F438735

General Info

Members Datasets Scaffolds Average Seq Length
416 225 832 91

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100167635|Ga0070711_1001676351
Length 100
Sequence MAGDRTALVCLAIPGQVVAIVDEENRLAKVDVAGVRRNVNVGLLDGDGGGVGPGDWVLIHVGFAISQVDEEEARATRDLLVRMGADYEQELEELKASVIE

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.97
Rhizosphere 85.1
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100167635 3300005439 Bacteria 1671
2 Ga0070683_100158587 3300005329 Bacteria 2146
3 Ga0070683_100657365 3300005329 Bacteria 1003
4 Ga0070660_100498525 3300005339 Bacteria 1013
5 Ga0070668_100054191 3300005347 Bacteria 3093
6 Ga0070668_100073377 3300005347 Bacteria 2668
7 Ga0070669_101029955 3300005353 Bacteria 707
8 Ga0070674_100015246 3300005356 Bacteria 4795
9 Ga0070659_101155476 3300005366 Bacteria 684
10 Ga0070667_100003716 3300005367 Bacteria 12962
11 Ga0070709_10366596 3300005434 Bacteria 1068
12 Ga0070714_100167185 3300005435 Bacteria 1994
13 Ga0070714_100179508 3300005435 Bacteria 1926
14 Ga0070714_100382693 3300005435 Bacteria 1327
15 Ga0070714_101037281 3300005435 Bacteria 798
16 Ga0070714_101895363 3300005435 Unclassified 582
17 Ga0070713_100014179 3300005436 Bacteria 5906
18 Ga0070713_100014953 3300005436 Bacteria 5779
19 Ga0070713_100188631 3300005436 Bacteria 1857
20 Ga0070713_100590153 3300005436 Bacteria 1055
21 Ga0070713_101011989 3300005436 Unclassified 802
22 Ga0070710_10025397 3300005437 Bacteria 3137
23 Ga0070710_10642885 3300005437 Bacteria 743
24 Ga0070710_10739067 3300005437 Bacteria 698
25 Ga0070711_100008605 3300005439 Bacteria 6258
26 Ga0070711_100031245 3300005439 Bacteria 3534
27 Ga0070711_100849211 3300005439 Bacteria 777
28 Ga0070662_100436531 3300005457 Bacteria 1085
29 Ga0070662_101257026 3300005457 Bacteria 637
30 Ga0070662_101350071 3300005457 Bacteria 614
31 Ga0068867_100469723 3300005459 Bacteria 1075
32 Ga0070685_10646406 3300005466 Bacteria 766
33 Ga0070685_10968061 3300005466 Bacteria 637
34 Ga0070679_101198276 3300005530 Bacteria 704
35 Ga0070684_100050037 3300005535 Bacteria 3628
36 Ga0070684_102296453 3300005535 Bacteria 509
37 Ga0070695_100847323 3300005545 Bacteria 735
38 Ga0070693_101005162 3300005547 Unclassified 631
39 Ga0068854_101594898 3300005578 Bacteria 595
40 Ga0068856_100955314 3300005614 Unclassified 876
41 Ga0068856_101329621 3300005614 Bacteria 734
42 Ga0070702_100223364 3300005615 Bacteria 1261
43 Ga0068852_100735642 3300005616 Bacteria 998
44 Ga0068859_101581438 3300005617 Bacteria 724
45 Ga0068861_100367034 3300005719 Bacteria 1268
46 Ga0068861_100412278 3300005719 Bacteria 1202
47 Ga0068858_100214542 3300005842 Bacteria 1822
48 Ga0068862_100005284 3300005844 Bacteria 10819
49 Ga0068862_101389698 3300005844 Bacteria 705
50 Ga0081538_10000852 3300005981 Bacteria 32907
51 Ga0081538_10016027 3300005981 Bacteria 5767
52 Ga0070717_10000621 3300006028 Bacteria 22817
53 Ga0070717_10002662 3300006028 Bacteria 12582
54 Ga0070717_10054458 3300006028 Bacteria 3299
55 Ga0070717_10141167 3300006028 Bacteria 2078
56 Ga0070717_10394914 3300006028 Bacteria 1242
57 Ga0070717_11708246 3300006028 Unclassified 570
58 Ga0075432_10006998 3300006058 Bacteria 3843
59 Ga0070715_10813757 3300006163 Bacteria 568
60 Ga0070712_100009969 3300006175 Bacteria 5988
61 Ga0070712_100085102 3300006175 Bacteria 2301
62 Ga0070712_100103502 3300006175 Bacteria 2111
63 Ga0070712_100136986 3300006175 Bacteria 1863
64 Ga0070712_100228472 3300006175 Bacteria 1477
65 Ga0070712_100352529 3300006175 Bacteria 1205
66 Ga0070712_100769298 3300006175 Bacteria 825
67 Ga0070712_101134124 3300006175 Bacteria 679
68 Ga0075428_102358712 3300006844 Bacteria 547
69 Ga0075428_102757796 3300006844 Bacteria 500
70 Ga0075430_100121092 3300006846 Bacteria 2181
71 Ga0075431_100744789 3300006847 Bacteria 956
72 Ga0075434_100580160 3300006871 Bacteria 1141
73 Ga0075434_101949140 3300006871 Bacteria 593
74 Ga0068865_100883972 3300006881 Bacteria 776
75 Ga0097620_101581499 3300006931 Bacteria 724
76 Ga0105240_11499221 3300009093 Bacteria 707
77 Ga0111539_10021532 3300009094 Bacteria 7932
78 Ga0111539_11213772 3300009094 Unclassified 876
79 Ga0111539_12430109 3300009094 Bacteria 608
80 Ga0105245_10294477 3300009098 Bacteria 1590
81 Ga0105245_10804352 3300009098 Bacteria 978
82 Ga0114129_10037523 3300009147 Bacteria 6841
83 Ga0114129_11761128 3300009147 Bacteria 754
84 Ga0105243_10009172 3300009148 Bacteria 7554
85 Ga0105243_10131205 3300009148 Bacteria 2126
86 Ga0105242_10989609 3300009176 Bacteria 848
87 Ga0105249_10005026 3300009553 Bacteria 11405
88 Ga0105249_11268349 3300009553 Bacteria 808
89 Ga0105239_10592173 3300010375 Bacteria 1264
90 Ga0105246_11015254 3300011119 Bacteria 752
91 Ga0105246_12540275 3300011119 Bacteria 505
92 Ga0157369_11635098 3300013105 Bacteria 655
93 Ga0157372_12767723 3300013307 Bacteria 562
94 Ga0157372_13070744 3300013307 Bacteria 533
95 Ga0157375_12278924 3300013308 Bacteria 646
96 Ga0163163_11689954 3300014325 Bacteria 694
97 Ga0157380_13547258 3300014326 Bacteria 500
98 Ga0157379_10015342 3300014968 Bacteria 6721
99 Ga0157376_10879476 3300014969 Bacteria 913
100 Ga0157376_12001500 3300014969 Bacteria 617
101 Ga0163161_10497833 3300017792 Bacteria 992
102 Ga0206353_10337995 3300020082 Bacteria 3082
103 Ga0213874_10004794 3300021377 Bacteria 3117
104 Ga0213874_10006346 3300021377 Bacteria 2799
105 Ga0213876_10013900 3300021384 Bacteria 4267
106 Ga0213876_10021088 3300021384 Bacteria 3445
107 Ga0213876_10162609 3300021384 Bacteria 1188
108 Ga0213875_10059048 3300021388 Bacteria 1795
109 Ga0213875_10125153 3300021388 Bacteria 1201
110 Ga0207692_10047762 3300025898 Bacteria 2151
111 Ga0207642_10233029 3300025899 Bacteria 1035
112 Ga0207693_10018704 3300025915 Bacteria 5515
113 Ga0207693_10032665 3300025915 Bacteria 4107
114 Ga0207693_10107525 3300025915 Bacteria 2188
115 Ga0207693_10208834 3300025915 Bacteria 1535
116 Ga0207693_10865594 3300025915 Bacteria 694
117 Ga0207693_10879857 3300025915 Bacteria 688
118 Ga0207663_10025200 3300025916 Bacteria 3434
119 Ga0207663_10069698 3300025916 Bacteria 2263
120 Ga0207663_10139270 3300025916 Bacteria 1688
121 Ga0207663_11048674 3300025916 Bacteria 655
122 Ga0207657_10695400 3300025919 Bacteria 790
123 Ga0207681_11034938 3300025923 Bacteria 689
124 Ga0207700_10124965 3300025928 Bacteria 2092
125 Ga0207700_10407291 3300025928 Bacteria 1193
126 Ga0207700_10896069 3300025928 Unclassified 794
127 Ga0207700_11234938 3300025928 Bacteria 667
128 Ga0207700_11856577 3300025928 Unclassified 529
129 Ga0207664_10011331 3300025929 Bacteria 6329
130 Ga0207664_10052923 3300025929 Bacteria 3212
131 Ga0207664_10346688 3300025929 Bacteria 1314
132 Ga0207664_10396759 3300025929 Bacteria 1226
133 Ga0207664_10768638 3300025929 Bacteria 866
134 Ga0207664_11109882 3300025929 Bacteria 707
135 Ga0207664_11950302 3300025929 Bacteria 510
136 Ga0207690_10956505 3300025932 Bacteria 712
137 Ga0207706_11217686 3300025933 Bacteria 625
138 Ga0207686_10068618 3300025934 Bacteria 2272
139 Ga0207686_10814030 3300025934 Bacteria 749
140 Ga0207709_10222188 3300025935 Bacteria 1363
141 Ga0207709_10364605 3300025935 Bacteria 1095
142 Ga0207669_10002270 3300025937 Bacteria 8184
143 Ga0207669_10960731 3300025937 Bacteria 716
144 Ga0207704_11759662 3300025938 Bacteria 533
145 Ga0207661_10017650 3300025944 Bacteria 5287
146 Ga0207661_11095192 3300025944 Bacteria 733
147 Ga0207679_11296273 3300025945 Bacteria 668
148 Ga0207712_10004213 3300025961 Bacteria 9075
149 Ga0207668_10008152 3300025972 Bacteria 6235
150 Ga0207668_10049991 3300025972 Bacteria 2878
151 Ga0207640_10964246 3300025981 Bacteria 748
152 Ga0207658_10006588 3300025986 Bacteria 7916
153 Ga0207703_10421999 3300026035 Bacteria 1241
154 Ga0207708_10460179 3300026075 Bacteria 1061
155 Ga0207702_10892829 3300026078 Unclassified 881
156 Ga0207648_10330272 3300026089 Bacteria 1371
157 Ga0207676_12144439 3300026095 Bacteria 557
158 Ga0207675_100222793 3300026118 Bacteria 1817
159 Ga0207675_101800477 3300026118 Bacteria 632
160 Ga0207683_10250262 3300026121 Bacteria 1617
161 Ga0268266_10098711 3300028379 Bacteria 2570
162 Ga0268265_10001165 3300028380 Bacteria 23037
163 Ga0307408_100490633 3300031548 Bacteria 1073
164 Ga0307405_10021199 3300031731 Bacteria 3648
165 Ga0307405_10924365 3300031731 Bacteria 739
166 Ga0307413_10218455 3300031824 Bacteria 1390
167 Ga0307410_10075136 3300031852 Bacteria 2355
168 Ga0307410_10591949 3300031852 Bacteria 924
169 Ga0307406_10010562 3300031901 Bacteria 5211
170 Ga0307407_10012308 3300031903 Bacteria 4107
171 Ga0307407_11621026 3300031903 Bacteria 514
172 Ga0307412_10097694 3300031911 Bacteria 2070
173 Ga0307412_10857594 3300031911 Bacteria 793
174 Ga0307409_100012092 3300031995 Bacteria 5482
175 Ga0307409_101626749 3300031995 Bacteria 674
176 Ga0307416_100006442 3300032002 Bacteria 7355
177 Ga0307416_100082313 3300032002 Bacteria 2726
178 Ga0307414_10147066 3300032004 Bacteria 1853
179 Ga0307411_10014748 3300032005 Bacteria 4361
180 Ga0307415_100002794 3300032126 Bacteria 8746
181 Ga0307415_100226346 3300032126 Bacteria 1503
182 Ga0373959_0110296 3300034820 Unclassified 663
183 Ga0373940_0323241 3300035088 Bacteria 536
184 Ga0373923_0213096 3300035111 Bacteria 896
185 Ga0373932_0011574 3300035112 Bacteria 2158
186 Ga0373932_0115446 3300035112 Bacteria 890
187 Ga0373956_0238758 3300035119 Bacteria 864
188 Ga0373960_0035788 3300035121 Bacteria 1411
189 Ga0373943_0093506 3300035170 Bacteria 1561
190 Ga0373943_0843725 3300035170 Bacteria 546
191 Ga0373942_0293466 3300035207 Bacteria 563
192 Ga0373962_0002657 3300035242 Bacteria 4249
193 Ga0373924_0094429 3300035410 Bacteria 1282
194 Ga0373931_0061355 3300035691 Bacteria 2027
195 Ga0373931_0822890 3300035691 Bacteria 620
196 Ga0373935_0035629 3300035692 Bacteria 3106
197 Ga0373927_0985471 3300035695 Bacteria 556
198 Ga0373927_1194126 3300035695 Bacteria 502
199 Ga0373933_0012879 3300035724 Bacteria 4626
200 Ga0373947_0067751 3300035725 Bacteria 2181
201 Ga0373947_0757539 3300035725 Bacteria 663
202 Ga0373937_0016845 3300036401 Bacteria 6497
203 Ga0316582_0240061 3300036647 Bacteria 1241
204 Ga0373925_0045859 3300037068 Bacteria 3248
205 Ga0436364_0272701 3300037853 Bacteria 2475
206 Ga0436364_0964127 3300037853 Bacteria 835
207 Ga0436364_1072420 3300037853 Bacteria 1033
208 Ga0436364_1369316 3300037853 Bacteria 3592
209 Ga0436364_1486047 3300037853 Bacteria 2320
210 Ga0395901_1619856 3300038443 Bacteria 600
211 Ga0436365_0325381 3300039437 Bacteria 693
212 Ga0436365_0814420 3300039437 Bacteria 4496
213 Ga0436365_0923148 3300039437 Bacteria 1573
214 Ga0436365_1172381 3300039437 Bacteria 6313
215 Ga0436365_1904524 3300039437 Bacteria 2906
216 Ga0436360_0867546 3300039438 Bacteria 666
217 Ga0436363_0269381 3300039450 Bacteria 1280
218 Ga0436363_0345784 3300039450 Bacteria 1819
219 Ga0436363_0372478 3300039450 Bacteria 1245
220 Ga0436363_0442154 3300039450 Bacteria 1446
221 Ga0436363_0481026 3300039450 Bacteria 3302
222 Ga0436363_0555449 3300039450 Bacteria 4011
223 Ga0436363_0856682 3300039450 Bacteria 686
224 Ga0436363_0951551 3300039450 Bacteria 729
225 Ga0436363_1449420 3300039450 Bacteria 835
226 Ga0436363_1562668 3300039450 Bacteria 4354
227 Ga0436362_0533875 3300039453 Bacteria 752
228 Ga0451835_0538839 3300041492 Bacteria 689
229 Ga0451853_1801080 3300041512 Bacteria 555
230 Ga0451853_3582312 3300041512 Bacteria 701
231 Ga0466966_0496659 3300044684 Bacteria 734
232 Ga0466963_0656568 3300044694 Bacteria 740
233 Ga0466971_0664732 3300044719 Bacteria 522
234 Ga0466968_0118139 3300044735 Bacteria 1198
235 Ga0466970_0492796 3300044765 Bacteria 705
236 Ga0466957_0367423 3300044842 Bacteria 979
237 Ga0466957_0453914 3300044842 Bacteria 883
238 Ga0466957_0869108 3300044842 Bacteria 643
239 Ga0466958_0110439 3300045836 Bacteria 1716
240 Ga0466967_0112327 3300045976 Bacteria 2505
241 Ga0466967_0755301 3300045976 Bacteria 965
242 Ga0466967_1036176 3300045976 Bacteria 817
243 Ga0495592_0010668 3300046454 Bacteria 6928
244 Ga0495592_0474326 3300046454 Bacteria 780
245 Ga0495603_0305755 3300046455 Bacteria 913
246 Ga0495603_0496321 3300046455 Bacteria 699
247 Ga0495629_0339479 3300046459 Bacteria 1026
248 Ga0495641_0036484 3300046461 Bacteria 2310
249 Ga0495641_0194362 3300046461 Bacteria 909
250 Ga0495641_0227736 3300046461 Bacteria 836
251 Ga0495651_0010745 3300046462 Bacteria 7039
252 Ga0495653_0008210 3300046463 Bacteria 8554
253 Ga0495653_0223426 3300046463 Bacteria 1265
254 Ga0495582_0087229 3300046473 Bacteria 1737
255 Ga0495639_0750225 3300046475 Bacteria 505
256 Ga0495662_0218170 3300046476 Bacteria 940
257 Ga0495664_0024898 3300046477 Bacteria 3481
258 Ga0495664_0320447 3300046477 Bacteria 935
259 Ga0495664_0339812 3300046477 Bacteria 905
260 Ga0495664_0482659 3300046477 Bacteria 741
261 Ga0495584_0416066 3300046491 Archaea 683
262 Ga0495584_0646217 3300046491 Bacteria 539
263 Ga0495608_0001679 3300046511 Bacteria 15904
264 Ga0495608_0709338 3300046511 Bacteria 598
265 Ga0495618_0012568 3300046514 Bacteria 5144
266 Ga0495618_0692305 3300046514 Bacteria 600
267 Ga0495618_0836573 3300046514 Bacteria 534
268 Ga0495628_0029652 3300046516 Bacteria 4434
269 Ga0495628_0046865 3300046516 Bacteria 3432
270 Ga0495630_0010832 3300046517 Bacteria 6585
271 Ga0495630_0098823 3300046517 Bacteria 2208
272 Ga0495630_0269853 3300046517 Bacteria 1300
273 Ga0495637_0043721 3300046520 Bacteria 1910
274 Ga0495643_0278197 3300046522 Bacteria 771
275 Ga0495652_0019903 3300046529 Bacteria 5969
276 Ga0495652_0347700 3300046529 Bacteria 1063
277 Ga0495665_0045222 3300046531 Bacteria 2339
278 Ga0495665_0175890 3300046531 Bacteria 1113
279 Ga0495640_0054752 3300046533 Bacteria 2731
280 Ga0495640_0086602 3300046533 Bacteria 2074
281 Ga0495640_0180068 3300046533 Bacteria 1347
282 Ga0495640_0270163 3300046533 Bacteria 1061
283 Ga0495587_0017055 3300046536 Bacteria 4516
284 Ga0495587_0313329 3300046536 Bacteria 877
285 Ga0495587_0535896 3300046536 Bacteria 646
286 Ga0495609_0171688 3300046538 Bacteria 915
287 Ga0495645_0186787 3300046543 Bacteria 1416
288 Ga0495645_0193296 3300046543 Bacteria 1385
289 Ga0495645_0890318 3300046543 Bacteria 529
290 Ga0495667_0006414 3300046559 Bacteria 7978
291 Ga0495667_0155800 3300046559 Bacteria 1470
292 Ga0495634_0077891 3300046642 Bacteria 2173
293 Ga0495635_0012787 3300046663 Bacteria 5878
294 Ga0495635_0129139 3300046663 Bacteria 1723
295 Ga0495588_0044988 3300046674 Bacteria 2262
296 Ga0495588_0372269 3300046674 Bacteria 750
297 Ga0495657_0008327 3300046675 Bacteria 7944
298 Ga0495599_0089788 3300046678 Bacteria 1918
299 Ga0495599_0191613 3300046678 Bacteria 1258
300 Ga0495623_0105657 3300046679 Bacteria 1711
301 Ga0495646_0008626 3300046680 Bacteria 6476
302 Ga0495647_0036471 3300046681 Bacteria 1851
303 Ga0495658_0057833 3300046683 Bacteria 2216
304 Ga0495658_0096066 3300046683 Bacteria 1762
305 Ga0495613_0047929 3300046689 Bacteria 3156
306 Ga0495613_0341995 3300046689 Bacteria 1029
307 Ga0495671_0481225 3300046692 Archaea 593
308 Ga0495649_0617609 3300046694 Bacteria 534
309 Ga0495589_0316246 3300046794 Unclassified 722
310 Ga0495600_0006296 3300046809 Bacteria 7213
311 Ga0495600_0172473 3300046809 Bacteria 1396
312 Ga0495600_0563947 3300046809 Bacteria 695
313 Ga0495581_0091912 3300047315 Bacteria 1761
314 Ga0495581_0429673 3300047315 Bacteria 770
315 Ga0495604_0006465 3300047317 Bacteria 9296
316 Ga0495604_0300664 3300047317 Bacteria 1078
317 Ga0495604_0540352 3300047317 Unclassified 752
318 Ga0495674_0017812 3300047319 Bacteria 6614
319 Ga0495674_0146088 3300047319 Bacteria 1985
320 Ga0495676_0004632 3300047321 Bacteria 12595
321 Ga0495676_0079394 3300047321 Bacteria 2495
322 Ga0495680_0048018 3300047322 Bacteria 3354
323 Ga0495680_0131686 3300047322 Bacteria 1837
324 Ga0495675_0312330 3300047444 Bacteria 931
325 Ga0495684_0185967 3300047471 Bacteria 1538
326 Ga0495684_0676438 3300047471 Bacteria 687
327 Ga0495593_0251814 3300047673 Bacteria 884
328 Ga0495593_0724281 3300047673 Bacteria 500
329 Ga0495602_0021913 3300048088 Bacteria 6271
330 Ga0495602_0574040 3300048088 Bacteria 779
331 Ga0495614_0068236 3300048089 Bacteria 1531
332 Ga0496104_0000037 3300048907 Bacteria 178518
333 Ga0496104_0073137 3300048907 Bacteria 3261
334 Ga0496104_0131586 3300048907 Bacteria 2403
335 Ga0496104_0478684 3300048907 Bacteria 1156
336 Ga0496105_0009413 3300048908 Bacteria 7641
337 Ga0496105_0060392 3300048908 Bacteria 3128
338 Ga0496105_0068105 3300048908 Bacteria 2940
339 Ga0496105_0107768 3300048908 Bacteria 2300
340 Ga0496107_0238458 3300048910 Bacteria 1353
341 Ga0496108_0055901 3300048911 Bacteria 3315
342 Ga0496109_0029901 3300048912 Bacteria 4882
343 Ga0496109_1390772 3300048912 Bacteria 637
344 Ga0496110_0000694 3300048913 Bacteria 23246
345 Ga0496110_0102074 3300048913 Bacteria 2572
346 Ga0496110_0490643 3300048913 Bacteria 1119
347 Ga0496110_1306759 3300048913 Bacteria 634
348 Ga0496111_0001895 3300048914 Bacteria 12391
349 Ga0496111_0141029 3300048914 Bacteria 1786
350 Ga0496111_0452275 3300048914 Bacteria 947
351 Ga0496112_0004376 3300048915 Bacteria 11956
352 Ga0496112_0358687 3300048915 Bacteria 1400
353 Ga0496113_0022379 3300048916 Bacteria 4470
354 Ga0496113_0670597 3300048916 Bacteria 829
355 Ga0496114_0306511 3300048917 Bacteria 1402
356 Ga0496114_0591871 3300048917 Bacteria 978
357 Ga0496114_1074429 3300048917 Bacteria 689
358 Ga0496115_0023572 3300048918 Bacteria 4776
359 Ga0496115_0101999 3300048918 Bacteria 2353
360 Ga0496115_0918805 3300048918 Bacteria 674
361 Ga0496119_0006705 3300048922 Bacteria 10583
362 Ga0496121_0099512 3300048924 Bacteria 2247
363 Ga0496125_0164126 3300048928 Bacteria 1504
364 Ga0501040_0625271 3300049576 Bacteria 778
365 Ga0501040_1146523 3300049576 Bacteria 564
366 Ga0501042_0416985 3300049578 Bacteria 973
367 Ga0501042_0727385 3300049578 Bacteria 722
368 Ga0501069_0652292 3300049585 Bacteria 633
369 Ga0501072_1050361 3300049588 Bacteria 634
370 Ga0501072_1331810 3300049588 Bacteria 556
371 Ga0501073_0806420 3300049589 Bacteria 647
372 Ga0501074_1086410 3300049590 Bacteria 562
373 Ga0501075_0988351 3300049591 Bacteria 639
374 Ga0501076_0559038 3300049592 Bacteria 943
375 Ga0501249_029148 3300049679 Bacteria 1227
376 Ga0501079_0585764 3300049741 Bacteria 878
377 Ga0501079_1357954 3300049741 Bacteria 559
378 Ga0501080_0743334 3300049742 Bacteria 863
379 Ga0501081_0292482 3300049743 Bacteria 1194
380 Ga0501081_0328634 3300049743 Bacteria 1125
381 Ga0501081_0777927 3300049743 Bacteria 720
382 Ga0501083_0465707 3300049744 Bacteria 823
383 Ga0501045_0312836 3300049824 Bacteria 1169
384 Ga0501045_0921822 3300049824 Bacteria 642
385 nmdc:mga05p37_117015_c1 3300050507 Bacteria 1657
386 nmdc:mga05p37_485969_c1 3300050507 Bacteria 1421
387 nmdc:mga09592_16705_c1 3300050508 Bacteria 6007
388 nmdc:mga0qj67_134696_c1 3300050509 Bacteria 2002
389 nmdc:mga0qj67_1586014_c1 3300050509 Bacteria 502
390 nmdc:mga0qj67_239520_c1 3300050509 Bacteria 1472
391 nmdc:mga0qj67_852841_c1 3300050509 Bacteria 719
392 nmdc:mga06r32_558133_c1 3300050510 Bacteria 1118
393 nmdc:mga06r32_73498_c1 3300050510 Bacteria 3313
394 nmdc:mga0n895_238706_c1 3300050512 Bacteria 1844
395 nmdc:mga0a205_33374_c1 3300050515 Bacteria 4935
396 Ga0495601_0000312 3300053077 Bacteria 25802
397 Ga0495601_0010955 3300053077 Bacteria 5414
398 Ga0495601_0357444 3300053077 Bacteria 949
399 Ga0495601_0780246 3300053077 Bacteria 607
400 Ga0495612_0041842 3300053078 Bacteria 1869
401 Ga0495612_0156102 3300053078 Bacteria 995
402 Ga0495655_0212820 3300053083 Unclassified 637
403 Ga0495595_0004006 3300053084 Bacteria 5890
404 Ga0495619_0023710 3300053085 Bacteria 3934
405 Ga0495619_0240014 3300053085 Bacteria 1256
406 Ga0495619_0366202 3300053085 Bacteria 996
407 Ga0495619_0459231 3300053085 Bacteria 877
408 Ga0501084_0314897 3300054114 Bacteria 1322
409 Ga0501084_0516506 3300054114 Bacteria 1010
410 Ga0501082_0504695 3300060353 Bacteria 1057
411 Ga0501082_1099875 3300060353 Bacteria 695
412 Ga0466962_0415518 3300061719 Bacteria 675
413 Ga0466962_0678286 3300061719 Bacteria 528
414 Ga0530510_0590980 3300061734 Bacteria 844
415 Ga0530510_0850333 3300061734 Bacteria 697
416 Ga0530510_1539725 3300061734 Bacteria 511
417 Ga0070711_100167635
418 Ga0070683_100158587
419 Ga0070683_100657365
420 Ga0070660_100498525
421 Ga0070668_100054191
422 Ga0070668_100073377
423 Ga0070669_101029955
424 Ga0070674_100015246
425 Ga0070659_101155476
426 Ga0070667_100003716
427 Ga0070709_10366596
428 Ga0070714_100167185
429 Ga0070714_100179508
430 Ga0070714_100382693
431 Ga0070714_101037281
432 Ga0070714_101895363
433 Ga0070713_100014179
434 Ga0070713_100014953
435 Ga0070713_100188631
436 Ga0070713_100590153
437 Ga0070713_101011989
438 Ga0070710_10025397
439 Ga0070710_10642885
440 Ga0070710_10739067
441 Ga0070711_100008605
442 Ga0070711_100031245
443 Ga0070711_100849211
444 Ga0070662_100436531
445 Ga0070662_101257026
446 Ga0070662_101350071
447 Ga0068867_100469723
448 Ga0070685_10646406
449 Ga0070685_10968061
450 Ga0070679_101198276
451 Ga0070684_100050037
452 Ga0070684_102296453
453 Ga0070695_100847323
454 Ga0070693_101005162
455 Ga0068854_101594898
456 Ga0068856_100955314
457 Ga0068856_101329621
458 Ga0070702_100223364
459 Ga0068852_100735642
460 Ga0068859_101581438
461 Ga0068861_100367034
462 Ga0068861_100412278
463 Ga0068858_100214542
464 Ga0068862_100005284
465 Ga0068862_101389698
466 Ga0081538_10000852
467 Ga0081538_10016027
468 Ga0070717_10000621
469 Ga0070717_10002662
470 Ga0070717_10054458
471 Ga0070717_10141167
472 Ga0070717_10394914
473 Ga0070717_11708246
474 Ga0075432_10006998
475 Ga0070715_10813757
476 Ga0070712_100009969
477 Ga0070712_100085102
478 Ga0070712_100103502
479 Ga0070712_100136986
480 Ga0070712_100228472
481 Ga0070712_100352529
482 Ga0070712_100769298
483 Ga0070712_101134124
484 Ga0075428_102358712
485 Ga0075428_102757796
486 Ga0075430_100121092
487 Ga0075431_100744789
488 Ga0075434_100580160
489 Ga0075434_101949140
490 Ga0068865_100883972
491 Ga0097620_101581499
492 Ga0105240_11499221
493 Ga0111539_10021532
494 Ga0111539_11213772
495 Ga0111539_12430109
496 Ga0105245_10294477
497 Ga0105245_10804352
498 Ga0114129_10037523
499 Ga0114129_11761128
500 Ga0105243_10009172
501 Ga0105243_10131205
502 Ga0105242_10989609
503 Ga0105249_10005026
504 Ga0105249_11268349
505 Ga0105239_10592173
506 Ga0105246_11015254
507 Ga0105246_12540275
508 Ga0157369_11635098
509 Ga0157372_12767723
510 Ga0157372_13070744
511 Ga0157375_12278924
512 Ga0163163_11689954
513 Ga0157380_13547258
514 Ga0157379_10015342
515 Ga0157376_10879476
516 Ga0157376_12001500
517 Ga0163161_10497833
518 Ga0206353_10337995
519 Ga0213874_10004794
520 Ga0213874_10006346
521 Ga0213876_10013900
522 Ga0213876_10021088
523 Ga0213876_10162609
524 Ga0213875_10059048
525 Ga0213875_10125153
526 Ga0207692_10047762
527 Ga0207642_10233029
528 Ga0207693_10018704
529 Ga0207693_10032665
530 Ga0207693_10107525
531 Ga0207693_10208834
532 Ga0207693_10865594
533 Ga0207693_10879857
534 Ga0207663_10025200
535 Ga0207663_10069698
536 Ga0207663_10139270
537 Ga0207663_11048674
538 Ga0207657_10695400
539 Ga0207681_11034938
540 Ga0207700_10124965
541 Ga0207700_10407291
542 Ga0207700_10896069
543 Ga0207700_11234938
544 Ga0207700_11856577
545 Ga0207664_10011331
546 Ga0207664_10052923
547 Ga0207664_10346688
548 Ga0207664_10396759
549 Ga0207664_10768638
550 Ga0207664_11109882
551 Ga0207664_11950302
552 Ga0207690_10956505
553 Ga0207706_11217686
554 Ga0207686_10068618
555 Ga0207686_10814030
556 Ga0207709_10222188
557 Ga0207709_10364605
558 Ga0207669_10002270
559 Ga0207669_10960731
560 Ga0207704_11759662
561 Ga0207661_10017650
562 Ga0207661_11095192
563 Ga0207679_11296273
564 Ga0207712_10004213
565 Ga0207668_10008152
566 Ga0207668_10049991
567 Ga0207640_10964246
568 Ga0207658_10006588
569 Ga0207703_10421999
570 Ga0207708_10460179
571 Ga0207702_10892829
572 Ga0207648_10330272
573 Ga0207676_12144439
574 Ga0207675_100222793
575 Ga0207675_101800477
576 Ga0207683_10250262
577 Ga0268266_10098711
578 Ga0268265_10001165
579 Ga0307408_100490633
580 Ga0307405_10021199
581 Ga0307405_10924365
582 Ga0307413_10218455
583 Ga0307410_10075136
584 Ga0307410_10591949
585 Ga0307406_10010562
586 Ga0307407_10012308
587 Ga0307407_11621026
588 Ga0307412_10097694
589 Ga0307412_10857594
590 Ga0307409_100012092
591 Ga0307409_101626749
592 Ga0307416_100006442
593 Ga0307416_100082313
594 Ga0307414_10147066
595 Ga0307411_10014748
596 Ga0307415_100002794
597 Ga0307415_100226346
598 Ga0373959_0110296
599 Ga0373940_0323241
600 Ga0373923_0213096
601 Ga0373932_0011574
602 Ga0373932_0115446
603 Ga0373956_0238758
604 Ga0373960_0035788
605 Ga0373943_0093506
606 Ga0373943_0843725
607 Ga0373942_0293466
608 Ga0373962_0002657
609 Ga0373924_0094429
610 Ga0373931_0061355
611 Ga0373931_0822890
612 Ga0373935_0035629
613 Ga0373927_0985471
614 Ga0373927_1194126
615 Ga0373933_0012879
616 Ga0373947_0067751
617 Ga0373947_0757539
618 Ga0373937_0016845
619 Ga0316582_0240061
620 Ga0373925_0045859
621 Ga0436364_0272701
622 Ga0436364_0964127
623 Ga0436364_1072420
624 Ga0436364_1369316
625 Ga0436364_1486047
626 Ga0395901_1619856
627 Ga0436365_0325381
628 Ga0436365_0814420
629 Ga0436365_0923148
630 Ga0436365_1172381
631 Ga0436365_1904524
632 Ga0436360_0867546
633 Ga0436363_0269381
634 Ga0436363_0345784
635 Ga0436363_0372478
636 Ga0436363_0442154
637 Ga0436363_0481026
638 Ga0436363_0555449
639 Ga0436363_0856682
640 Ga0436363_0951551
641 Ga0436363_1449420
642 Ga0436363_1562668
643 Ga0436362_0533875
644 Ga0451835_0538839
645 Ga0451853_1801080
646 Ga0451853_3582312
647 Ga0466966_0496659
648 Ga0466963_0656568
649 Ga0466971_0664732
650 Ga0466968_0118139
651 Ga0466970_0492796
652 Ga0466957_0367423
653 Ga0466957_0453914
654 Ga0466957_0869108
655 Ga0466958_0110439
656 Ga0466967_0112327
657 Ga0466967_0755301
658 Ga0466967_1036176
659 Ga0495592_0010668
660 Ga0495592_0474326
661 Ga0495603_0305755
662 Ga0495603_0496321
663 Ga0495629_0339479
664 Ga0495641_0036484
665 Ga0495641_0194362
666 Ga0495641_0227736
667 Ga0495651_0010745
668 Ga0495653_0008210
669 Ga0495653_0223426
670 Ga0495582_0087229
671 Ga0495639_0750225
672 Ga0495662_0218170
673 Ga0495664_0024898
674 Ga0495664_0320447
675 Ga0495664_0339812
676 Ga0495664_0482659
677 Ga0495584_0416066
678 Ga0495584_0646217
679 Ga0495608_0001679
680 Ga0495608_0709338
681 Ga0495618_0012568
682 Ga0495618_0692305
683 Ga0495618_0836573
684 Ga0495628_0029652
685 Ga0495628_0046865
686 Ga0495630_0010832
687 Ga0495630_0098823
688 Ga0495630_0269853
689 Ga0495637_0043721
690 Ga0495643_0278197
691 Ga0495652_0019903
692 Ga0495652_0347700
693 Ga0495665_0045222
694 Ga0495665_0175890
695 Ga0495640_0054752
696 Ga0495640_0086602
697 Ga0495640_0180068
698 Ga0495640_0270163
699 Ga0495587_0017055
700 Ga0495587_0313329
701 Ga0495587_0535896
702 Ga0495609_0171688
703 Ga0495645_0186787
704 Ga0495645_0193296
705 Ga0495645_0890318
706 Ga0495667_0006414
707 Ga0495667_0155800
708 Ga0495634_0077891
709 Ga0495635_0012787
710 Ga0495635_0129139
711 Ga0495588_0044988
712 Ga0495588_0372269
713 Ga0495657_0008327
714 Ga0495599_0089788
715 Ga0495599_0191613
716 Ga0495623_0105657
717 Ga0495646_0008626
718 Ga0495647_0036471
719 Ga0495658_0057833
720 Ga0495658_0096066
721 Ga0495613_0047929
722 Ga0495613_0341995
723 Ga0495671_0481225
724 Ga0495649_0617609
725 Ga0495589_0316246
726 Ga0495600_0006296
727 Ga0495600_0172473
728 Ga0495600_0563947
729 Ga0495581_0091912
730 Ga0495581_0429673
731 Ga0495604_0006465
732 Ga0495604_0300664
733 Ga0495604_0540352
734 Ga0495674_0017812
735 Ga0495674_0146088
736 Ga0495676_0004632
737 Ga0495676_0079394
738 Ga0495680_0048018
739 Ga0495680_0131686
740 Ga0495675_0312330
741 Ga0495684_0185967
742 Ga0495684_0676438
743 Ga0495593_0251814
744 Ga0495593_0724281
745 Ga0495602_0021913
746 Ga0495602_0574040
747 Ga0495614_0068236
748 Ga0496104_0000037
749 Ga0496104_0073137
750 Ga0496104_0131586
751 Ga0496104_0478684
752 Ga0496105_0009413
753 Ga0496105_0060392
754 Ga0496105_0068105
755 Ga0496105_0107768
756 Ga0496107_0238458
757 Ga0496108_0055901
758 Ga0496109_0029901
759 Ga0496109_1390772
760 Ga0496110_0000694
761 Ga0496110_0102074
762 Ga0496110_0490643
763 Ga0496110_1306759
764 Ga0496111_0001895
765 Ga0496111_0141029
766 Ga0496111_0452275
767 Ga0496112_0004376
768 Ga0496112_0358687
769 Ga0496113_0022379
770 Ga0496113_0670597
771 Ga0496114_0306511
772 Ga0496114_0591871
773 Ga0496114_1074429
774 Ga0496115_0023572
775 Ga0496115_0101999
776 Ga0496115_0918805
777 Ga0496119_0006705
778 Ga0496121_0099512
779 Ga0496125_0164126
780 Ga0501040_0625271
781 Ga0501040_1146523
782 Ga0501042_0416985
783 Ga0501042_0727385
784 Ga0501069_0652292
785 Ga0501072_1050361
786 Ga0501072_1331810
787 Ga0501073_0806420
788 Ga0501074_1086410
789 Ga0501075_0988351
790 Ga0501076_0559038
791 Ga0501249_029148
792 Ga0501079_0585764
793 Ga0501079_1357954
794 Ga0501080_0743334
795 Ga0501081_0292482
796 Ga0501081_0328634
797 Ga0501081_0777927
798 Ga0501083_0465707
799 Ga0501045_0312836
800 Ga0501045_0921822
801 nmdc:mga05p37_117015_c1
802 nmdc:mga05p37_485969_c1
803 nmdc:mga09592_16705_c1
804 nmdc:mga0qj67_134696_c1
805 nmdc:mga0qj67_1586014_c1
806 nmdc:mga0qj67_239520_c1
807 nmdc:mga0qj67_852841_c1
808 nmdc:mga06r32_558133_c1
809 nmdc:mga06r32_73498_c1
810 nmdc:mga0n895_238706_c1
811 nmdc:mga0a205_33374_c1
812 Ga0495601_0000312
813 Ga0495601_0010955
814 Ga0495601_0357444
815 Ga0495601_0780246
816 Ga0495612_0041842
817 Ga0495612_0156102
818 Ga0495655_0212820
819 Ga0495595_0004006
820 Ga0495619_0023710
821 Ga0495619_0240014
822 Ga0495619_0366202
823 Ga0495619_0459231
824 Ga0501084_0314897
825 Ga0501084_0516506
826 Ga0501082_0504695
827 Ga0501082_1099875
828 Ga0466962_0415518
829 Ga0466962_0678286
830 Ga0530510_0590980
831 Ga0530510_0850333
832 Ga0530510_1539725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01455

HupF_HypC

HupF/HypC family

9

80

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fp9-assembly2.cif.gz_E crystal structure of intern domain of proteasome-associated atpase, mycobacterium tuberculosis 0.7695 3 32
1fvi-assembly1.cif.gz_A crystal structure of chlorella virus dna ligase-adenylate 0.7621 3 32
3oc4-assembly1.cif.gz_A crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.7528 7 32
2bc0-assembly1.cif.gz_B structural analysis of streptococcus pyogenes nadh oxidase: wild-type nox 0.7466 7 32
2bcp-assembly1.cif.gz_A structural analysis of streptococcus pyogenes nadh oxidase: c44s nox with azide 0.7391 7 32
ID Description Score Start End Superfamily
af_P9WLJ5_154_236_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8592 19 31 3.10.450.40
af_G5EC16_48_111_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8393 5 32 2.30.30.140
af_Q9BVN2_843_902_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8296 7 34 2.30.30.40
af_Q68LP1_328_392_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8254 7 32 2.30.30.40
af_Q55D16_339_392_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8127 7 32 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A0F7FGX0-F1-model_v4 ABC transporter domain-containing protein 0.8431 3 54 GO:0005524
GO:0016887
GO:0022857
GO:0055052
AF-A0A5N9EER7-F1-model_v4 ATP-binding cassette domain-containing protein 0.8237 1 54 GO:0005524
GO:0016887
AF-A0A7C7PPC6-F1-model_v4 Hydrogenase assembly protein HupF 0.8208 1 58 GO:0005506
GO:0051604
GO:1902670
AF-T1C4F6-F1-model_v4 Protein belonging to Hydrogenase expression/formation protein, HupF/HypC 0.8092 1 63 GO:0005506
GO:0051604
GO:1902670
AF-A0A7C7PPC6-F1-model_v4 Hydrogenase assembly protein HupF 0.8077 1 58 GO:0005506
GO:0051604
GO:1902670

Map