 | Ga0439444_0000401 | |||
| 737 | Ga0439444_0068621 | |||
| 738 | Ga0451577_0006343 | |||
| 739 | Ga0451577_0127307 | |||
| 740 | Ga0451577_0312491 | |||
| 741 | Ga0451577_0973245 | |||
| 742 | Ga0466969_0049275 | |||
| 743 | Ga0453683_0227947 | |||
| 744 | Ga0453684_0000692 | |||
| 745 | Ga0453684_0755607 | |||
| 746 | Ga0466959_0011052 | |||
| 747 | Ga0451576_0025298 | |||
| 748 | Ga0451576_0229576 | |||
| 749 | Ga0451576_0279232 | |||
| 750 | Ga0495597_0001631 | |||
| 751 | Ga0495625_0026543 | |||
| 752 | Ga0495588_0028101 | |||
| 753 | Ga0495672_0000020 | |||
| 754 | Ga0495679_000282 | |||
| 755 | Ga0495681_0139294 | |||
| 756 | Ga0496101_0778317 | |||
| 757 | Ga0496102_0205226 | |||
| 758 | Ga0496103_0066153 | |||
| 759 | Ga0496107_0216009 | |||
| 760 | Ga0496108_0181648 | |||
| 761 | Ga0496110_0323083 | |||
| 762 | Ga0496121_0005167 | |||
| 763 | Ga0496125_0003124 | |||
| 764 | Ga0501036_0057020 | |||
| 765 | Ga0501037_0036661 | |||
| 766 | Ga0501038_0000767 | |||
| 767 | Ga0501038_0004640 | |||
| 768 | Ga0501038_0264298 | |||
| 769 | Ga0501039_0000428 | |||
| 770 | Ga0501039_0011873 | |||
| 771 | Ga0501039_0518461 | |||
| 772 | Ga0501040_0016438 | |||
| 773 | Ga0501040_0091350 | |||
| 774 | Ga0501041_0000067 | |||
| 775 | Ga0501041_0080304 | |||
| 776 | Ga0501041_0112257 | |||
| 777 | Ga0501042_0002265 | |||
| 778 | Ga0501042_0432049 | |||
| 779 | Ga0501043_0023417 | |||
| 780 | Ga0501043_0294827 | |||
| 781 | Ga0501046_0008309 | |||
| 782 | Ga0501046_0008579 | |||
| 783 | Ga0501048_0022086 | |||
| 784 | Ga0501048_0571264 | |||
| 785 | Ga0501068_0067767 | |||
| 786 | Ga0501068_0268289 | |||
| 787 | Ga0501071_0001370 | |||
| 788 | Ga0501071_0007224 | |||
| 789 | Ga0501072_0000207 | |||
| 790 | Ga0501072_0009788 | |||
| 791 | Ga0501073_0157809 | |||
| 792 | Ga0501073_0521266 | |||
| 793 | Ga0501074_0029077 | |||
| 794 | Ga0501075_0004851 | |||
| 795 | Ga0501075_0027462 | |||
| 796 | Ga0501075_0028123 | |||
| 797 | Ga0501076_0000060 | |||
| 798 | Ga0501076_0009649 | |||
| 799 | Ga0501077_0000072 | |||
| 800 | Ga0501077_0001282 | |||
| 801 | Ga0501079_0000665 | |||
| 802 | Ga0501079_0010533 | |||
| 803 | Ga0501079_0073132 | |||
| 804 | Ga0501080_0001793 | |||
| 805 | Ga0501080_0039368 | |||
| 806 | Ga0501081_0000277 | |||
| 807 | Ga0501081_0184582 | |||
| 808 | Ga0501083_0022506 | |||
| 809 | Ga0501035_0002190 | |||
| 810 | Ga0501035_0023570 | |||
| 811 | Ga0501044_0121312 | |||
| 812 | Ga0501045_0000150 | |||
| 813 | Ga0501045_0013504 | |||
| 814 | Ga0501045_0083453 | |||
| 815 | nmdc:mga00v17_401918_c1 | |||
| 816 | nmdc:mga08y16_346775_c1 | |||
| 817 | nmdc:mga08y16_76593_c1 | |||
| 818 | Ga0501084_0010500 | |||
| 819 | Ga0501084_0058861 | |||
| 820 | Ga0501082_0000505 | |||
| 821 | Ga0501082_0384859 | |||
| 822 | Ga0501082_0576752 | |||
| 823 | Ga0530510_0000570 | |||
| 824 | Ga0530510_0552879 | |||
| 825 | 2509391413 | |||
| 826 | 2599723418 | |||
| 827 | 2603866770 | |||
| 828 | 2869553025 | |||
| 829 | 2883292125 | |||
| 830 | 2891672929 | |||
| 831 | 8005651181 | |||
| 832 | 8054853014 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9426 | 140 | 199 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9389 | 140 | 199 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9384 | 140 | 199 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9361 | 140 | 199 |
| 1je8-assembly2.cif.gz_E | two-component response regulator narl/dna complex: dna bending found in a high affinity site | 0.9333 | 142 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9809 | 144 | 199 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9808 | 144 | 199 | 1.10.10.10 |
| af_P0DMC9_101_196_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9548 | 144 | 199 | 1.10.10.10 |
| af_Q11028_1077_1158_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9497 | 143 | 199 | 1.10.10.10 |
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.949 | 144 | 199 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0W627-F1-model_v4 | Two-component transcriptional response regulator, LuxR family | 0.9334 | 4 | 200 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A2A3MTX2-F1-model_v4 | DNA-binding response regulator | 0.9267 | 1 | 200 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A7V1Z6V2-F1-model_v4 | Response regulator transcription factor | 0.9254 | 1 | 200 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A1E2UMK5-F1-model_v4 | DNA-binding response regulator | 0.9165 | 5 | 200 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A521SJL2-F1-model_v4 | deleted | 0.9144 | 2 | 200 |
|