F438561

General Info

Members Datasets Scaffolds Average Seq Length
415 303 830 169

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10117871|Ga0157373_101178713
Length 202
Sequence VKTSQRAELLRALVRSSIASVRHPNIEEYLVRTIFVIAAIAVAAFVGKTALADGSGDPAAVKSEDGKYMDKDGNPTFKVGADGTVDWYTYSGYRRYHSECHVCHGPDGMGSTYAPALKDSLKTMSYADFLGVVASGRKNVTSSQENVMPAFGDNPNVSCYMDDIYVYLRARANDAIGRVRPAKHEDKSDAAKKAEDSCMGNR

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
68 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
69 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
70 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
266 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
267 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
268 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
269 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
270 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
271 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
272 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
273 2906610324
274 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
275 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
276 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
277 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
278 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
279 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
280 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
281 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
282 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
283 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
284 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
285 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
286 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
287 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
288 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
289 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
290 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
291 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
292 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
293 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
294 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
295 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
296 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
297 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
298 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
299 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
300 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
301 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
302 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
303 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.78
Metatranscriptomes 6.04
Isolates 9.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 7.95
Rhizoplane 3.61
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10117871 3300013100 Bacteria 1866
2 2214757467 2209111006 Unclassified 854
3 Ga0006759J45824_1021623 3300003163 Bacteria 1015
4 JGI25406J46586_10003437 3300003203 Bacteria 7453
5 Ga0007417J51691_1026878 3300003544 Bacteria 1690
6 Ga0007409J51694_1016105 3300003575 Bacteria 4733
7 Ga0007416J51690_1020096 3300003577 Bacteria 2037
8 Ga0058863_10004760 3300004799 Bacteria 3590
9 Ga0058861_10075563 3300004800 Bacteria 2652
10 Ga0058861_11535824 3300004800 Bacteria 849
11 Ga0058861_12002901 3300004800 Bacteria 2649
12 Ga0058861_12051877 3300004800 Bacteria 1262
13 Ga0058862_10043944 3300004803 Bacteria 2832
14 Ga0058862_10249635 3300004803 Bacteria 3882
15 Ga0070658_10051975 3300005327 Bacteria 3322
16 Ga0070658_10519746 3300005327 Bacteria 1029
17 Ga0070683_100006732 3300005329 Bacteria 9651
18 Ga0070690_100607866 3300005330 Bacteria 831
19 Ga0070670_100911077 3300005331 Bacteria 797
20 Ga0070680_100002152 3300005336 Bacteria 14562
21 Ga0070680_100037613 3300005336 Bacteria 3910
22 Ga0070680_100200039 3300005336 Bacteria 1685
23 Ga0070680_100374565 3300005336 Bacteria 1212
24 Ga0070682_100032917 3300005337 Bacteria 3146
25 Ga0070682_100545175 3300005337 Archaea 907
26 Ga0068868_100117091 3300005338 Bacteria 2170
27 Ga0070660_100184922 3300005339 Bacteria 1687
28 Ga0070691_10115641 3300005341 Bacteria 1346
29 Ga0070674_100438536 3300005356 Bacteria 1075
30 Ga0070673_100437099 3300005364 Bacteria 1175
31 Ga0070673_100534086 3300005364 Bacteria 1064
32 Ga0070688_100433852 3300005365 Bacteria 979
33 Ga0070659_100023702 3300005366 Bacteria 4700
34 Ga0070659_100051435 3300005366 Bacteria 3239
35 Ga0070659_100109320 3300005366 Bacteria 2231
36 Ga0070659_101247778 3300005366 Bacteria 658
37 Ga0070667_100922254 3300005367 Bacteria 813
38 Ga0070709_10000728 3300005434 Bacteria 18607
39 Ga0070709_10542872 3300005434 Bacteria 888
40 Ga0070714_100017635 3300005435 Bacteria 5786
41 Ga0070713_100161054 3300005436 Bacteria 2003
42 Ga0070710_10003789 3300005437 Bacteria 7145
43 Ga0070711_100001618 3300005439 Bacteria 12434
44 Ga0070681_10003489 3300005458 Bacteria 14719
45 Ga0070681_10009071 3300005458 Bacteria 9776
46 Ga0070681_10035611 3300005458 Bacteria 5000
47 Ga0070681_10099290 3300005458 Bacteria 2857
48 Ga0070681_10325085 3300005458 Bacteria 1448
49 Ga0068867_100250553 3300005459 Bacteria 1440
50 Ga0070685_10300324 3300005466 Bacteria 1082
51 Ga0070679_100001782 3300005530 Bacteria 19408
52 Ga0070679_100002205 3300005530 Bacteria 17593
53 Ga0070679_100005808 3300005530 Bacteria 11449
54 Ga0070679_100007580 3300005530 Bacteria 10152
55 Ga0070679_100141257 3300005530 Bacteria 2387
56 Ga0070679_100420987 3300005530 Bacteria 1281
57 Ga0070684_100053139 3300005535 Bacteria 3525
58 Ga0070684_101309975 3300005535 Bacteria 682
59 Ga0070697_100074788 3300005536 Bacteria 2784
60 Ga0068853_100340677 3300005539 Bacteria 1393
61 Ga0068853_101014443 3300005539 Bacteria 799
62 Ga0068853_101383172 3300005539 Bacteria 680
63 Ga0070686_100040485 3300005544 Bacteria 2907
64 Ga0070695_100021706 3300005545 Bacteria 3933
65 Ga0070696_100472655 3300005546 Bacteria 993
66 Ga0068855_100012479 3300005563 Bacteria 10256
67 Ga0068855_100060000 3300005563 Bacteria 4449
68 Ga0068855_100075707 3300005563 Bacteria 3907
69 Ga0068855_100175198 3300005563 Bacteria 2427
70 Ga0068855_100811101 3300005563 Bacteria 994
71 Ga0070664_100036512 3300005564 Bacteria 4129
72 Ga0068856_100627153 3300005614 Bacteria 1096
73 Ga0070702_100060737 3300005615 Bacteria 2198
74 Ga0068852_100014101 3300005616 Bacteria 6136
75 Ga0068859_100278727 3300005617 Bacteria 1764
76 Ga0068851_10257267 3300005834 Bacteria 992
77 Ga0068863_100072793 3300005841 Bacteria 3251
78 Ga0068858_100138964 3300005842 Bacteria 2280
79 Ga0068860_100380381 3300005843 Bacteria 1393
80 Ga0081538_10026103 3300005981 Bacteria 4096
81 Ga0081540_1007003 3300005983 Bacteria 8113
82 Ga0081539_10002442 3300005985 Bacteria 26244
83 Ga0070717_10148316 3300006028 Bacteria 2028
84 Ga0070712_100072420 3300006175 Bacteria 2468
85 Ga0070712_100083615 3300006175 Bacteria 2318
86 Ga0097621_100074283 3300006237 Bacteria 2816
87 Ga0075434_100269390 3300006871 Unclassified 1722
88 Ga0068865_101311272 3300006881 Bacteria 644
89 Ga0075436_100012115 3300006914 Bacteria 5911
90 Ga0097620_100278727 3300006931 Bacteria 1764
91 Ga0099795_10016191 3300007788 Bacteria 2353
92 Ga0105240_10017780 3300009093 Bacteria 9570
93 Ga0105247_10403420 3300009101 Bacteria 975
94 Ga0105241_10018125 3300009174 Bacteria 5177
95 Ga0105241_10278480 3300009174 Bacteria 1428
96 Ga0105248_10995498 3300009177 Bacteria 947
97 Ga0105237_10142032 3300009545 Bacteria 2395
98 Ga0105237_10295641 3300009545 Bacteria 1622
99 Ga0105237_10902235 3300009545 Bacteria 891
100 Ga0105238_10304404 3300009551 Bacteria 1578
101 Ga0157336_1003491 3300012477 Unclassified 949
102 Ga0157341_1009514 3300012494 Unclassified 812
103 Ga0157319_1015968 3300012497 Unclassified 677
104 Ga0157315_1000376 3300012508 Unclassified 2016
105 Ga0157373_10492264 3300013100 Bacteria 885
106 Ga0157371_10269600 3300013102 Bacteria 1228
107 Ga0157370_10063827 3300013104 Bacteria 3487
108 Ga0157370_10072789 3300013104 Bacteria 3242
109 Ga0157369_10030500 3300013105 Bacteria 5946
110 Ga0157369_10952349 3300013105 Bacteria 880
111 Ga0163162_11570270 3300013306 Bacteria 750
112 Ga0157372_10376163 3300013307 Bacteria 1655
113 Ga0157372_10480801 3300013307 Bacteria 1448
114 Ga0163163_10030283 3300014325 Bacteria 5213
115 Ga0182008_10383594 3300014497 Bacteria 752
116 Ga0157379_10830285 3300014968 Bacteria 874
117 Ga0206356_10205825 3300020070 Bacteria 2485
118 Ga0206356_10249922 3300020070 Bacteria 2731
119 Ga0206352_11128342 3300020078 Bacteria 1726
120 Ga0206353_11911329 3300020082 Bacteria 1670
121 Ga0213871_10042218 3300021441 Bacteria 1227
122 Ga0207692_10004273 3300025898 Bacteria 5648
123 Ga0207642_10289565 3300025899 Bacteria 945
124 Ga0207647_10026721 3300025904 Bacteria 3773
125 Ga0207699_10005084 3300025906 Bacteria 6292
126 Ga0207705_10029352 3300025909 Bacteria 3920
127 Ga0207705_10132642 3300025909 Bacteria 1855
128 Ga0207654_10030942 3300025911 Bacteria 2943
129 Ga0207654_10047911 3300025911 Bacteria 2443
130 Ga0207654_10182244 3300025911 Bacteria 1371
131 Ga0207707_10000363 3300025912 Bacteria 47616
132 Ga0207707_10034870 3300025912 Bacteria 4402
133 Ga0207707_10175798 3300025912 Bacteria 1870
134 Ga0207707_10197720 3300025912 Bacteria 1753
135 Ga0207707_10276998 3300025912 Bacteria 1453
136 Ga0207695_10065095 3300025913 Bacteria 3749
137 Ga0207695_10075260 3300025913 Bacteria 3435
138 Ga0207695_10095467 3300025913 Bacteria 2977
139 Ga0207671_10179694 3300025914 Bacteria 1646
140 Ga0207693_10029067 3300025915 Bacteria 4369
141 Ga0207693_10062271 3300025915 Bacteria 2923
142 Ga0207693_10414591 3300025915 Bacteria 1053
143 Ga0207663_10001622 3300025916 Bacteria 10592
144 Ga0207663_10189285 3300025916 Bacteria 1476
145 Ga0207660_10021596 3300025917 Bacteria 4331
146 Ga0207660_10042025 3300025917 Bacteria 3207
147 Ga0207660_10102552 3300025917 Bacteria 2139
148 Ga0207662_10317563 3300025918 Unclassified 1039
149 Ga0207657_10027075 3300025919 Bacteria 5256
150 Ga0207652_10016430 3300025921 Bacteria 6044
151 Ga0207652_10022174 3300025921 Bacteria 5249
152 Ga0207652_10078570 3300025921 Bacteria 2881
153 Ga0207652_10436777 3300025921 Bacteria 1180
154 Ga0207694_10161419 3300025924 Bacteria 1810
155 Ga0207700_10049896 3300025928 Bacteria 3115
156 Ga0207664_10018496 3300025929 Bacteria 5132
157 Ga0207664_11128302 3300025929 Bacteria 700
158 Ga0207644_10259356 3300025931 Unclassified 1389
159 Ga0207690_10048752 3300025932 Bacteria 2819
160 Ga0207690_10190918 3300025932 Bacteria 1549
161 Ga0207690_10640551 3300025932 Bacteria 870
162 Ga0207706_10008946 3300025933 Bacteria 9216
163 Ga0207686_10701050 3300025934 Bacteria 805
164 Ga0207669_10707676 3300025937 Bacteria 828
165 Ga0207665_10489638 3300025939 Bacteria 949
166 Ga0207691_10621660 3300025940 Bacteria 914
167 Ga0207689_10120825 3300025942 Bacteria 2155
168 Ga0207661_10049709 3300025944 Bacteria 3338
169 Ga0207679_10614568 3300025945 Bacteria 980
170 Ga0207667_10057887 3300025949 Bacteria 4066
171 Ga0207667_10335574 3300025949 Bacteria 1543
172 Ga0207712_10102142 3300025961 Bacteria 2134
173 Ga0207668_10100506 3300025972 Bacteria 2148
174 Ga0207658_11492711 3300025986 Bacteria 618
175 Ga0207703_10320557 3300026035 Unclassified 1419
176 Ga0207703_11405300 3300026035 Bacteria 671
177 Ga0207639_10251391 3300026041 Bacteria 1542
178 Ga0207639_10915762 3300026041 Bacteria 820
179 Ga0207678_10012522 3300026067 Bacteria 7449
180 Ga0207678_10363097 3300026067 Bacteria 1250
181 Ga0207702_10686126 3300026078 Bacteria 1009
182 Ga0207702_11843176 3300026078 Bacteria 596
183 Ga0207698_10080828 3300026142 Bacteria 2621
184 Ga0265338_10929030 3300028800 Bacteria 591
185 Ga0265320_10029779 3300031240 Bacteria 2822
186 Ga0265325_10200904 3300031241 Bacteria 920
187 Ga0265329_10059973 3300031242 Bacteria 1205
188 Ga0265340_10181442 3300031247 Bacteria 951
189 Ga0265331_10100703 3300031250 Bacteria 1330
190 Ga0265316_10065441 3300031344 Bacteria 2815
191 Ga0307508_10014017 3300031616 Bacteria 7315
192 Ga0307516_10439660 3300031730 Bacteria 961
193 Ga0373959_0103435 3300034820 Bacteria 680
194 Ga0373926_0034578 3300035083 Bacteria 1789
195 Ga0373928_0029267 3300035084 Bacteria 1210
196 Ga0373934_0030894 3300035086 Bacteria 2096
197 Ga0373944_0026353 3300035089 Bacteria 1716
198 Ga0373923_0065272 3300035111 Bacteria 1553
199 Ga0373936_0024164 3300035113 Bacteria 2371
200 Ga0373945_0187220 3300035116 Unclassified 854
201 Ga0373953_0015043 3300035117 Bacteria 2795
202 Ga0373954_0021646 3300035118 Bacteria 2911
203 Ga0373954_0211400 3300035118 Bacteria 953
204 Ga0373956_0037918 3300035119 Bacteria 2131
205 Ga0373957_0012739 3300035120 Bacteria 2837
206 Ga0373957_0027993 3300035120 Bacteria 2051
207 Ga0373943_0048130 3300035170 Bacteria 2087
208 Ga0373943_0068307 3300035170 Bacteria 1794
209 Ga0373946_0290356 3300035171 Bacteria 806
210 Ga0373955_0093075 3300035172 Bacteria 1720
211 Ga0373955_0192309 3300035172 Bacteria 1213
212 Ga0373924_0356303 3300035410 Bacteria 652
213 Ga0373927_0451692 3300035695 Bacteria 849
214 Ga0373947_0185403 3300035725 Bacteria 1356
215 Ga0373947_0586458 3300035725 Bacteria 759
216 Ga0373947_0605781 3300035725 Unclassified 746
217 Ga0373937_0117213 3300036401 Bacteria 2480
218 Ga0373925_0068706 3300037068 Bacteria 2675
219 Ga0395900_1021791 3300037418 Bacteria 746
220 Ga0395905_0012215 3300037471 Bacteria 8272
221 Ga0436364_0033830 3300037853 Bacteria 700
222 Ga0436364_0676030 3300037853 Bacteria 2920
223 Ga0436364_1144367 3300037853 Bacteria 1643
224 Ga0436365_0006628 3300039437 Bacteria 3646
225 Ga0436365_0180680 3300039437 Bacteria 2256
226 Ga0436365_0317550 3300039437 Bacteria 1431
227 Ga0436365_0632248 3300039437 Bacteria 730
228 Ga0436365_1055500 3300039437 Bacteria 2010
229 Ga0436361_0719196 3300039447 Bacteria 1926
230 Ga0436363_0720333 3300039450 Bacteria 51178
231 Ga0436363_1444614 3300039450 Bacteria 1970
232 Ga0436362_0770020 3300039453 Bacteria 1103
233 Ga0451805_057048 3300041461 Bacteria 709
234 Ga0466966_0581435 3300044684 Bacteria 674
235 Ga0466964_0132017 3300044706 Bacteria 1139
236 Ga0466968_0077093 3300044735 Bacteria 1460
237 Ga0466970_0117185 3300044765 Bacteria 1457
238 Ga0466957_0109852 3300044842 Bacteria 1748
239 Ga0466959_0015438 3300045049 Bacteria 5564
240 Ga0466958_0740055 3300045836 Bacteria 641
241 Ga0495592_0099969 3300046454 Bacteria 2068
242 Ga0495603_0004705 3300046455 Bacteria 8148
243 Ga0495629_0068662 3300046459 Bacteria 2473
244 Ga0495641_0035337 3300046461 Bacteria 2357
245 Ga0495641_0117075 3300046461 Bacteria 1188
246 Ga0495651_0005630 3300046462 Bacteria 9548
247 Ga0495651_0077733 3300046462 Bacteria 2512
248 Ga0495580_0067286 3300046472 Bacteria 2506
249 Ga0495582_0005614 3300046473 Bacteria 6986
250 Ga0495639_0021830 3300046475 Bacteria 2804
251 Ga0495639_0063341 3300046475 Bacteria 1697
252 Ga0495639_0367534 3300046475 Bacteria 724
253 Ga0495664_0021350 3300046477 Unclassified 3740
254 Ga0495664_0023650 3300046477 Bacteria 3566
255 Ga0495585_0038071 3300046492 Plasmid 2708
256 Ga0495607_0022654 3300046501 Bacteria 3941
257 Ga0495608_0004974 3300046511 Bacteria 9511
258 Ga0495608_0055264 3300046511 Bacteria 2623
259 Ga0495616_0296263 3300046513 Archaea 684
260 Ga0495618_0035468 3300046514 Bacteria 3130
261 Ga0495628_0126916 3300046516 Unclassified 1954
262 Ga0495630_0141525 3300046517 Bacteria 1829
263 Ga0495630_0252586 3300046517 Bacteria 1347
264 Ga0495644_0116037 3300046523 Bacteria 1017
265 Ga0495666_0084496 3300046526 Unclassified 1499
266 Ga0495652_0097158 3300046529 Bacteria 2396
267 Ga0495665_0022641 3300046531 Bacteria 3376
268 Ga0495665_0181580 3300046531 Bacteria 1093
269 Ga0495640_0041540 3300046533 Bacteria 3213
270 Ga0495586_0156324 3300046535 Bacteria 1284
271 Ga0495586_0181797 3300046535 Bacteria 1190
272 Ga0495586_0194505 3300046535 Bacteria 1149
273 Ga0495587_0030347 3300046536 Bacteria 3279
274 Ga0495587_0073618 3300046536 Bacteria 1984
275 Ga0495587_0254571 3300046536 Bacteria 987
276 Ga0495645_0007208 3300046543 Bacteria 7737
277 Ga0495645_0062535 3300046543 Bacteria 2696
278 Ga0495622_0093515 3300046557 Unclassified 1380
279 Ga0495633_0018051 3300046558 Plasmid 3589
280 Ga0495667_0040058 3300046559 Bacteria 3112
281 Ga0495667_0209302 3300046559 Bacteria 1246
282 Ga0495667_0504993 3300046559 Bacteria 757
283 Ga0495656_0018783 3300046615 Plasmid 2661
284 Ga0495634_0036273 3300046642 Bacteria 3372
285 Ga0495634_0230192 3300046642 Unclassified 1140
286 Ga0495635_0087983 3300046663 Bacteria 2125
287 Ga0495635_0515501 3300046663 Bacteria 786
288 Ga0495659_0003087 3300046664 Bacteria 5351
289 Ga0495588_0029241 3300046674 Bacteria 2763
290 Ga0495588_0088445 3300046674 Bacteria 1621
291 Ga0495657_0055508 3300046675 Bacteria 2641
292 Ga0495623_0164434 3300046679 Bacteria 1301
293 Ga0495647_0018144 3300046681 Bacteria 2500
294 Ga0495658_0400850 3300046683 Archaea 874
295 Ga0495613_0178537 3300046689 Bacteria 1504
296 Ga0495624_0073376 3300046690 Bacteria 2127
297 Ga0495670_0126196 3300046691 Bacteria 1332
298 Ga0495600_0063908 3300046809 Bacteria 2405
299 Ga0495581_0070310 3300047315 Bacteria 2024
300 Ga0495604_0092467 3300047317 Bacteria 2240
301 Ga0495604_0579056 3300047317 Bacteria 721
302 Ga0495674_0068004 3300047319 Bacteria 3084
303 Ga0495676_0043230 3300047321 Bacteria 3691
304 Ga0495676_0048399 3300047321 Bacteria 3428
305 Ga0495676_0079603 3300047321 Bacteria 2490
306 Ga0495680_0012109 3300047322 Bacteria 7610
307 Ga0495680_0135784 3300047322 Bacteria 1804
308 Ga0495675_0488861 3300047444 Bacteria 708
309 Ga0495673_0119280 3300047469 Bacteria 1046
310 Ga0495684_0089606 3300047471 Bacteria 2330
311 Ga0495684_0282546 3300047471 Bacteria 1197
312 Ga0495593_0064972 3300047673 Bacteria 1903
313 Ga0495602_0205901 3300048088 Bacteria 1497
314 Ga0495602_0269567 3300048088 Bacteria 1259
315 Ga0495602_0338753 3300048088 Bacteria 1088
316 Ga0495614_0084814 3300048089 Bacteria 1374
317 Ga0496101_0553568 3300048904 Unclassified 909
318 Ga0496102_0443342 3300048905 Bacteria 1218
319 Ga0496104_0008745 3300048907 Bacteria 9002
320 Ga0496105_0025061 3300048908 Bacteria 4850
321 Ga0496106_0728757 3300048909 Bacteria 789
322 Ga0496107_0141755 3300048910 Bacteria 1777
323 Ga0496107_0739944 3300048910 Bacteria 722
324 Ga0496109_0010841 3300048912 Bacteria 7802
325 Ga0496110_0013858 3300048913 Bacteria 6679
326 Ga0496111_0007424 3300048914 Bacteria 7184
327 Ga0496112_0080768 3300048915 Bacteria 3215
328 Ga0496113_0007682 3300048916 Bacteria 6957
329 Ga0496114_0129737 3300048917 Bacteria 2176
330 Ga0496115_0054101 3300048918 Bacteria 3222
331 Ga0496118_0016388 3300048921 Bacteria 6802
332 Ga0496121_0032131 3300048924 Bacteria 4778
333 Ga0496121_0075648 3300048924 Bacteria 2689
334 Ga0496121_0178475 3300048924 Bacteria 1535
335 Ga0496121_0345909 3300048924 Bacteria 992
336 Ga0496122_0108277 3300048925 Bacteria 1833
337 Ga0496126_0023468 3300048929 Bacteria 5977
338 Ga0496126_0131077 3300048929 Bacteria 2166
339 Ga0496126_0167793 3300048929 Bacteria 1872
340 Ga0501031_0311766 3300049568 Bacteria 1019
341 Ga0501033_0087542 3300049570 Bacteria 2279
342 Ga0501034_0620404 3300049571 Bacteria 985
343 Ga0501036_0260560 3300049572 Bacteria 1452
344 Ga0501037_0095926 3300049573 Bacteria 2143
345 Ga0501038_0190712 3300049574 Bacteria 1649
346 Ga0501039_0499105 3300049575 Bacteria 955
347 Ga0501043_0623533 3300049579 Bacteria 794
348 Ga0501046_0033403 3300049580 Bacteria 4156
349 Ga0501047_0197476 3300049581 Bacteria 1873
350 Ga0501048_0162287 3300049582 Bacteria 1582
351 Ga0501069_0094898 3300049585 Bacteria 1689
352 Ga0501073_0035009 3300049589 Bacteria 3571
353 Ga0501074_0217752 3300049590 Bacteria 1360
354 Ga0501080_0086000 3300049742 Bacteria 2921
355 Ga0501044_0095790 3300049823 Bacteria 2990
356 Ga0501044_0553092 3300049823 Bacteria 1048
357 Ga0501045_0934226 3300049824 Bacteria 637
358 nmdc:mga08x19_486023_c1 3300050514 Bacteria 871
359 Ga0495601_0042780 3300053077 Bacteria 2843
360 Ga0495601_0103131 3300053077 Bacteria 1843
361 Ga0495612_0051885 3300053078 Bacteria 1686
362 Ga0495612_0079414 3300053078 Bacteria 1377
363 Ga0495595_0045023 3300053084 Bacteria 2028
364 Ga0495595_0045952 3300053084 Bacteria 2009
365 Ga0495619_0555923 3300053085 Bacteria 787
366 Ga0500641_0018924 3300053096 Bacteria 2597
367 Ga0500616_0005116 3300053153 Bacteria 9035
368 Ga0587066_007611 3300059490 Bacteria 1475
369 Ga0587070_010616 3300059491 Bacteria 1361
370 Ga0587073_0007366 3300059492 Bacteria 1736
371 Ga0587083_0060809 3300059505 Bacteria 851
372 Ga0587089_026203 3300059509 Bacteria 836
373 Ga0587067_101375 3300059640 Bacteria 667
374 Ga0587069_028335 3300059642 Bacteria 889
375 Ga0587075_014835 3300059644 Bacteria 1089
376 Ga0587076_115282 3300059645 Bacteria 616
377 2513672095 2513237098 Bacteria 9902361
378 2513894792 2513237141 Bacteria 8496279
379 2728753426 2728368998 Bacteria 8720350
380 2793071293 2791355197 Bacteria 8420563
381 2876763181 2876761206 Bacteria 10111113
382 2885387916 2885383462 Bacteria 9473874
383 2903749251 2903748898 Bacteria 9972761
384 2903771308 2903768456 Bacteria 9749579
385 2906611200
386 2932803813 2932801729 Bacteria 7987968
387 2935654901 2935648319 Bacteria 8801166
388 2935663829 2935656913 Bacteria 8965014
389 2935770685 2935769743 Bacteria 7878163
390 2935782918 2935777560 Bacteria 8077691
391 2935787029 2935785616 Bacteria 7962367
392 2935795077 2935793552 Bacteria 8012592
393 2935884309 2935883170 Bacteria 7964738
394 2936017985 2936011229 Bacteria 8801034
395 2936026488 2936019824 Bacteria 8804134
396 2936035105 2936028420 Bacteria 8965941
397 2936053255 2936046547 Bacteria 8903709
398 3005488682 3005483717 Bacteria 7877331
399 3005720283 3005718088 Bacteria 8283608
400 8006928481 8006926726 Bacteria 6749210
401 8006943106 8006933436 Bacteria 10410654
402 8006982901 8006973647 Bacteria 10679141
403 8016523418 8016522445 Bacteria 8156687
404 8016541188 8016539877 Bacteria 8155419
405 8016552065 8016548790 Bacteria 8155074
406 8016560443 8016557553 Bacteria 8154380
407 8016566578 8016566248 Bacteria 8158151
408 8016579322 8016575299 Bacteria 8154085
409 8016589874 8016583857 Bacteria 10421953
410 8016598345 8016595262 Bacteria 8149947
411 8016621025 8016613128 Bacteria 8794220
412 8016628981 8016622563 Bacteria 7999408
413 8019536618 8019530166 Bacteria 8155624
414 8019542843 8019538911 Bacteria 7872763
415 8019547905 8019547302 Bacteria 7996444
416 Ga0157373_10117871
417 2214757467
418 Ga0006759J45824_1021623
419 JGI25406J46586_10003437
420 Ga0007417J51691_1026878
421 Ga0007409J51694_1016105
422 Ga0007416J51690_1020096
423 Ga0058863_10004760
424 Ga0058861_10075563
425 Ga0058861_11535824
426 Ga0058861_12002901
427 Ga0058861_12051877
428 Ga0058862_10043944
429 Ga0058862_10249635
430 Ga0070658_10051975
431 Ga0070658_10519746
432 Ga0070683_100006732
433 Ga0070690_100607866
434 Ga0070670_100911077
435 Ga0070680_100002152
436 Ga0070680_100037613
437 Ga0070680_100200039
438 Ga0070680_100374565
439 Ga0070682_100032917
440 Ga0070682_100545175
441 Ga0068868_100117091
442 Ga0070660_100184922
443 Ga0070691_10115641
444 Ga0070674_100438536
445 Ga0070673_100437099
446 Ga0070673_100534086
447 Ga0070688_100433852
448 Ga0070659_100023702
449 Ga0070659_100051435
450 Ga0070659_100109320
451 Ga0070659_101247778
452 Ga0070667_100922254
453 Ga0070709_10000728
454 Ga0070709_10542872
455 Ga0070714_100017635
456 Ga0070713_100161054
457 Ga0070710_10003789
458 Ga0070711_100001618
459 Ga0070681_10003489
460 Ga0070681_10009071
461 Ga0070681_10035611
462 Ga0070681_10099290
463 Ga0070681_10325085
464 Ga0068867_100250553
465 Ga0070685_10300324
466 Ga0070679_100001782
467 Ga0070679_100002205
468 Ga0070679_100005808
469 Ga0070679_100007580
470 Ga0070679_100141257
471 Ga0070679_100420987
472 Ga0070684_100053139
473 Ga0070684_101309975
474 Ga0070697_100074788
475 Ga0068853_100340677
476 Ga0068853_101014443
477 Ga0068853_101383172
478 Ga0070686_100040485
479 Ga0070695_100021706
480 Ga0070696_100472655
481 Ga0068855_100012479
482 Ga0068855_100060000
483 Ga0068855_100075707
484 Ga0068855_100175198
485 Ga0068855_100811101
486 Ga0070664_100036512
487 Ga0068856_100627153
488 Ga0070702_100060737
489 Ga0068852_100014101
490 Ga0068859_100278727
491 Ga0068851_10257267
492 Ga0068863_100072793
493 Ga0068858_100138964
494 Ga0068860_100380381
495 Ga0081538_10026103
496 Ga0081540_1007003
497 Ga0081539_10002442
498 Ga0070717_10148316
499 Ga0070712_100072420
500 Ga0070712_100083615
501 Ga0097621_100074283
502 Ga0075434_100269390
503 Ga0068865_101311272
504 Ga0075436_100012115
505 Ga0097620_100278727
506 Ga0099795_10016191
507 Ga0105240_10017780
508 Ga0105247_10403420
509 Ga0105241_10018125
510 Ga0105241_10278480
511 Ga0105248_10995498
512 Ga0105237_10142032
513 Ga0105237_10295641
514 Ga0105237_10902235
515 Ga0105238_10304404
516 Ga0157336_1003491
517 Ga0157341_1009514
518 Ga0157319_1015968
519 Ga0157315_1000376
520 Ga0157373_10492264
521 Ga0157371_10269600
522 Ga0157370_10063827
523 Ga0157370_10072789
524 Ga0157369_10030500
525 Ga0157369_10952349
526 Ga0163162_11570270
527 Ga0157372_10376163
528 Ga0157372_10480801
529 Ga0163163_10030283
530 Ga0182008_10383594
531 Ga0157379_10830285
532 Ga0206356_10205825
533 Ga0206356_10249922
534 Ga0206352_11128342
535 Ga0206353_11911329
536 Ga0213871_10042218
537 Ga0207692_10004273
538 Ga0207642_10289565
539 Ga0207647_10026721
540 Ga0207699_10005084
541 Ga0207705_10029352
542 Ga0207705_10132642
543 Ga0207654_10030942
544 Ga0207654_10047911
545 Ga0207654_10182244
546 Ga0207707_10000363
547 Ga0207707_10034870
548 Ga0207707_10175798
549 Ga0207707_10197720
550 Ga0207707_10276998
551 Ga0207695_10065095
552 Ga0207695_10075260
553 Ga0207695_10095467
554 Ga0207671_10179694
555 Ga0207693_10029067
556 Ga0207693_10062271
557 Ga0207693_10414591
558 Ga0207663_10001622
559 Ga0207663_10189285
560 Ga0207660_10021596
561 Ga0207660_10042025
562 Ga0207660_10102552
563 Ga0207662_10317563
564 Ga0207657_10027075
565 Ga0207652_10016430
566 Ga0207652_10022174
567 Ga0207652_10078570
568 Ga0207652_10436777
569 Ga0207694_10161419
570 Ga0207700_10049896
571 Ga0207664_10018496
572 Ga0207664_11128302
573 Ga0207644_10259356
574 Ga0207690_10048752
575 Ga0207690_10190918
576 Ga0207690_10640551
577 Ga0207706_10008946
578 Ga0207686_10701050
579 Ga0207669_10707676
580 Ga0207665_10489638
581 Ga0207691_10621660
582 Ga0207689_10120825
583 Ga0207661_10049709
584 Ga0207679_10614568
585 Ga0207667_10057887
586 Ga0207667_10335574
587 Ga0207712_10102142
588 Ga0207668_10100506
589 Ga0207658_11492711
590 Ga0207703_10320557
591 Ga0207703_11405300
592 Ga0207639_10251391
593 Ga0207639_10915762
594 Ga0207678_10012522
595 Ga0207678_10363097
596 Ga0207702_10686126
597 Ga0207702_11843176
598 Ga0207698_10080828
599 Ga0265338_10929030
600 Ga0265320_10029779
601 Ga0265325_10200904
602 Ga0265329_10059973
603 Ga0265340_10181442
604 Ga0265331_10100703
605 Ga0265316_10065441
606 Ga0307508_10014017
607 Ga0307516_10439660
608 Ga0373959_0103435
609 Ga0373926_0034578
610 Ga0373928_0029267
611 Ga0373934_0030894
612 Ga0373944_0026353
613 Ga0373923_0065272
614 Ga0373936_0024164
615 Ga0373945_0187220
616 Ga0373953_0015043
617 Ga0373954_0021646
618 Ga0373954_0211400
619 Ga0373956_0037918
620 Ga0373957_0012739
621 Ga0373957_0027993
622 Ga0373943_0048130
623 Ga0373943_0068307
624 Ga0373946_0290356
625 Ga0373955_0093075
626 Ga0373955_0192309
627 Ga0373924_0356303
628 Ga0373927_0451692
629 Ga0373947_0185403
630 Ga0373947_0586458
631 Ga0373947_0605781
632 Ga0373937_0117213
633 Ga0373925_0068706
634 Ga0395900_1021791
635 Ga0395905_0012215
636 Ga0436364_0033830
637 Ga0436364_0676030
638 Ga0436364_1144367
639 Ga0436365_0006628
640 Ga0436365_0180680
641 Ga0436365_0317550
642 Ga0436365_0632248
643 Ga0436365_1055500
644 Ga0436361_0719196
645 Ga0436363_0720333
646 Ga0436363_1444614
647 Ga0436362_0770020
648 Ga0451805_057048
649 Ga0466966_0581435
650 Ga0466964_0132017
651 Ga0466968_0077093
652 Ga0466970_0117185
653 Ga0466957_0109852
654 Ga0466959_0015438
655 Ga0466958_0740055
656 Ga0495592_0099969
657 Ga0495603_0004705
658 Ga0495629_0068662
659 Ga0495641_0035337
660 Ga0495641_0117075
661 Ga0495651_0005630
662 Ga0495651_0077733
663 Ga0495580_0067286
664 Ga0495582_0005614
665 Ga0495639_0021830
666 Ga0495639_0063341
667 Ga0495639_0367534
668 Ga0495664_0021350
669 Ga0495664_0023650
670 Ga0495585_0038071
671 Ga0495607_0022654
672 Ga0495608_0004974
673 Ga0495608_0055264
674 Ga0495616_0296263
675 Ga0495618_0035468
676 Ga0495628_0126916
677 Ga0495630_0141525
678 Ga0495630_0252586
679 Ga0495644_0116037
680 Ga0495666_0084496
681 Ga0495652_0097158
682 Ga0495665_0022641
683 Ga0495665_0181580
684 Ga0495640_0041540
685 Ga0495586_0156324
686 Ga0495586_0181797
687 Ga0495586_0194505
688 Ga0495587_0030347
689 Ga0495587_0073618
690 Ga0495587_0254571
691 Ga0495645_0007208
692 Ga0495645_0062535
693 Ga0495622_0093515
694 Ga0495633_0018051
695 Ga0495667_0040058
696 Ga0495667_0209302
697 Ga0495667_0504993
698 Ga0495656_0018783
699 Ga0495634_0036273
700 Ga0495634_0230192
701 Ga0495635_0087983
702 Ga0495635_0515501
703 Ga0495659_0003087
704 Ga0495588_0029241
705 Ga0495588_0088445
706 Ga0495657_0055508
707 Ga0495623_0164434
708 Ga0495647_0018144
709 Ga0495658_0400850
710 Ga0495613_0178537
711 Ga0495624_0073376
712 Ga0495670_0126196
713 Ga0495600_0063908
714 Ga0495581_0070310
715 Ga0495604_0092467
716 Ga0495604_0579056
717 Ga0495674_0068004
718 Ga0495676_0043230
719 Ga0495676_0048399
720 Ga0495676_0079603
721 Ga0495680_0012109
722 Ga0495680_0135784
723 Ga0495675_0488861
724 Ga0495673_0119280
725 Ga0495684_0089606
726 Ga0495684_0282546
727 Ga0495593_0064972
728 Ga0495602_0205901
729 Ga0495602_0269567
730 Ga0495602_0338753
731 Ga0495614_0084814
732 Ga0496101_0553568
733 Ga0496102_0443342
734 Ga0496104_0008745
735 Ga0496105_0025061
736 Ga0496106_0728757
737 Ga0496107_0141755
738 Ga0496107_0739944
739 Ga0496109_0010841
740 Ga0496110_0013858
741 Ga0496111_0007424
742 Ga0496112_0080768
743 Ga0496113_0007682
744 Ga0496114_0129737
745 Ga0496115_0054101
746 Ga0496118_0016388
747 Ga0496121_0032131
748 Ga0496121_0075648
749 Ga0496121_0178475
750 Ga0496121_0345909
751 Ga0496122_0108277
752 Ga0496126_0023468
753 Ga0496126_0131077
754 Ga0496126_0167793
755 Ga0501031_0311766
756 Ga0501033_0087542
757 Ga0501034_0620404
758 Ga0501036_0260560
759 Ga0501037_0095926
760 Ga0501038_0190712
761 Ga0501039_0499105
762 Ga0501043_0623533
763 Ga0501046_0033403
764 Ga0501047_0197476
765 Ga0501048_0162287
766 Ga0501069_0094898
767 Ga0501073_0035009
768 Ga0501074_0217752
769 Ga0501080_0086000
770 Ga0501044_0095790
771 Ga0501044_0553092
772 Ga0501045_0934226
773 nmdc:mga08x19_486023_c1
774 Ga0495601_0042780
775 Ga0495601_0103131
776 Ga0495612_0051885
777 Ga0495612_0079414
778 Ga0495595_0045023
779 Ga0495595_0045952
780 Ga0495619_0555923
781 Ga0500641_0018924
782 Ga0500616_0005116
783 Ga0587066_007611
784 Ga0587070_010616
785 Ga0587073_0007366
786 Ga0587083_0060809
787 Ga0587089_026203
788 Ga0587067_101375
789 Ga0587069_028335
790 Ga0587075_014835
791 Ga0587076_115282
792 2513672095
793 2513894792
794 2728753426
795 2793071293
796 2876763181
797 2885387916
798 2903749251
799 2903771308
800 2906611200
801 2932803813
802 2935654901
803 2935663829
804 2935770685
805 2935782918
806 2935787029
807 2935795077
808 2935884309
809 2936017985
810 2936026488
811 2936035105
812 2936053255
813 3005488682
814 3005720283
815 8006928481
816 8006943106
817 8006982901
818 8016523418
819 8016541188
820 8016552065
821 8016560443
822 8016566578
823 8016579322
824 8016589874
825 8016598345
826 8016621025
827 8016628981
828 8019536618
829 8019542843
830 8019547905

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

89

168

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6onq-assembly1.cif.gz_A crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 0.8991 24 163
6onq-assembly1.cif.gz_A crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 0.7705 24 163
1n90-assembly1.cif.gz_A following the c heme reduction in nitrite reductase from pseudomonas aeruginosa 0.7225 52 133
1k3g-assembly1.cif.gz_A nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii 0.6998 55 135
1c75-assembly1.cif.gz_A "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" 0.6834 58 133
ID Description Score Start End Superfamily
1n15B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7285 52 133 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6998 55 135 1.10.760.10
af_I1LGG8_13_193_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.6841 31 45 2.40.160.200
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.677 55 135 1.10.760.10
1kv9A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6752 52 138 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A3M9XT89-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.9019 21 166 GO:0009055
GO:0020037
GO:0046872
AF-A0A4P7F7Y3-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.8949 21 164 GO:0009055
GO:0020037
GO:0046872
AF-A0A1L9BRS1-F1-model_v4 Cytochrome c domain-containing protein 0.8943 23 164 GO:0009055
GO:0020037
GO:0046872
AF-A0A5N7MS82-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.8934 24 164 GO:0009055
GO:0020037
AF-A0A6G9WCI7-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.891 21 164 GO:0009055
GO:0020037
GO:0046872

Map