F439113

General Info

Members Datasets Scaffolds Average Seq Length
417 222 832 204

Family's Representative Sequence

Representative Sequence 3300041408|Ga0439453_0006112|Ga0439453_0006112_887_1567
Length 226
Sequence MAPLGELPETVYVVDDHPSIRAALKRLLGSVGLACETFGSASEFIDRLDEGGVTGCLLLDVRMPGVGGLELQEKLAAAGQDLPVIFLTAYADVPLTVRVMKAGAQEVLTKPFEEQALLDAVYRALDRERVLRREREELXXDREHFETLTGREREVMQLVVTGMLNKQVADALGTAEKTIKAHRGHVMQKMRASSLVELLRMADRLRECDQRAETPSRGLTTAGRQK

Samples

Sample ID Description Type Environment
1 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
138 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
139 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
140 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
149 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
150 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
151 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
152 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
153 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
154 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
155 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
156 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
159 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
216 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
217 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
218 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
219 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
220 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
221 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
222 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.24
Metatranscriptomes 3.84
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0.24
Rhizoplane 1.92
Rhizosphere 89.93
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439453_0006112 3300041408 Bacteria 1862
2 Ga0065715_10150479 3300005293 Bacteria 1735
3 Ga0065707_10221749 3300005295 Bacteria 1222
4 Ga0070658_10625989 3300005327 Bacteria 933
5 Ga0070676_10004525 3300005328 Bacteria 7321
6 Ga0070676_10050507 3300005328 Bacteria 2438
7 Ga0070676_10362411 3300005328 Bacteria 999
8 Ga0070690_100094807 3300005330 Bacteria 1970
9 Ga0070670_100100212 3300005331 Bacteria 2493
10 Ga0070677_10215017 3300005333 Bacteria 935
11 Ga0070666_10036283 3300005335 Bacteria 3271
12 Ga0070680_100167193 3300005336 Bacteria 1850
13 Ga0070689_100062907 3300005340 Bacteria 2888
14 Ga0070689_100108305 3300005340 Bacteria 2207
15 Ga0070691_10303215 3300005341 Bacteria 873
16 Ga0070687_100006214 3300005343 Bacteria 4885
17 Ga0070687_100075103 3300005343 Bacteria 1827
18 Ga0070692_10071805 3300005345 Bacteria 1846
19 Ga0070668_100065907 3300005347 Bacteria 2809
20 Ga0070668_100112534 3300005347 Bacteria 2168
21 Ga0070668_100145281 3300005347 Bacteria 1914
22 Ga0070669_100000751 3300005353 Bacteria 23601
23 Ga0070669_101096292 3300005353 Bacteria 685
24 Ga0070675_100983541 3300005354 Bacteria 774
25 Ga0070671_100002002 3300005355 Bacteria 15650
26 Ga0070671_100126886 3300005355 Bacteria 2148
27 Ga0070674_100006994 3300005356 Bacteria 6624
28 Ga0070674_100054832 3300005356 Bacteria 2758
29 Ga0070673_100081563 3300005364 Bacteria 2623
30 Ga0070688_100009910 3300005365 Bacteria 5236
31 Ga0070688_100297472 3300005365 Bacteria 1165
32 Ga0070688_100710568 3300005365 Bacteria 779
33 Ga0070667_100002128 3300005367 Bacteria 17464
34 Ga0070667_100052618 3300005367 Bacteria 3436
35 Ga0070667_100061664 3300005367 Bacteria 3175
36 Ga0070701_10011449 3300005438 Bacteria 3967
37 Ga0070700_100034791 3300005441 Bacteria 3044
38 Ga0070700_100092660 3300005441 Bacteria 1975
39 Ga0070662_100061694 3300005457 Bacteria 2738
40 Ga0070662_100137766 3300005457 Bacteria 1889
41 Ga0070662_100140261 3300005457 Bacteria 1872
42 Ga0070681_10023641 3300005458 Bacteria 6183
43 Ga0068867_100283544 3300005459 Bacteria 1359
44 Ga0070685_10016916 3300005466 Bacteria 3892
45 Ga0070679_100125576 3300005530 Bacteria 2548
46 Ga0070679_100127048 3300005530 Bacteria 2532
47 Ga0070672_100129177 3300005543 Bacteria 2075
48 Ga0070686_100072472 3300005544 Bacteria 2259
49 Ga0070686_100223977 3300005544 Bacteria 1361
50 Ga0070665_101004012 3300005548 Bacteria 847
51 Ga0070704_100071831 3300005549 Unclassified 2516
52 Ga0070704_100461230 3300005549 Bacteria 1096
53 Ga0068855_100048550 3300005563 Bacteria 5009
54 Ga0068856_101472198 3300005614 Bacteria 695
55 Ga0068859_100001335 3300005617 Bacteria 25191
56 Ga0068859_100069468 3300005617 Bacteria 3557
57 Ga0068864_100165245 3300005618 Bacteria 2014
58 Ga0068864_100376886 3300005618 Bacteria 1344
59 Ga0068866_10012818 3300005718 Bacteria 3661
60 Ga0068866_10015698 3300005718 Bacteria 3370
61 Ga0068861_100104522 3300005719 Bacteria 2259
62 Ga0068870_10144846 3300005840 Bacteria 1393
63 Ga0068863_100008177 3300005841 Bacteria 10218
64 Ga0068858_100001317 3300005842 Bacteria 25645
65 Ga0068858_100388027 3300005842 Bacteria 1340
66 Ga0068860_100018325 3300005843 Bacteria 6812
67 Ga0068860_100076973 3300005843 Bacteria 3172
68 Ga0068860_100097170 3300005843 Bacteria 2808
69 Ga0068860_100350423 3300005843 Bacteria 1453
70 Ga0068860_100929329 3300005843 Bacteria 886
71 Ga0068862_100108525 3300005844 Bacteria 2434
72 Ga0068862_100132228 3300005844 Bacteria 2208
73 Ga0097621_100398068 3300006237 Bacteria 1232
74 Ga0068871_100010118 3300006358 Bacteria 6864
75 Ga0068865_100571528 3300006881 Bacteria 952
76 Ga0097620_100001335 3300006931 Bacteria 25191
77 Ga0097620_100069469 3300006931 Bacteria 3557
78 Ga0105251_10008971 3300009011 Bacteria 5970
79 Ga0105244_10001499 3300009036 Bacteria 18722
80 Ga0105244_10008832 3300009036 Bacteria 6256
81 Ga0105244_10043099 3300009036 Bacteria 2330
82 Ga0105240_10026597 3300009093 Bacteria 7593
83 Ga0105240_10045776 3300009093 Bacteria 5548
84 Ga0111539_10303953 3300009094 Bacteria 1856
85 Ga0111539_10478688 3300009094 Bacteria 1450
86 Ga0105245_10281287 3300009098 Bacteria 1626
87 Ga0105247_10000351 3300009101 Bacteria 39984
88 Ga0105247_10023832 3300009101 Bacteria 3688
89 Ga0105243_10035294 3300009148 Bacteria 3876
90 Ga0105242_10006790 3300009176 Bacteria 8825
91 Ga0105242_10038027 3300009176 Bacteria 3867
92 Ga0105248_10030814 3300009177 Bacteria 5992
93 Ga0105248_10280380 3300009177 Bacteria 1876
94 Ga0105238_10085397 3300009551 Bacteria 3144
95 Ga0105238_10110131 3300009551 Bacteria 2735
96 Ga0105249_10130636 3300009553 Bacteria 2397
97 Ga0105239_10023796 3300010375 Bacteria 6745
98 Ga0105246_10245577 3300011119 Unclassified 1418
99 Ga0157373_10297477 3300013100 Bacteria 1145
100 Ga0157371_10005283 3300013102 Bacteria 10942
101 Ga0157370_10307131 3300013104 Bacteria 1464
102 Ga0157369_10958519 3300013105 Bacteria 877
103 Ga0157374_10318554 3300013296 Bacteria 1541
104 Ga0157378_10099556 3300013297 Bacteria 2652
105 Ga0157372_10068718 3300013307 Bacteria 3983
106 Ga0157375_10119946 3300013308 Bacteria 2738
107 Ga0157375_10593424 3300013308 Bacteria 1267
108 Ga0163163_10004130 3300014325 Bacteria 12365
109 Ga0163163_10072441 3300014325 Bacteria 3434
110 Ga0157380_10018037 3300014326 Bacteria 5234
111 Ga0157380_10068447 3300014326 Bacteria 2861
112 Ga0157380_10457775 3300014326 Bacteria 1227
113 Ga0157380_10615659 3300014326 Bacteria 1077
114 Ga0157379_10001800 3300014968 Bacteria 17670
115 Ga0157379_10008835 3300014968 Bacteria 8787
116 Ga0157379_10055820 3300014968 Bacteria 3529
117 Ga0157379_10301267 3300014968 Bacteria 1461
118 Ga0163161_10043416 3300017792 Bacteria 3237
119 Ga0163161_10069714 3300017792 Bacteria 2570
120 Ga0207697_10005605 3300025315 Bacteria 5811
121 Ga0207696_1001572 3300025711 Bacteria 12124
122 Ga0207655_1049397 3300025728 Bacteria 1718
123 Ga0207682_10006948 3300025893 Bacteria 4538
124 Ga0207682_10009896 3300025893 Bacteria 3747
125 Ga0207642_10073060 3300025899 Bacteria 1639
126 Ga0207710_10000315 3300025900 Bacteria 37309
127 Ga0207688_10005891 3300025901 Bacteria 6672
128 Ga0207680_10030578 3300025903 Bacteria 3039
129 Ga0207645_10037900 3300025907 Bacteria 3094
130 Ga0207645_10134356 3300025907 Bacteria 1611
131 Ga0207645_10429173 3300025907 Bacteria 891
132 Ga0207643_10008054 3300025908 Bacteria 5652
133 Ga0207643_10059198 3300025908 Bacteria 2185
134 Ga0207643_10146560 3300025908 Bacteria 1413
135 Ga0207695_10146402 3300025913 Bacteria 2306
136 Ga0207695_10173196 3300025913 Bacteria 2082
137 Ga0207660_10048025 3300025917 Bacteria 3020
138 Ga0207662_10007570 3300025918 Bacteria 5914
139 Ga0207662_10008114 3300025918 Bacteria 5738
140 Ga0207649_10070312 3300025920 Bacteria 2232
141 Ga0207652_10320001 3300025921 Bacteria 1400
142 Ga0207681_10094294 3300025923 Bacteria 2144
143 Ga0207694_10195097 3300025924 Bacteria 1646
144 Ga0207650_10427810 3300025925 Bacteria 1099
145 Ga0207659_10109095 3300025926 Bacteria 2100
146 Ga0207659_10204364 3300025926 Bacteria 1579
147 Ga0207659_10367537 3300025926 Bacteria 1197
148 Ga0207659_10382030 3300025926 Bacteria 1175
149 Ga0207644_10000993 3300025931 Bacteria 18104
150 Ga0207644_10011107 3300025931 Bacteria 5948
151 Ga0207706_10031573 3300025933 Bacteria 4719
152 Ga0207706_10068833 3300025933 Bacteria 3114
153 Ga0207706_10131942 3300025933 Bacteria 2197
154 Ga0207686_10015146 3300025934 Bacteria 4306
155 Ga0207709_10070599 3300025935 Bacteria 2215
156 Ga0207670_10096845 3300025936 Unclassified 2099
157 Ga0207669_10008184 3300025937 Bacteria 4896
158 Ga0207669_10447780 3300025937 Bacteria 1022
159 Ga0207691_10072994 3300025940 Bacteria 3095
160 Ga0207711_10023066 3300025941 Bacteria 5211
161 Ga0207689_10003437 3300025942 Bacteria 14460
162 Ga0207689_10048514 3300025942 Bacteria 3502
163 Ga0207667_10152072 3300025949 Bacteria 2382
164 Ga0207651_10100389 3300025960 Bacteria 2145
165 Ga0207712_10243824 3300025961 Bacteria 1449
166 Ga0207668_10041561 3300025972 Bacteria 3109
167 Ga0207668_10096448 3300025972 Bacteria 2186
168 Ga0207668_10122287 3300025972 Bacteria 1973
169 Ga0207658_10003492 3300025986 Bacteria 11095
170 Ga0207658_10276979 3300025986 Bacteria 1436
171 Ga0207677_10046342 3300026023 Bacteria 2910
172 Ga0207703_10005337 3300026035 Bacteria 10351
173 Ga0207703_10031784 3300026035 Bacteria 4175
174 Ga0207708_10035670 3300026075 Bacteria 3785
175 Ga0207708_10074201 3300026075 Bacteria 2607
176 Ga0207702_10083265 3300026078 Bacteria 2783
177 Ga0207702_10637250 3300026078 Bacteria 1048
178 Ga0207641_10003040 3300026088 Bacteria 15114
179 Ga0207641_10033856 3300026088 Bacteria 4246
180 Ga0207641_10164486 3300026088 Bacteria 2019
181 Ga0207641_11339823 3300026088 Bacteria 716
182 Ga0207648_10015500 3300026089 Bacteria 7007
183 Ga0207648_10179728 3300026089 Bacteria 1872
184 Ga0207648_10395966 3300026089 Bacteria 1251
185 Ga0207676_10082627 3300026095 Bacteria 2613
186 Ga0207675_100080154 3300026118 Bacteria 3060
187 Ga0207675_100577578 3300026118 Bacteria 1125
188 Ga0207683_10044118 3300026121 Unclassified 3898
189 Ga0207683_10050952 3300026121 Bacteria 3627
190 Ga0207698_10373560 3300026142 Bacteria 1354
191 Ga0210002_1021320 3300027617 Bacteria 1047
192 Ga0209983_1006215 3300027665 Bacteria 2460
193 Ga0209974_10003793 3300027876 Bacteria 5416
194 Ga0268266_10095703 3300028379 Bacteria 2608
195 Ga0268265_10268616 3300028380 Bacteria 1520
196 Ga0268265_10485397 3300028380 Bacteria 1161
197 Ga0268264_10017448 3300028381 Bacteria 5878
198 Ga0268264_10018953 3300028381 Bacteria 5626
199 Ga0268264_10068715 3300028381 Bacteria 2995
200 Ga0268264_10208384 3300028381 Bacteria 1793
201 Ga0265334_10081594 3300028573 Unclassified 1190
202 Ga0265331_10012561 3300031250 Unclassified 4580
203 Ga0265327_10007525 3300031251 Bacteria 8387
204 Ga0307408_100109487 3300031548 Bacteria 2119
205 Ga0316575_10000092 3300031665 Bacteria 21797
206 Ga0316575_10015925 3300031665 Bacteria 2838
207 Ga0316575_10033330 3300031665 Bacteria 2020
208 Ga0316575_10066059 3300031665 Bacteria 1449
209 Ga0316575_10076396 3300031665 Bacteria 1348
210 Ga0316575_10177522 3300031665 Bacteria 884
211 Ga0316579_10000256 3300031691 Bacteria 16283
212 Ga0316579_10000354 3300031691 Bacteria 14402
213 Ga0316579_10027188 3300031691 Bacteria 2595
214 Ga0316576_10000101 3300031727 Bacteria 31298
215 Ga0316576_10000428 3300031727 Bacteria 19499
216 Ga0316576_10002737 3300031727 Bacteria 10103
217 Ga0316576_10003059 3300031727 Bacteria 9731
218 Ga0316576_10004588 3300031727 Bacteria 8309
219 Ga0316576_10039514 3300031727 Bacteria 3387
220 Ga0316578_10007641 3300031728 Bacteria 5440
221 Ga0316578_10024527 3300031728 Bacteria 3383
222 Ga0316578_10033875 3300031728 Bacteria 2929
223 Ga0316578_10034973 3300031728 Bacteria 2886
224 Ga0316578_10036468 3300031728 Bacteria 2830
225 Ga0316578_10243224 3300031728 Bacteria 1080
226 Ga0316578_10423663 3300031728 Bacteria 788
227 Ga0307405_10220092 3300031731 Bacteria 1392
228 Ga0316577_10000267 3300031733 Bacteria 18493
229 Ga0316577_10000361 3300031733 Bacteria 17071
230 Ga0316577_10001133 3300031733 Bacteria 12182
231 Ga0316577_10158300 3300031733 Bacteria 1277
232 Ga0316577_10166476 3300031733 Bacteria 1243
233 Ga0307412_10222645 3300031911 Bacteria 1447
234 Ga0307416_100210253 3300032002 Bacteria 1855
235 Ga0307416_100428346 3300032002 Bacteria 1369
236 Ga0307414_10557335 3300032004 Bacteria 1022
237 Ga0307415_100004607 3300032126 Bacteria 7194
238 Ga0316583_10002521 3300032133 Bacteria 6373
239 Ga0316583_10015624 3300032133 Bacteria 2732
240 Ga0316583_10062764 3300032133 Bacteria 1301
241 Ga0316585_10000020 3300032137 Bacteria 24272
242 Ga0316585_10028577 3300032137 Bacteria 1744
243 Ga0316580_10000034 3300032139 Bacteria 21707
244 Ga0316580_10000159 3300032139 Bacteria 13198
245 Ga0316580_10024665 3300032139 Bacteria 1859
246 Ga0316580_10025883 3300032139 Bacteria 1813
247 Ga0316593_10007668 3300032168 Bacteria 2972
248 Ga0316593_10030334 3300032168 Bacteria 1755
249 Ga0316593_10050292 3300032168 Bacteria 1406
250 Ga0316593_10194305 3300032168 Bacteria 749
251 Ga0316592_1000005 3300033524 Bacteria 14827
252 Ga0316592_1001761 3300033524 Bacteria 3602
253 Ga0316586_1000684 3300033527 Bacteria 3423
254 Ga0316586_1013221 3300033527 Bacteria 1289
255 Ga0316588_1005403 3300033528 Bacteria 2486
256 Ga0316588_1018203 3300033528 Bacteria 1572
257 Ga0316588_1020696 3300033528 Bacteria 1492
258 Ga0316588_1031968 3300033528 Bacteria 1236
259 Ga0316596_1002688 3300033541 Bacteria 3822
260 Ga0316596_1009117 3300033541 Bacteria 2378
261 Ga0316596_1020913 3300033541 Bacteria 1666
262 Ga0316596_1048126 3300033541 Bacteria 1126
263 Ga0316574_0000006 3300035398 Bacteria 48577
264 Ga0316574_0002032 3300035398 Bacteria 9974
265 Ga0316574_0014709 3300035398 Bacteria 4528
266 Ga0316574_0095677 3300035398 Bacteria 1898
267 Ga0316574_0121515 3300035398 Bacteria 1677
268 Ga0316574_0428533 3300035398 Bacteria 831
269 Ga0316582_0000228 3300036647 Bacteria 18493
270 Ga0316582_0009138 3300036647 Bacteria 5365
271 Ga0316582_0070367 3300036647 Bacteria 2263
272 Ga0316582_0103410 3300036647 Bacteria 1889
273 Ga0316582_0299078 3300036647 Bacteria 1105
274 Ga0316584_0000053 3300036712 Bacteria 43023
275 Ga0316584_0003931 3300036712 Bacteria 9766
276 Ga0316584_0007256 3300036712 Bacteria 7564
277 Ga0316584_0009997 3300036712 Bacteria 6609
278 Ga0316584_0016329 3300036712 Bacteria 5322
279 Ga0316584_0021122 3300036712 Bacteria 4727
280 Ga0316584_0049410 3300036712 Bacteria 3144
281 Ga0316584_0082056 3300036712 Bacteria 2415
282 Ga0316581_0004565 3300037588 Bacteria 3538
283 Ga0400484_05404 3300038725 Bacteria 2226
284 Ga0400484_06387 3300038725 Bacteria 35858
285 Ga0400484_28538 3300038725 Bacteria 3514
286 Ga0400490_00715 3300038726 Bacteria 87348
287 Ga0400490_28306 3300038726 Bacteria 18010
288 Ga0400490_50473 3300038726 Bacteria 15220
289 Ga0400491_08086 3300038727 Bacteria 6795
290 Ga0400485_15626 3300038735 Bacteria 27235
291 Ga0400485_19863 3300038735 Bacteria 101440
292 Ga0400488_16050 3300038741 Unclassified 3963
293 Ga0400488_21541 3300038741 Bacteria 8203
294 Ga0400488_46961 3300038741 Bacteria 19550
295 Ga0400486_10291 3300038742 Bacteria 28199
296 Ga0400486_13306 3300038742 Bacteria 8335
297 Ga0400486_19188 3300038742 Bacteria 196185
298 Ga0400486_31726 3300038742 Bacteria 4226
299 Ga0400483_002592 3300039062 Bacteria 32038
300 Ga0400483_008530 3300039062 Bacteria 4067
301 Ga0400483_032108 3300039062 Bacteria 16142
302 Ga0400483_095524 3300039062 Bacteria 1211
303 Ga0400483_102797 3300039062 Bacteria 11177
304 Ga0400483_164432 3300039062 Bacteria 3281
305 Ga0400483_196159 3300039062 Bacteria 15835
306 Ga0400483_200291 3300039062 Bacteria 5210
307 Ga0400487_04570 3300039110 Bacteria 4121
308 Ga0400487_35120 3300039110 Bacteria 88723
309 Ga0400487_38000 3300039110 Bacteria 182775
310 Ga0400487_57813 3300039110 Bacteria 3605
311 Ga0400487_65420 3300039110 Bacteria 8871
312 Ga0436365_0065638 3300039437 Bacteria 6864
313 Ga0439438_000005 3300041405 Bacteria 408610
314 Ga0439447_009653 3300041407 Bacteria 2909
315 Ga0439461_0021999 3300041410 Bacteria 1274
316 Ga0439432_003715 3300042006 Bacteria 5647
317 Ga0439432_135905 3300042006 Unclassified 724
318 Ga0450888_004005 3300042126 Bacteria 1521
319 Ga0439434_0131785 3300042435 Bacteria 820
320 Ga0439444_0000401 3300042437 Bacteria 4753
321 Ga0439444_0068621 3300042437 Bacteria 755
322 Ga0451577_0006343 3300042876 Bacteria 11814
323 Ga0451577_0127307 3300042876 Bacteria 2283
324 Ga0451577_0312491 3300042876 Bacteria 1424
325 Ga0451577_0973245 3300042876 Bacteria 763
326 Ga0466969_0049275 3300044656 Bacteria 2079
327 Ga0453683_0227947 3300044673 Bacteria 1185
328 Ga0453684_0000692 3300044712 Bacteria 120085
329 Ga0453684_0755607 3300044712 Bacteria 1052
330 Ga0466959_0011052 3300045049 Bacteria 6479
331 Ga0451576_0025298 3300045051 Bacteria 6397
332 Ga0451576_0229576 3300045051 Bacteria 1938
333 Ga0451576_0279232 3300045051 Bacteria 1746
334 Ga0495597_0001631 3300046542 Bacteria 15710
335 Ga0495625_0026543 3300046660 Bacteria 4376
336 Ga0495588_0028101 3300046674 Bacteria 2814
337 Ga0495672_0000020 3300047320 Bacteria 432845
338 Ga0495679_000282 3300047446 Bacteria 42194
339 Ga0495681_0139294 3300047470 Bacteria 1026
340 Ga0496101_0778317 3300048904 Bacteria 755
341 Ga0496102_0205226 3300048905 Bacteria 1858
342 Ga0496103_0066153 3300048906 Bacteria 2256
343 Ga0496107_0216009 3300048910 Bacteria 1426
344 Ga0496108_0181648 3300048911 Bacteria 1822
345 Ga0496110_0323083 3300048913 Bacteria 1406
346 Ga0496121_0005167 3300048924 Bacteria 16942
347 Ga0496125_0003124 3300048928 Bacteria 20578
348 Ga0501036_0057020 3300049572 Bacteria 3309
349 Ga0501037_0036661 3300049573 Bacteria 3613
350 Ga0501038_0000767 3300049574 Bacteria 28528
351 Ga0501038_0004640 3300049574 Bacteria 12788
352 Ga0501038_0264298 3300049574 Bacteria 1359
353 Ga0501039_0000428 3300049575 Bacteria 30396
354 Ga0501039_0011873 3300049575 Bacteria 6637
355 Ga0501039_0518461 3300049575 Bacteria 936
356 Ga0501040_0016438 3300049576 Bacteria 4898
357 Ga0501040_0091350 3300049576 Bacteria 2116
358 Ga0501041_0000067 3300049577 Bacteria 39230
359 Ga0501041_0080304 3300049577 Bacteria 2008
360 Ga0501041_0112257 3300049577 Bacteria 1691
361 Ga0501042_0002265 3300049578 Bacteria 11745
362 Ga0501042_0432049 3300049578 Bacteria 954
363 Ga0501043_0023417 3300049579 Bacteria 4844
364 Ga0501043_0294827 3300049579 Bacteria 1241
365 Ga0501046_0008309 3300049580 Bacteria 9059
366 Ga0501046_0008579 3300049580 Bacteria 8894
367 Ga0501048_0022086 3300049582 Bacteria 4656
368 Ga0501048_0571264 3300049582 Bacteria 812
369 Ga0501068_0067767 3300049584 Bacteria 2175
370 Ga0501068_0268289 3300049584 Bacteria 1089
371 Ga0501071_0001370 3300049587 Bacteria 13971
372 Ga0501071_0007224 3300049587 Bacteria 7267
373 Ga0501072_0000207 3300049588 Bacteria 42907
374 Ga0501072_0009788 3300049588 Bacteria 7288
375 Ga0501073_0157809 3300049589 Bacteria 1572
376 Ga0501073_0521266 3300049589 Bacteria 821
377 Ga0501074_0029077 3300049590 Bacteria 4003
378 Ga0501075_0004851 3300049591 Bacteria 9155
379 Ga0501075_0027462 3300049591 Bacteria 4194
380 Ga0501075_0028123 3300049591 Bacteria 4148
381 Ga0501076_0000060 3300049592 Bacteria 54005
382 Ga0501076_0009649 3300049592 Bacteria 7131
383 Ga0501077_0000072 3300049593 Bacteria 50803
384 Ga0501077_0001282 3300049593 Bacteria 15191
385 Ga0501079_0000665 3300049741 Bacteria 23026
386 Ga0501079_0010533 3300049741 Bacteria 7030
387 Ga0501079_0073132 3300049741 Bacteria 2650
388 Ga0501080_0001793 3300049742 Bacteria 18401
389 Ga0501080_0039368 3300049742 Bacteria 4412
390 Ga0501081_0000277 3300049743 Bacteria 27024
391 Ga0501081_0184582 3300049743 Bacteria 1509
392 Ga0501083_0022506 3300049744 Bacteria 4373
393 Ga0501035_0002190 3300049822 Bacteria 19394
394 Ga0501035_0023570 3300049822 Bacteria 5647
395 Ga0501044_0121312 3300049823 Bacteria 2615
396 Ga0501045_0000150 3300049824 Bacteria 37092
397 Ga0501045_0013504 3300049824 Bacteria 5769
398 Ga0501045_0083453 3300049824 Bacteria 2357
399 nmdc:mga00v17_401918_c1 3300050491 Bacteria 890
400 nmdc:mga08y16_346775_c1 3300050511 Bacteria 1526
401 nmdc:mga08y16_76593_c1 3300050511 Bacteria 3486
402 Ga0501084_0010500 3300054114 Bacteria 7656
403 Ga0501084_0058861 3300054114 Bacteria 3215
404 Ga0501082_0000505 3300060353 Bacteria 34566
405 Ga0501082_0384859 3300060353 Bacteria 1224
406 Ga0501082_0576752 3300060353 Bacteria 984
407 Ga0530510_0000570 3300061734 Bacteria 23735
408 Ga0530510_0552879 3300061734 Bacteria 874
409 2509391413 2509276021 Bacteria 7634384
410 2599723418 2599185236 Bacteria 6875203
411 2603866770 2602042109 Bacteria 5152801
412 2869553025 2869551831 Bacteria 5474685
413 2883292125 2883291878 Bacteria 5894118
414 2891672929 2891670763 Bacteria 4967099
415 8005651181 8005645114 Bacteria 6950293
416 8054853014 8054849141 Bacteria 5232694
417 Ga0439453_0006112
418 Ga0065715_10150479
419 Ga0065707_10221749
420 Ga0070658_10625989
421 Ga0070676_10004525
422 Ga0070676_10050507
423 Ga0070676_10362411
424 Ga0070690_100094807
425 Ga0070670_100100212
426 Ga0070677_10215017
427 Ga0070666_10036283
428 Ga0070680_100167193
429 Ga0070689_100062907
430 Ga0070689_100108305
431 Ga0070691_10303215
432 Ga0070687_100006214
433 Ga0070687_100075103
434 Ga0070692_10071805
435 Ga0070668_100065907
436 Ga0070668_100112534
437 Ga0070668_100145281
438 Ga0070669_100000751
439 Ga0070669_101096292
440 Ga0070675_100983541
441 Ga0070671_100002002
442 Ga0070671_100126886
443 Ga0070674_100006994
444 Ga0070674_100054832
445 Ga0070673_100081563
446 Ga0070688_100009910
447 Ga0070688_100297472
448 Ga0070688_100710568
449 Ga0070667_100002128
450 Ga0070667_100052618
451 Ga0070667_100061664
452 Ga0070701_10011449
453 Ga0070700_100034791
454 Ga0070700_100092660
455 Ga0070662_100061694
456 Ga0070662_100137766
457 Ga0070662_100140261
458 Ga0070681_10023641
459 Ga0068867_100283544
460 Ga0070685_10016916
461 Ga0070679_100125576
462 Ga0070679_100127048
463 Ga0070672_100129177
464 Ga0070686_100072472
465 Ga0070686_100223977
466 Ga0070665_101004012
467 Ga0070704_100071831
468 Ga0070704_100461230
469 Ga0068855_100048550
470 Ga0068856_101472198
471 Ga0068859_100001335
472 Ga0068859_100069468
473 Ga0068864_100165245
474 Ga0068864_100376886
475 Ga0068866_10012818
476 Ga0068866_10015698
477 Ga0068861_100104522
478 Ga0068870_10144846
479 Ga0068863_100008177
480 Ga0068858_100001317
481 Ga0068858_100388027
482 Ga0068860_100018325
483 Ga0068860_100076973
484 Ga0068860_100097170
485 Ga0068860_100350423
486 Ga0068860_100929329
487 Ga0068862_100108525
488 Ga0068862_100132228
489 Ga0097621_100398068
490 Ga0068871_100010118
491 Ga0068865_100571528
492 Ga0097620_100001335
493 Ga0097620_100069469
494 Ga0105251_10008971
495 Ga0105244_10001499
496 Ga0105244_10008832
497 Ga0105244_10043099
498 Ga0105240_10026597
499 Ga0105240_10045776
500 Ga0111539_10303953
501 Ga0111539_10478688
502 Ga0105245_10281287
503 Ga0105247_10000351
504 Ga0105247_10023832
505 Ga0105243_10035294
506 Ga0105242_10006790
507 Ga0105242_10038027
508 Ga0105248_10030814
509 Ga0105248_10280380
510 Ga0105238_10085397
511 Ga0105238_10110131
512 Ga0105249_10130636
513 Ga0105239_10023796
514 Ga0105246_10245577
515 Ga0157373_10297477
516 Ga0157371_10005283
517 Ga0157370_10307131
518 Ga0157369_10958519
519 Ga0157374_10318554
520 Ga0157378_10099556
521 Ga0157372_10068718
522 Ga0157375_10119946
523 Ga0157375_10593424
524 Ga0163163_10004130
525 Ga0163163_10072441
526 Ga0157380_10018037
527 Ga0157380_10068447
528 Ga0157380_10457775
529 Ga0157380_10615659
530 Ga0157379_10001800
531 Ga0157379_10008835
532 Ga0157379_10055820
533 Ga0157379_10301267
534 Ga0163161_10043416
535 Ga0163161_10069714
536 Ga0207697_10005605
537 Ga0207696_1001572
538 Ga0207655_1049397
539 Ga0207682_10006948
540 Ga0207682_10009896
541 Ga0207642_10073060
542 Ga0207710_10000315
543 Ga0207688_10005891
544 Ga0207680_10030578
545 Ga0207645_10037900
546 Ga0207645_10134356
547 Ga0207645_10429173
548 Ga0207643_10008054
549 Ga0207643_10059198
550 Ga0207643_10146560
551 Ga0207695_10146402
552 Ga0207695_10173196
553 Ga0207660_10048025
554 Ga0207662_10007570
555 Ga0207662_10008114
556 Ga0207649_10070312
557 Ga0207652_10320001
558 Ga0207681_10094294
559 Ga0207694_10195097
560 Ga0207650_10427810
561 Ga0207659_10109095
562 Ga0207659_10204364
563 Ga0207659_10367537
564 Ga0207659_10382030
565 Ga0207644_10000993
566 Ga0207644_10011107
567 Ga0207706_10031573
568 Ga0207706_10068833
569 Ga0207706_10131942
570 Ga0207686_10015146
571 Ga0207709_10070599
572 Ga0207670_10096845
573 Ga0207669_10008184
574 Ga0207669_10447780
575 Ga0207691_10072994
576 Ga0207711_10023066
577 Ga0207689_10003437
578 Ga0207689_10048514
579 Ga0207667_10152072
580 Ga0207651_10100389
581 Ga0207712_10243824
582 Ga0207668_10041561
583 Ga0207668_10096448
584 Ga0207668_10122287
585 Ga0207658_10003492
586 Ga0207658_10276979
587 Ga0207677_10046342
588 Ga0207703_10005337
589 Ga0207703_10031784
590 Ga0207708_10035670
591 Ga0207708_10074201
592 Ga0207702_10083265
593 Ga0207702_10637250
594 Ga0207641_10003040
595 Ga0207641_10033856
596 Ga0207641_10164486
597 Ga0207641_11339823
598 Ga0207648_10015500
599 Ga0207648_10179728
600 Ga0207648_10395966
601 Ga0207676_10082627
602 Ga0207675_100080154
603 Ga0207675_100577578
604 Ga0207683_10044118
605 Ga0207683_10050952
606 Ga0207698_10373560
607 Ga0210002_1021320
608 Ga0209983_1006215
609 Ga0209974_10003793
610 Ga0268266_10095703
611 Ga0268265_10268616
612 Ga0268265_10485397
613 Ga0268264_10017448
614 Ga0268264_10018953
615 Ga0268264_10068715
616 Ga0268264_10208384
617 Ga0265334_10081594
618 Ga0265331_10012561
619 Ga0265327_10007525
620 Ga0307408_100109487
621 Ga0316575_10000092
622 Ga0316575_10015925
623 Ga0316575_10033330
624 Ga0316575_10066059
625 Ga0316575_10076396
626 Ga0316575_10177522
627 Ga0316579_10000256
628 Ga0316579_10000354
629 Ga0316579_10027188
630 Ga0316576_10000101
631 Ga0316576_10000428
632 Ga0316576_10002737
633 Ga0316576_10003059
634 Ga0316576_10004588
635 Ga0316576_10039514
636 Ga0316578_10007641
637 Ga0316578_10024527
638 Ga0316578_10033875
639 Ga0316578_10034973
640 Ga0316578_10036468
641 Ga0316578_10243224
642 Ga0316578_10423663
643 Ga0307405_10220092
644 Ga0316577_10000267
645 Ga0316577_10000361
646 Ga0316577_10001133
647 Ga0316577_10158300
648 Ga0316577_10166476
649 Ga0307412_10222645
650 Ga0307416_100210253
651 Ga0307416_100428346
652 Ga0307414_10557335
653 Ga0307415_100004607
654 Ga0316583_10002521
655 Ga0316583_10015624
656 Ga0316583_10062764
657 Ga0316585_10000020
658 Ga0316585_10028577
659 Ga0316580_10000034
660 Ga0316580_10000159
661 Ga0316580_10024665
662 Ga0316580_10025883
663 Ga0316593_10007668
664 Ga0316593_10030334
665 Ga0316593_10050292
666 Ga0316593_10194305
667 Ga0316592_1000005
668 Ga0316592_1001761
669 Ga0316586_1000684
670 Ga0316586_1013221
671 Ga0316588_1005403
672 Ga0316588_1018203
673 Ga0316588_1020696
674 Ga0316588_1031968
675 Ga0316596_1002688
676 Ga0316596_1009117
677 Ga0316596_1020913
678 Ga0316596_1048126
679 Ga0316574_0000006
680 Ga0316574_0002032
681 Ga0316574_0014709
682 Ga0316574_0095677
683 Ga0316574_0121515
684 Ga0316574_0428533
685 Ga0316582_0000228
686 Ga0316582_0009138
687 Ga0316582_0070367
688 Ga0316582_0103410
689 Ga0316582_0299078
690 Ga0316584_0000053
691 Ga0316584_0003931
692 Ga0316584_0007256
693 Ga0316584_0009997
694 Ga0316584_0016329
695 Ga0316584_0021122
696 Ga0316584_0049410
697 Ga0316584_0082056
698 Ga0316581_0004565
699 Ga0400484_05404
700 Ga0400484_06387
701 Ga0400484_28538
702 Ga0400490_00715
703 Ga0400490_28306
704 Ga0400490_50473
705 Ga0400491_08086
706 Ga0400485_15626
707 Ga0400485_19863
708 Ga0400488_16050
709 Ga0400488_21541
710 Ga0400488_46961
711 Ga0400486_10291
712 Ga0400486_13306
713 Ga0400486_19188
714 Ga0400486_31726
715 Ga0400483_002592
716 Ga0400483_008530
717 Ga0400483_032108
718 Ga0400483_095524
719 Ga0400483_102797
720 Ga0400483_164432
721 Ga0400483_196159
722 Ga0400483_200291
723 Ga0400487_04570
724 Ga0400487_35120
725 Ga0400487_38000
726 Ga0400487_57813
727 Ga0400487_65420
728 Ga0436365_0065638
729 Ga0439438_000005
730 Ga0439447_009653
731 Ga0439461_0021999
732 Ga0439432_003715
733 Ga0439432_135905
734 Ga0450888_004005
735 Ga0439434_0131785
736 Ga0439444_0000401
737 Ga0439444_0068621
738 Ga0451577_0006343
739 Ga0451577_0127307
740 Ga0451577_0312491
741 Ga0451577_0973245
742 Ga0466969_0049275
743 Ga0453683_0227947
744 Ga0453684_0000692
745 Ga0453684_0755607
746 Ga0466959_0011052
747 Ga0451576_0025298
748 Ga0451576_0229576
749 Ga0451576_0279232
750 Ga0495597_0001631
751 Ga0495625_0026543
752 Ga0495588_0028101
753 Ga0495672_0000020
754 Ga0495679_000282
755 Ga0495681_0139294
756 Ga0496101_0778317
757 Ga0496102_0205226
758 Ga0496103_0066153
759 Ga0496107_0216009
760 Ga0496108_0181648
761 Ga0496110_0323083
762 Ga0496121_0005167
763 Ga0496125_0003124
764 Ga0501036_0057020
765 Ga0501037_0036661
766 Ga0501038_0000767
767 Ga0501038_0004640
768 Ga0501038_0264298
769 Ga0501039_0000428
770 Ga0501039_0011873
771 Ga0501039_0518461
772 Ga0501040_0016438
773 Ga0501040_0091350
774 Ga0501041_0000067
775 Ga0501041_0080304
776 Ga0501041_0112257
777 Ga0501042_0002265
778 Ga0501042_0432049
779 Ga0501043_0023417
780 Ga0501043_0294827
781 Ga0501046_0008309
782 Ga0501046_0008579
783 Ga0501048_0022086
784 Ga0501048_0571264
785 Ga0501068_0067767
786 Ga0501068_0268289
787 Ga0501071_0001370
788 Ga0501071_0007224
789 Ga0501072_0000207
790 Ga0501072_0009788
791 Ga0501073_0157809
792 Ga0501073_0521266
793 Ga0501074_0029077
794 Ga0501075_0004851
795 Ga0501075_0027462
796 Ga0501075_0028123
797 Ga0501076_0000060
798 Ga0501076_0009649
799 Ga0501077_0000072
800 Ga0501077_0001282
801 Ga0501079_0000665
802 Ga0501079_0010533
803 Ga0501079_0073132
804 Ga0501080_0001793
805 Ga0501080_0039368
806 Ga0501081_0000277
807 Ga0501081_0184582
808 Ga0501083_0022506
809 Ga0501035_0002190
810 Ga0501035_0023570
811 Ga0501044_0121312
812 Ga0501045_0000150
813 Ga0501045_0013504
814 Ga0501045_0083453
815 nmdc:mga00v17_401918_c1
816 nmdc:mga08y16_346775_c1
817 nmdc:mga08y16_76593_c1
818 Ga0501084_0010500
819 Ga0501084_0058861
820 Ga0501082_0000505
821 Ga0501082_0384859
822 Ga0501082_0576752
823 Ga0530510_0000570
824 Ga0530510_0552879
825 2509391413
826 2599723418
827 2603866770
828 2869553025
829 2883292125
830 2891672929
831 8005651181
832 8054853014

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

146

202

0.98

PF00072

Response_reg

Response regulator receiver domain

11

122

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9426 140 199
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9389 140 199
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9384 140 199
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9361 140 199
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9333 142 199
ID Description Score Start End Superfamily
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9809 144 199 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9808 144 199 1.10.10.10
af_P0DMC9_101_196_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9548 144 199 1.10.10.10
af_Q11028_1077_1158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9497 143 199 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.949 144 199 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3B0W627-F1-model_v4 Two-component transcriptional response regulator, LuxR family 0.9334 4 200 GO:0000160
GO:0003677
GO:0006355
AF-A0A2A3MTX2-F1-model_v4 DNA-binding response regulator 0.9267 1 200 GO:0000160
GO:0003677
GO:0006355
AF-A0A7V1Z6V2-F1-model_v4 Response regulator transcription factor 0.9254 1 200 GO:0000160
GO:0003677
GO:0006355
AF-A0A1E2UMK5-F1-model_v4 DNA-binding response regulator 0.9165 5 200 GO:0000160
GO:0003677
GO:0006355
AF-A0A521SJL2-F1-model_v4 deleted 0.9144 2 200

Map