F438561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 415 | 303 | 830 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10117871|Ga0157373_101178713 |
| Length | 202 |
| Sequence | VKTSQRAELLRALVRSSIASVRHPNIEEYLVRTIFVIAAIAVAAFVGKTALADGSGDPAAVKSEDGKYMDKDGNPTFKVGADGTVDWYTYSGYRRYHSECHVCHGPDGMGSTYAPALKDSLKTMSYADFLGVVASGRKNVTSSQENVMPAFGDNPNVSCYMDDIYVYLRARANDAIGRVRPAKHEDKSDAAKKAEDSCMGNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 68 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 69 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 70 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 83 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 132 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 141 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 154 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 155 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 156 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 159 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 266 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 267 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 268 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 269 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 270 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 271 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 272 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 273 | 2906610324 | |||
| 274 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 275 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 276 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 277 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 278 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 279 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 280 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 281 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 282 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 283 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 284 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 285 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 286 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 287 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 288 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 289 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 290 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 291 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 292 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 293 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 294 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 295 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 296 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 297 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 298 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 299 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 300 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 301 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 302 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 303 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.78 |
| Metatranscriptomes | 6.04 |
| Isolates | 9.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 7.95 |
| Rhizoplane | 3.61 |
| Rhizosphere | 81.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10117871 | 3300013100 | Bacteria | 1866 |
| 2 | 2214757467 | 2209111006 | Unclassified | 854 |
| 3 | Ga0006759J45824_1021623 | 3300003163 | Bacteria | 1015 |
| 4 | JGI25406J46586_10003437 | 3300003203 | Bacteria | 7453 |
| 5 | Ga0007417J51691_1026878 | 3300003544 | Bacteria | 1690 |
| 6 | Ga0007409J51694_1016105 | 3300003575 | Bacteria | 4733 |
| 7 | Ga0007416J51690_1020096 | 3300003577 | Bacteria | 2037 |
| 8 | Ga0058863_10004760 | 3300004799 | Bacteria | 3590 |
| 9 | Ga0058861_10075563 | 3300004800 | Bacteria | 2652 |
| 10 | Ga0058861_11535824 | 3300004800 | Bacteria | 849 |
| 11 | Ga0058861_12002901 | 3300004800 | Bacteria | 2649 |
| 12 | Ga0058861_12051877 | 3300004800 | Bacteria | 1262 |
| 13 | Ga0058862_10043944 | 3300004803 | Bacteria | 2832 |
| 14 | Ga0058862_10249635 | 3300004803 | Bacteria | 3882 |
| 15 | Ga0070658_10051975 | 3300005327 | Bacteria | 3322 |
| 16 | Ga0070658_10519746 | 3300005327 | Bacteria | 1029 |
| 17 | Ga0070683_100006732 | 3300005329 | Bacteria | 9651 |
| 18 | Ga0070690_100607866 | 3300005330 | Bacteria | 831 |
| 19 | Ga0070670_100911077 | 3300005331 | Bacteria | 797 |
| 20 | Ga0070680_100002152 | 3300005336 | Bacteria | 14562 |
| 21 | Ga0070680_100037613 | 3300005336 | Bacteria | 3910 |
| 22 | Ga0070680_100200039 | 3300005336 | Bacteria | 1685 |
| 23 | Ga0070680_100374565 | 3300005336 | Bacteria | 1212 |
| 24 | Ga0070682_100032917 | 3300005337 | Bacteria | 3146 |
| 25 | Ga0070682_100545175 | 3300005337 | Archaea | 907 |
| 26 | Ga0068868_100117091 | 3300005338 | Bacteria | 2170 |
| 27 | Ga0070660_100184922 | 3300005339 | Bacteria | 1687 |
| 28 | Ga0070691_10115641 | 3300005341 | Bacteria | 1346 |
| 29 | Ga0070674_100438536 | 3300005356 | Bacteria | 1075 |
| 30 | Ga0070673_100437099 | 3300005364 | Bacteria | 1175 |
| 31 | Ga0070673_100534086 | 3300005364 | Bacteria | 1064 |
| 32 | Ga0070688_100433852 | 3300005365 | Bacteria | 979 |
| 33 | Ga0070659_100023702 | 3300005366 | Bacteria | 4700 |
| 34 | Ga0070659_100051435 | 3300005366 | Bacteria | 3239 |
| 35 | Ga0070659_100109320 | 3300005366 | Bacteria | 2231 |
| 36 | Ga0070659_101247778 | 3300005366 | Bacteria | 658 |
| 37 | Ga0070667_100922254 | 3300005367 | Bacteria | 813 |
| 38 | Ga0070709_10000728 | 3300005434 | Bacteria | 18607 |
| 39 | Ga0070709_10542872 | 3300005434 | Bacteria | 888 |
| 40 | Ga0070714_100017635 | 3300005435 | Bacteria | 5786 |
| 41 | Ga0070713_100161054 | 3300005436 | Bacteria | 2003 |
| 42 | Ga0070710_10003789 | 3300005437 | Bacteria | 7145 |
| 43 | Ga0070711_100001618 | 3300005439 | Bacteria | 12434 |
| 44 | Ga0070681_10003489 | 3300005458 | Bacteria | 14719 |
| 45 | Ga0070681_10009071 | 3300005458 | Bacteria | 9776 |
| 46 | Ga0070681_10035611 | 3300005458 | Bacteria | 5000 |
| 47 | Ga0070681_10099290 | 3300005458 | Bacteria | 2857 |
| 48 | Ga0070681_10325085 | 3300005458 | Bacteria | 1448 |
| 49 | Ga0068867_100250553 | 3300005459 | Bacteria | 1440 |
| 50 | Ga0070685_10300324 | 3300005466 | Bacteria | 1082 |
| 51 | Ga0070679_100001782 | 3300005530 | Bacteria | 19408 |
| 52 | Ga0070679_100002205 | 3300005530 | Bacteria | 17593 |
| 53 | Ga0070679_100005808 | 3300005530 | Bacteria | 11449 |
| 54 | Ga0070679_100007580 | 3300005530 | Bacteria | 10152 |
| 55 | Ga0070679_100141257 | 3300005530 | Bacteria | 2387 |
| 56 | Ga0070679_100420987 | 3300005530 | Bacteria | 1281 |
| 57 | Ga0070684_100053139 | 3300005535 | Bacteria | 3525 |
| 58 | Ga0070684_101309975 | 3300005535 | Bacteria | 682 |
| 59 | Ga0070697_100074788 | 3300005536 | Bacteria | 2784 |
| 60 | Ga0068853_100340677 | 3300005539 | Bacteria | 1393 |
| 61 | Ga0068853_101014443 | 3300005539 | Bacteria | 799 |
| 62 | Ga0068853_101383172 | 3300005539 | Bacteria | 680 |
| 63 | Ga0070686_100040485 | 3300005544 | Bacteria | 2907 |
| 64 | Ga0070695_100021706 | 3300005545 | Bacteria | 3933 |
| 65 | Ga0070696_100472655 | 3300005546 | Bacteria | 993 |
| 66 | Ga0068855_100012479 | 3300005563 | Bacteria | 10256 |
| 67 | Ga0068855_100060000 | 3300005563 | Bacteria | 4449 |
| 68 | Ga0068855_100075707 | 3300005563 | Bacteria | 3907 |
| 69 | Ga0068855_100175198 | 3300005563 | Bacteria | 2427 |
| 70 | Ga0068855_100811101 | 3300005563 | Bacteria | 994 |
| 71 | Ga0070664_100036512 | 3300005564 | Bacteria | 4129 |
| 72 | Ga0068856_100627153 | 3300005614 | Bacteria | 1096 |
| 73 | Ga0070702_100060737 | 3300005615 | Bacteria | 2198 |
| 74 | Ga0068852_100014101 | 3300005616 | Bacteria | 6136 |
| 75 | Ga0068859_100278727 | 3300005617 | Bacteria | 1764 |
| 76 | Ga0068851_10257267 | 3300005834 | Bacteria | 992 |
| 77 | Ga0068863_100072793 | 3300005841 | Bacteria | 3251 |
| 78 | Ga0068858_100138964 | 3300005842 | Bacteria | 2280 |
| 79 | Ga0068860_100380381 | 3300005843 | Bacteria | 1393 |
| 80 | Ga0081538_10026103 | 3300005981 | Bacteria | 4096 |
| 81 | Ga0081540_1007003 | 3300005983 | Bacteria | 8113 |
| 82 | Ga0081539_10002442 | 3300005985 | Bacteria | 26244 |
| 83 | Ga0070717_10148316 | 3300006028 | Bacteria | 2028 |
| 84 | Ga0070712_100072420 | 3300006175 | Bacteria | 2468 |
| 85 | Ga0070712_100083615 | 3300006175 | Bacteria | 2318 |
| 86 | Ga0097621_100074283 | 3300006237 | Bacteria | 2816 |
| 87 | Ga0075434_100269390 | 3300006871 | Unclassified | 1722 |
| 88 | Ga0068865_101311272 | 3300006881 | Bacteria | 644 |
| 89 | Ga0075436_100012115 | 3300006914 | Bacteria | 5911 |
| 90 | Ga0097620_100278727 | 3300006931 | Bacteria | 1764 |
| 91 | Ga0099795_10016191 | 3300007788 | Bacteria | 2353 |
| 92 | Ga0105240_10017780 | 3300009093 | Bacteria | 9570 |
| 93 | Ga0105247_10403420 | 3300009101 | Bacteria | 975 |
| 94 | Ga0105241_10018125 | 3300009174 | Bacteria | 5177 |
| 95 | Ga0105241_10278480 | 3300009174 | Bacteria | 1428 |
| 96 | Ga0105248_10995498 | 3300009177 | Bacteria | 947 |
| 97 | Ga0105237_10142032 | 3300009545 | Bacteria | 2395 |
| 98 | Ga0105237_10295641 | 3300009545 | Bacteria | 1622 |
| 99 | Ga0105237_10902235 | 3300009545 | Bacteria | 891 |
| 100 | Ga0105238_10304404 | 3300009551 | Bacteria | 1578 |
| 101 | Ga0157336_1003491 | 3300012477 | Unclassified | 949 |
| 102 | Ga0157341_1009514 | 3300012494 | Unclassified | 812 |
| 103 | Ga0157319_1015968 | 3300012497 | Unclassified | 677 |
| 104 | Ga0157315_1000376 | 3300012508 | Unclassified | 2016 |
| 105 | Ga0157373_10492264 | 3300013100 | Bacteria | 885 |
| 106 | Ga0157371_10269600 | 3300013102 | Bacteria | 1228 |
| 107 | Ga0157370_10063827 | 3300013104 | Bacteria | 3487 |
| 108 | Ga0157370_10072789 | 3300013104 | Bacteria | 3242 |
| 109 | Ga0157369_10030500 | 3300013105 | Bacteria | 5946 |
| 110 | Ga0157369_10952349 | 3300013105 | Bacteria | 880 |
| 111 | Ga0163162_11570270 | 3300013306 | Bacteria | 750 |
| 112 | Ga0157372_10376163 | 3300013307 | Bacteria | 1655 |
| 113 | Ga0157372_10480801 | 3300013307 | Bacteria | 1448 |
| 114 | Ga0163163_10030283 | 3300014325 | Bacteria | 5213 |
| 115 | Ga0182008_10383594 | 3300014497 | Bacteria | 752 |
| 116 | Ga0157379_10830285 | 3300014968 | Bacteria | 874 |
| 117 | Ga0206356_10205825 | 3300020070 | Bacteria | 2485 |
| 118 | Ga0206356_10249922 | 3300020070 | Bacteria | 2731 |
| 119 | Ga0206352_11128342 | 3300020078 | Bacteria | 1726 |
| 120 | Ga0206353_11911329 | 3300020082 | Bacteria | 1670 |
| 121 | Ga0213871_10042218 | 3300021441 | Bacteria | 1227 |
| 122 | Ga0207692_10004273 | 3300025898 | Bacteria | 5648 |
| 123 | Ga0207642_10289565 | 3300025899 | Bacteria | 945 |
| 124 | Ga0207647_10026721 | 3300025904 | Bacteria | 3773 |
| 125 | Ga0207699_10005084 | 3300025906 | Bacteria | 6292 |
| 126 | Ga0207705_10029352 | 3300025909 | Bacteria | 3920 |
| 127 | Ga0207705_10132642 | 3300025909 | Bacteria | 1855 |
| 128 | Ga0207654_10030942 | 3300025911 | Bacteria | 2943 |
| 129 | Ga0207654_10047911 | 3300025911 | Bacteria | 2443 |
| 130 | Ga0207654_10182244 | 3300025911 | Bacteria | 1371 |
| 131 | Ga0207707_10000363 | 3300025912 | Bacteria | 47616 |
| 132 | Ga0207707_10034870 | 3300025912 | Bacteria | 4402 |
| 133 | Ga0207707_10175798 | 3300025912 | Bacteria | 1870 |
| 134 | Ga0207707_10197720 | 3300025912 | Bacteria | 1753 |
| 135 | Ga0207707_10276998 | 3300025912 | Bacteria | 1453 |
| 136 | Ga0207695_10065095 | 3300025913 | Bacteria | 3749 |
| 137 | Ga0207695_10075260 | 3300025913 | Bacteria | 3435 |
| 138 | Ga0207695_10095467 | 3300025913 | Bacteria | 2977 |
| 139 | Ga0207671_10179694 | 3300025914 | Bacteria | 1646 |
| 140 | Ga0207693_10029067 | 3300025915 | Bacteria | 4369 |
| 141 | Ga0207693_10062271 | 3300025915 | Bacteria | 2923 |
| 142 | Ga0207693_10414591 | 3300025915 | Bacteria | 1053 |
| 143 | Ga0207663_10001622 | 3300025916 | Bacteria | 10592 |
| 144 | Ga0207663_10189285 | 3300025916 | Bacteria | 1476 |
| 145 | Ga0207660_10021596 | 3300025917 | Bacteria | 4331 |
| 146 | Ga0207660_10042025 | 3300025917 | Bacteria | 3207 |
| 147 | Ga0207660_10102552 | 3300025917 | Bacteria | 2139 |
| 148 | Ga0207662_10317563 | 3300025918 | Unclassified | 1039 |
| 149 | Ga0207657_10027075 | 3300025919 | Bacteria | 5256 |
| 150 | Ga0207652_10016430 | 3300025921 | Bacteria | 6044 |
| 151 | Ga0207652_10022174 | 3300025921 | Bacteria | 5249 |
| 152 | Ga0207652_10078570 | 3300025921 | Bacteria | 2881 |
| 153 | Ga0207652_10436777 | 3300025921 | Bacteria | 1180 |
| 154 | Ga0207694_10161419 | 3300025924 | Bacteria | 1810 |
| 155 | Ga0207700_10049896 | 3300025928 | Bacteria | 3115 |
| 156 | Ga0207664_10018496 | 3300025929 | Bacteria | 5132 |
| 157 | Ga0207664_11128302 | 3300025929 | Bacteria | 700 |
| 158 | Ga0207644_10259356 | 3300025931 | Unclassified | 1389 |
| 159 | Ga0207690_10048752 | 3300025932 | Bacteria | 2819 |
| 160 | Ga0207690_10190918 | 3300025932 | Bacteria | 1549 |
| 161 | Ga0207690_10640551 | 3300025932 | Bacteria | 870 |
| 162 | Ga0207706_10008946 | 3300025933 | Bacteria | 9216 |
| 163 | Ga0207686_10701050 | 3300025934 | Bacteria | 805 |
| 164 | Ga0207669_10707676 | 3300025937 | Bacteria | 828 |
| 165 | Ga0207665_10489638 | 3300025939 | Bacteria | 949 |
| 166 | Ga0207691_10621660 | 3300025940 | Bacteria | 914 |
| 167 | Ga0207689_10120825 | 3300025942 | Bacteria | 2155 |
| 168 | Ga0207661_10049709 | 3300025944 | Bacteria | 3338 |
| 169 | Ga0207679_10614568 | 3300025945 | Bacteria | 980 |
| 170 | Ga0207667_10057887 | 3300025949 | Bacteria | 4066 |
| 171 | Ga0207667_10335574 | 3300025949 | Bacteria | 1543 |
| 172 | Ga0207712_10102142 | 3300025961 | Bacteria | 2134 |
| 173 | Ga0207668_10100506 | 3300025972 | Bacteria | 2148 |
| 174 | Ga0207658_11492711 | 3300025986 | Bacteria | 618 |
| 175 | Ga0207703_10320557 | 3300026035 | Unclassified | 1419 |
| 176 | Ga0207703_11405300 | 3300026035 | Bacteria | 671 |
| 177 | Ga0207639_10251391 | 3300026041 | Bacteria | 1542 |
| 178 | Ga0207639_10915762 | 3300026041 | Bacteria | 820 |
| 179 | Ga0207678_10012522 | 3300026067 | Bacteria | 7449 |
| 180 | Ga0207678_10363097 | 3300026067 | Bacteria | 1250 |
| 181 | Ga0207702_10686126 | 3300026078 | Bacteria | 1009 |
| 182 | Ga0207702_11843176 | 3300026078 | Bacteria | 596 |
| 183 | Ga0207698_10080828 | 3300026142 | Bacteria | 2621 |
| 184 | Ga0265338_10929030 | 3300028800 | Bacteria | 591 |
| 185 | Ga0265320_10029779 | 3300031240 | Bacteria | 2822 |
| 186 | Ga0265325_10200904 | 3300031241 | Bacteria | 920 |
| 187 | Ga0265329_10059973 | 3300031242 | Bacteria | 1205 |
| 188 | Ga0265340_10181442 | 3300031247 | Bacteria | 951 |
| 189 | Ga0265331_10100703 | 3300031250 | Bacteria | 1330 |
| 190 | Ga0265316_10065441 | 3300031344 | Bacteria | 2815 |
| 191 | Ga0307508_10014017 | 3300031616 | Bacteria | 7315 |
| 192 | Ga0307516_10439660 | 3300031730 | Bacteria | 961 |
| 193 | Ga0373959_0103435 | 3300034820 | Bacteria | 680 |
| 194 | Ga0373926_0034578 | 3300035083 | Bacteria | 1789 |
| 195 | Ga0373928_0029267 | 3300035084 | Bacteria | 1210 |
| 196 | Ga0373934_0030894 | 3300035086 | Bacteria | 2096 |
| 197 | Ga0373944_0026353 | 3300035089 | Bacteria | 1716 |
| 198 | Ga0373923_0065272 | 3300035111 | Bacteria | 1553 |
| 199 | Ga0373936_0024164 | 3300035113 | Bacteria | 2371 |
| 200 | Ga0373945_0187220 | 3300035116 | Unclassified | 854 |
| 201 | Ga0373953_0015043 | 3300035117 | Bacteria | 2795 |
| 202 | Ga0373954_0021646 | 3300035118 | Bacteria | 2911 |
| 203 | Ga0373954_0211400 | 3300035118 | Bacteria | 953 |
| 204 | Ga0373956_0037918 | 3300035119 | Bacteria | 2131 |
| 205 | Ga0373957_0012739 | 3300035120 | Bacteria | 2837 |
| 206 | Ga0373957_0027993 | 3300035120 | Bacteria | 2051 |
| 207 | Ga0373943_0048130 | 3300035170 | Bacteria | 2087 |
| 208 | Ga0373943_0068307 | 3300035170 | Bacteria | 1794 |
| 209 | Ga0373946_0290356 | 3300035171 | Bacteria | 806 |
| 210 | Ga0373955_0093075 | 3300035172 | Bacteria | 1720 |
| 211 | Ga0373955_0192309 | 3300035172 | Bacteria | 1213 |
| 212 | Ga0373924_0356303 | 3300035410 | Bacteria | 652 |
| 213 | Ga0373927_0451692 | 3300035695 | Bacteria | 849 |
| 214 | Ga0373947_0185403 | 3300035725 | Bacteria | 1356 |
| 215 | Ga0373947_0586458 | 3300035725 | Bacteria | 759 |
| 216 | Ga0373947_0605781 | 3300035725 | Unclassified | 746 |
| 217 | Ga0373937_0117213 | 3300036401 | Bacteria | 2480 |
| 218 | Ga0373925_0068706 | 3300037068 | Bacteria | 2675 |
| 219 | Ga0395900_1021791 | 3300037418 | Bacteria | 746 |
| 220 | Ga0395905_0012215 | 3300037471 | Bacteria | 8272 |
| 221 | Ga0436364_0033830 | 3300037853 | Bacteria | 700 |
| 222 | Ga0436364_0676030 | 3300037853 | Bacteria | 2920 |
| 223 | Ga0436364_1144367 | 3300037853 | Bacteria | 1643 |
| 224 | Ga0436365_0006628 | 3300039437 | Bacteria | 3646 |
| 225 | Ga0436365_0180680 | 3300039437 | Bacteria | 2256 |
| 226 | Ga0436365_0317550 | 3300039437 | Bacteria | 1431 |
| 227 | Ga0436365_0632248 | 3300039437 | Bacteria | 730 |
| 228 | Ga0436365_1055500 | 3300039437 | Bacteria | 2010 |
| 229 | Ga0436361_0719196 | 3300039447 | Bacteria | 1926 |
| 230 | Ga0436363_0720333 | 3300039450 | Bacteria | 51178 |
| 231 | Ga0436363_1444614 | 3300039450 | Bacteria | 1970 |
| 232 | Ga0436362_0770020 | 3300039453 | Bacteria | 1103 |
| 233 | Ga0451805_057048 | 3300041461 | Bacteria | 709 |
| 234 | Ga0466966_0581435 | 3300044684 | Bacteria | 674 |
| 235 | Ga0466964_0132017 | 3300044706 | Bacteria | 1139 |
| 236 | Ga0466968_0077093 | 3300044735 | Bacteria | 1460 |
| 237 | Ga0466970_0117185 | 3300044765 | Bacteria | 1457 |
| 238 | Ga0466957_0109852 | 3300044842 | Bacteria | 1748 |
| 239 | Ga0466959_0015438 | 3300045049 | Bacteria | 5564 |
| 240 | Ga0466958_0740055 | 3300045836 | Bacteria | 641 |
| 241 | Ga0495592_0099969 | 3300046454 | Bacteria | 2068 |
| 242 | Ga0495603_0004705 | 3300046455 | Bacteria | 8148 |
| 243 | Ga0495629_0068662 | 3300046459 | Bacteria | 2473 |
| 244 | Ga0495641_0035337 | 3300046461 | Bacteria | 2357 |
| 245 | Ga0495641_0117075 | 3300046461 | Bacteria | 1188 |
| 246 | Ga0495651_0005630 | 3300046462 | Bacteria | 9548 |
| 247 | Ga0495651_0077733 | 3300046462 | Bacteria | 2512 |
| 248 | Ga0495580_0067286 | 3300046472 | Bacteria | 2506 |
| 249 | Ga0495582_0005614 | 3300046473 | Bacteria | 6986 |
| 250 | Ga0495639_0021830 | 3300046475 | Bacteria | 2804 |
| 251 | Ga0495639_0063341 | 3300046475 | Bacteria | 1697 |
| 252 | Ga0495639_0367534 | 3300046475 | Bacteria | 724 |
| 253 | Ga0495664_0021350 | 3300046477 | Unclassified | 3740 |
| 254 | Ga0495664_0023650 | 3300046477 | Bacteria | 3566 |
| 255 | Ga0495585_0038071 | 3300046492 | Plasmid | 2708 |
| 256 | Ga0495607_0022654 | 3300046501 | Bacteria | 3941 |
| 257 | Ga0495608_0004974 | 3300046511 | Bacteria | 9511 |
| 258 | Ga0495608_0055264 | 3300046511 | Bacteria | 2623 |
| 259 | Ga0495616_0296263 | 3300046513 | Archaea | 684 |
| 260 | Ga0495618_0035468 | 3300046514 | Bacteria | 3130 |
| 261 | Ga0495628_0126916 | 3300046516 | Unclassified | 1954 |
| 262 | Ga0495630_0141525 | 3300046517 | Bacteria | 1829 |
| 263 | Ga0495630_0252586 | 3300046517 | Bacteria | 1347 |
| 264 | Ga0495644_0116037 | 3300046523 | Bacteria | 1017 |
| 265 | Ga0495666_0084496 | 3300046526 | Unclassified | 1499 |
| 266 | Ga0495652_0097158 | 3300046529 | Bacteria | 2396 |
| 267 | Ga0495665_0022641 | 3300046531 | Bacteria | 3376 |
| 268 | Ga0495665_0181580 | 3300046531 | Bacteria | 1093 |
| 269 | Ga0495640_0041540 | 3300046533 | Bacteria | 3213 |
| 270 | Ga0495586_0156324 | 3300046535 | Bacteria | 1284 |
| 271 | Ga0495586_0181797 | 3300046535 | Bacteria | 1190 |
| 272 | Ga0495586_0194505 | 3300046535 | Bacteria | 1149 |
| 273 | Ga0495587_0030347 | 3300046536 | Bacteria | 3279 |
| 274 | Ga0495587_0073618 | 3300046536 | Bacteria | 1984 |
| 275 | Ga0495587_0254571 | 3300046536 | Bacteria | 987 |
| 276 | Ga0495645_0007208 | 3300046543 | Bacteria | 7737 |
| 277 | Ga0495645_0062535 | 3300046543 | Bacteria | 2696 |
| 278 | Ga0495622_0093515 | 3300046557 | Unclassified | 1380 |
| 279 | Ga0495633_0018051 | 3300046558 | Plasmid | 3589 |
| 280 | Ga0495667_0040058 | 3300046559 | Bacteria | 3112 |
| 281 | Ga0495667_0209302 | 3300046559 | Bacteria | 1246 |
| 282 | Ga0495667_0504993 | 3300046559 | Bacteria | 757 |
| 283 | Ga0495656_0018783 | 3300046615 | Plasmid | 2661 |
| 284 | Ga0495634_0036273 | 3300046642 | Bacteria | 3372 |
| 285 | Ga0495634_0230192 | 3300046642 | Unclassified | 1140 |
| 286 | Ga0495635_0087983 | 3300046663 | Bacteria | 2125 |
| 287 | Ga0495635_0515501 | 3300046663 | Bacteria | 786 |
| 288 | Ga0495659_0003087 | 3300046664 | Bacteria | 5351 |
| 289 | Ga0495588_0029241 | 3300046674 | Bacteria | 2763 |
| 290 | Ga0495588_0088445 | 3300046674 | Bacteria | 1621 |
| 291 | Ga0495657_0055508 | 3300046675 | Bacteria | 2641 |
| 292 | Ga0495623_0164434 | 3300046679 | Bacteria | 1301 |
| 293 | Ga0495647_0018144 | 3300046681 | Bacteria | 2500 |
| 294 | Ga0495658_0400850 | 3300046683 | Archaea | 874 |
| 295 | Ga0495613_0178537 | 3300046689 | Bacteria | 1504 |
| 296 | Ga0495624_0073376 | 3300046690 | Bacteria | 2127 |
| 297 | Ga0495670_0126196 | 3300046691 | Bacteria | 1332 |
| 298 | Ga0495600_0063908 | 3300046809 | Bacteria | 2405 |
| 299 | Ga0495581_0070310 | 3300047315 | Bacteria | 2024 |
| 300 | Ga0495604_0092467 | 3300047317 | Bacteria | 2240 |
| 301 | Ga0495604_0579056 | 3300047317 | Bacteria | 721 |
| 302 | Ga0495674_0068004 | 3300047319 | Bacteria | 3084 |
| 303 | Ga0495676_0043230 | 3300047321 | Bacteria | 3691 |
| 304 | Ga0495676_0048399 | 3300047321 | Bacteria | 3428 |
| 305 | Ga0495676_0079603 | 3300047321 | Bacteria | 2490 |
| 306 | Ga0495680_0012109 | 3300047322 | Bacteria | 7610 |
| 307 | Ga0495680_0135784 | 3300047322 | Bacteria | 1804 |
| 308 | Ga0495675_0488861 | 3300047444 | Bacteria | 708 |
| 309 | Ga0495673_0119280 | 3300047469 | Bacteria | 1046 |
| 310 | Ga0495684_0089606 | 3300047471 | Bacteria | 2330 |
| 311 | Ga0495684_0282546 | 3300047471 | Bacteria | 1197 |
| 312 | Ga0495593_0064972 | 3300047673 | Bacteria | 1903 |
| 313 | Ga0495602_0205901 | 3300048088 | Bacteria | 1497 |
| 314 | Ga0495602_0269567 | 3300048088 | Bacteria | 1259 |
| 315 | Ga0495602_0338753 | 3300048088 | Bacteria | 1088 |
| 316 | Ga0495614_0084814 | 3300048089 | Bacteria | 1374 |
| 317 | Ga0496101_0553568 | 3300048904 | Unclassified | 909 |
| 318 | Ga0496102_0443342 | 3300048905 | Bacteria | 1218 |
| 319 | Ga0496104_0008745 | 3300048907 | Bacteria | 9002 |
| 320 | Ga0496105_0025061 | 3300048908 | Bacteria | 4850 |
| 321 | Ga0496106_0728757 | 3300048909 | Bacteria | 789 |
| 322 | Ga0496107_0141755 | 3300048910 | Bacteria | 1777 |
| 323 | Ga0496107_0739944 | 3300048910 | Bacteria | 722 |
| 324 | Ga0496109_0010841 | 3300048912 | Bacteria | 7802 |
| 325 | Ga0496110_0013858 | 3300048913 | Bacteria | 6679 |
| 326 | Ga0496111_0007424 | 3300048914 | Bacteria | 7184 |
| 327 | Ga0496112_0080768 | 3300048915 | Bacteria | 3215 |
| 328 | Ga0496113_0007682 | 3300048916 | Bacteria | 6957 |
| 329 | Ga0496114_0129737 | 3300048917 | Bacteria | 2176 |
| 330 | Ga0496115_0054101 | 3300048918 | Bacteria | 3222 |
| 331 | Ga0496118_0016388 | 3300048921 | Bacteria | 6802 |
| 332 | Ga0496121_0032131 | 3300048924 | Bacteria | 4778 |
| 333 | Ga0496121_0075648 | 3300048924 | Bacteria | 2689 |
| 334 | Ga0496121_0178475 | 3300048924 | Bacteria | 1535 |
| 335 | Ga0496121_0345909 | 3300048924 | Bacteria | 992 |
| 336 | Ga0496122_0108277 | 3300048925 | Bacteria | 1833 |
| 337 | Ga0496126_0023468 | 3300048929 | Bacteria | 5977 |
| 338 | Ga0496126_0131077 | 3300048929 | Bacteria | 2166 |
| 339 | Ga0496126_0167793 | 3300048929 | Bacteria | 1872 |
| 340 | Ga0501031_0311766 | 3300049568 | Bacteria | 1019 |
| 341 | Ga0501033_0087542 | 3300049570 | Bacteria | 2279 |
| 342 | Ga0501034_0620404 | 3300049571 | Bacteria | 985 |
| 343 | Ga0501036_0260560 | 3300049572 | Bacteria | 1452 |
| 344 | Ga0501037_0095926 | 3300049573 | Bacteria | 2143 |
| 345 | Ga0501038_0190712 | 3300049574 | Bacteria | 1649 |
| 346 | Ga0501039_0499105 | 3300049575 | Bacteria | 955 |
| 347 | Ga0501043_0623533 | 3300049579 | Bacteria | 794 |
| 348 | Ga0501046_0033403 | 3300049580 | Bacteria | 4156 |
| 349 | Ga0501047_0197476 | 3300049581 | Bacteria | 1873 |
| 350 | Ga0501048_0162287 | 3300049582 | Bacteria | 1582 |
| 351 | Ga0501069_0094898 | 3300049585 | Bacteria | 1689 |
| 352 | Ga0501073_0035009 | 3300049589 | Bacteria | 3571 |
| 353 | Ga0501074_0217752 | 3300049590 | Bacteria | 1360 |
| 354 | Ga0501080_0086000 | 3300049742 | Bacteria | 2921 |
| 355 | Ga0501044_0095790 | 3300049823 | Bacteria | 2990 |
| 356 | Ga0501044_0553092 | 3300049823 | Bacteria | 1048 |
| 357 | Ga0501045_0934226 | 3300049824 | Bacteria | 637 |
| 358 | nmdc:mga08x19_486023_c1 | 3300050514 | Bacteria | 871 |
| 359 | Ga0495601_0042780 | 3300053077 | Bacteria | 2843 |
| 360 | Ga0495601_0103131 | 3300053077 | Bacteria | 1843 |
| 361 | Ga0495612_0051885 | 3300053078 | Bacteria | 1686 |
| 362 | Ga0495612_0079414 | 3300053078 | Bacteria | 1377 |
| 363 | Ga0495595_0045023 | 3300053084 | Bacteria | 2028 |
| 364 | Ga0495595_0045952 | 3300053084 | Bacteria | 2009 |
| 365 | Ga0495619_0555923 | 3300053085 | Bacteria | 787 |
| 366 | Ga0500641_0018924 | 3300053096 | Bacteria | 2597 |
| 367 | Ga0500616_0005116 | 3300053153 | Bacteria | 9035 |
| 368 | Ga0587066_007611 | 3300059490 | Bacteria | 1475 |
| 369 | Ga0587070_010616 | 3300059491 | Bacteria | 1361 |
| 370 | Ga0587073_0007366 | 3300059492 | Bacteria | 1736 |
| 371 | Ga0587083_0060809 | 3300059505 | Bacteria | 851 |
| 372 | Ga0587089_026203 | 3300059509 | Bacteria | 836 |
| 373 | Ga0587067_101375 | 3300059640 | Bacteria | 667 |
| 374 | Ga0587069_028335 | 3300059642 | Bacteria | 889 |
| 375 | Ga0587075_014835 | 3300059644 | Bacteria | 1089 |
| 376 | Ga0587076_115282 | 3300059645 | Bacteria | 616 |
| 377 | 2513672095 | 2513237098 | Bacteria | 9902361 |
| 378 | 2513894792 | 2513237141 | Bacteria | 8496279 |
| 379 | 2728753426 | 2728368998 | Bacteria | 8720350 |
| 380 | 2793071293 | 2791355197 | Bacteria | 8420563 |
| 381 | 2876763181 | 2876761206 | Bacteria | 10111113 |
| 382 | 2885387916 | 2885383462 | Bacteria | 9473874 |
| 383 | 2903749251 | 2903748898 | Bacteria | 9972761 |
| 384 | 2903771308 | 2903768456 | Bacteria | 9749579 |
| 385 | 2906611200 | |||
| 386 | 2932803813 | 2932801729 | Bacteria | 7987968 |
| 387 | 2935654901 | 2935648319 | Bacteria | 8801166 |
| 388 | 2935663829 | 2935656913 | Bacteria | 8965014 |
| 389 | 2935770685 | 2935769743 | Bacteria | 7878163 |
| 390 | 2935782918 | 2935777560 | Bacteria | 8077691 |
| 391 | 2935787029 | 2935785616 | Bacteria | 7962367 |
| 392 | 2935795077 | 2935793552 | Bacteria | 8012592 |
| 393 | 2935884309 | 2935883170 | Bacteria | 7964738 |
| 394 | 2936017985 | 2936011229 | Bacteria | 8801034 |
| 395 | 2936026488 | 2936019824 | Bacteria | 8804134 |
| 396 | 2936035105 | 2936028420 | Bacteria | 8965941 |
| 397 | 2936053255 | 2936046547 | Bacteria | 8903709 |
| 398 | 3005488682 | 3005483717 | Bacteria | 7877331 |
| 399 | 3005720283 | 3005718088 | Bacteria | 8283608 |
| 400 | 8006928481 | 8006926726 | Bacteria | 6749210 |
| 401 | 8006943106 | 8006933436 | Bacteria | 10410654 |
| 402 | 8006982901 | 8006973647 | Bacteria | 10679141 |
| 403 | 8016523418 | 8016522445 | Bacteria | 8156687 |
| 404 | 8016541188 | 8016539877 | Bacteria | 8155419 |
| 405 | 8016552065 | 8016548790 | Bacteria | 8155074 |
| 406 | 8016560443 | 8016557553 | Bacteria | 8154380 |
| 407 | 8016566578 | 8016566248 | Bacteria | 8158151 |
| 408 | 8016579322 | 8016575299 | Bacteria | 8154085 |
| 409 | 8016589874 | 8016583857 | Bacteria | 10421953 |
| 410 | 8016598345 | 8016595262 | Bacteria | 8149947 |
| 411 | 8016621025 | 8016613128 | Bacteria | 8794220 |
| 412 | 8016628981 | 8016622563 | Bacteria | 7999408 |
| 413 | 8019536618 | 8019530166 | Bacteria | 8155624 |
| 414 | 8019542843 | 8019538911 | Bacteria | 7872763 |
| 415 | 8019547905 | 8019547302 | Bacteria | 7996444 |
| 416 | Ga0157373_10117871 | |||
| 417 | 2214757467 | |||
| 418 | Ga0006759J45824_1021623 | |||
| 419 | JGI25406J46586_10003437 | |||
| 420 | Ga0007417J51691_1026878 | |||
| 421 | Ga0007409J51694_1016105 | |||
| 422 | Ga0007416J51690_1020096 | |||
| 423 | Ga0058863_10004760 | |||
| 424 | Ga0058861_10075563 | |||
| 425 | Ga0058861_11535824 | |||
| 426 | Ga0058861_12002901 | |||
| 427 | Ga0058861_12051877 | |||
| 428 | Ga0058862_10043944 | |||
| 429 | Ga0058862_10249635 | |||
| 430 | Ga0070658_10051975 | |||
| 431 | Ga0070658_10519746 | |||
| 432 | Ga0070683_100006732 | |||
| 433 | Ga0070690_100607866 | |||
| 434 | Ga0070670_100911077 | |||
| 435 | Ga0070680_100002152 | |||
| 436 | Ga0070680_100037613 | |||
| 437 | Ga0070680_100200039 | |||
| 438 | Ga0070680_100374565 | |||
| 439 | Ga0070682_100032917 | |||
| 440 | Ga0070682_100545175 | |||
| 441 | Ga0068868_100117091 | |||
| 442 | Ga0070660_100184922 | |||
| 443 | Ga0070691_10115641 | |||
| 444 | Ga0070674_100438536 | |||
| 445 | Ga0070673_100437099 | |||
| 446 | Ga0070673_100534086 | |||
| 447 | Ga0070688_100433852 | |||
| 448 | Ga0070659_100023702 | |||
| 449 | Ga0070659_100051435 | |||
| 450 | Ga0070659_100109320 | |||
| 451 | Ga0070659_101247778 | |||
| 452 | Ga0070667_100922254 | |||
| 453 | Ga0070709_10000728 | |||
| 454 | Ga0070709_10542872 | |||
| 455 | Ga0070714_100017635 | |||
| 456 | Ga0070713_100161054 | |||
| 457 | Ga0070710_10003789 | |||
| 458 | Ga0070711_100001618 | |||
| 459 | Ga0070681_10003489 | |||
| 460 | Ga0070681_10009071 | |||
| 461 | Ga0070681_10035611 | |||
| 462 | Ga0070681_10099290 | |||
| 463 | Ga0070681_10325085 | |||
| 464 | Ga0068867_100250553 | |||
| 465 | Ga0070685_10300324 | |||
| 466 | Ga0070679_100001782 | |||
| 467 | Ga0070679_100002205 | |||
| 468 | Ga0070679_100005808 | |||
| 469 | Ga0070679_100007580 | |||
| 470 | Ga0070679_100141257 | |||
| 471 | Ga0070679_100420987 | |||
| 472 | Ga0070684_100053139 | |||
| 473 | Ga0070684_101309975 | |||
| 474 | Ga0070697_100074788 | |||
| 475 | Ga0068853_100340677 | |||
| 476 | Ga0068853_101014443 | |||
| 477 | Ga0068853_101383172 | |||
| 478 | Ga0070686_100040485 | |||
| 479 | Ga0070695_100021706 | |||
| 480 | Ga0070696_100472655 | |||
| 481 | Ga0068855_100012479 | |||
| 482 | Ga0068855_100060000 | |||
| 483 | Ga0068855_100075707 | |||
| 484 | Ga0068855_100175198 | |||
| 485 | Ga0068855_100811101 | |||
| 486 | Ga0070664_100036512 | |||
| 487 | Ga0068856_100627153 | |||
| 488 | Ga0070702_100060737 | |||
| 489 | Ga0068852_100014101 | |||
| 490 | Ga0068859_100278727 | |||
| 491 | Ga0068851_10257267 | |||
| 492 | Ga0068863_100072793 | |||
| 493 | Ga0068858_100138964 | |||
| 494 | Ga0068860_100380381 | |||
| 495 | Ga0081538_10026103 | |||
| 496 | Ga0081540_1007003 | |||
| 497 | Ga0081539_10002442 | |||
| 498 | Ga0070717_10148316 | |||
| 499 | Ga0070712_100072420 | |||
| 500 | Ga0070712_100083615 | |||
| 501 | Ga0097621_100074283 | |||
| 502 | Ga0075434_100269390 | |||
| 503 | Ga0068865_101311272 | |||
| 504 | Ga0075436_100012115 | |||
| 505 | Ga0097620_100278727 | |||
| 506 | Ga0099795_10016191 | |||
| 507 | Ga0105240_10017780 | |||
| 508 | Ga0105247_10403420 | |||
| 509 | Ga0105241_10018125 | |||
| 510 | Ga0105241_10278480 | |||
| 511 | Ga0105248_10995498 | |||
| 512 | Ga0105237_10142032 | |||
| 513 | Ga0105237_10295641 | |||
| 514 | Ga0105237_10902235 | |||
| 515 | Ga0105238_10304404 | |||
| 516 | Ga0157336_1003491 | |||
| 517 | Ga0157341_1009514 | |||
| 518 | Ga0157319_1015968 | |||
| 519 | Ga0157315_1000376 | |||
| 520 | Ga0157373_10492264 | |||
| 521 | Ga0157371_10269600 | |||
| 522 | Ga0157370_10063827 | |||
| 523 | Ga0157370_10072789 | |||
| 524 | Ga0157369_10030500 | |||
| 525 | Ga0157369_10952349 | |||
| 526 | Ga0163162_11570270 | |||
| 527 | Ga0157372_10376163 | |||
| 528 | Ga0157372_10480801 | |||
| 529 | Ga0163163_10030283 | |||
| 530 | Ga0182008_10383594 | |||
| 531 | Ga0157379_10830285 | |||
| 532 | Ga0206356_10205825 | |||
| 533 | Ga0206356_10249922 | |||
| 534 | Ga0206352_11128342 | |||
| 535 | Ga0206353_11911329 | |||
| 536 | Ga0213871_10042218 | |||
| 537 | Ga0207692_10004273 | |||
| 538 | Ga0207642_10289565 | |||
| 539 | Ga0207647_10026721 | |||
| 540 | Ga0207699_10005084 | |||
| 541 | Ga0207705_10029352 | |||
| 542 | Ga0207705_10132642 | |||
| 543 | Ga0207654_10030942 | |||
| 544 | Ga0207654_10047911 | |||
| 545 | Ga0207654_10182244 | |||
| 546 | Ga0207707_10000363 | |||
| 547 | Ga0207707_10034870 | |||
| 548 | Ga0207707_10175798 | |||
| 549 | Ga0207707_10197720 | |||
| 550 | Ga0207707_10276998 | |||
| 551 | Ga0207695_10065095 | |||
| 552 | Ga0207695_10075260 | |||
| 553 | Ga0207695_10095467 | |||
| 554 | Ga0207671_10179694 | |||
| 555 | Ga0207693_10029067 | |||
| 556 | Ga0207693_10062271 | |||
| 557 | Ga0207693_10414591 | |||
| 558 | Ga0207663_10001622 | |||
| 559 | Ga0207663_10189285 | |||
| 560 | Ga0207660_10021596 | |||
| 561 | Ga0207660_10042025 | |||
| 562 | Ga0207660_10102552 | |||
| 563 | Ga0207662_10317563 | |||
| 564 | Ga0207657_10027075 | |||
| 565 | Ga0207652_10016430 | |||
| 566 | Ga0207652_10022174 | |||
| 567 | Ga0207652_10078570 | |||
| 568 | Ga0207652_10436777 | |||
| 569 | Ga0207694_10161419 | |||
| 570 | Ga0207700_10049896 | |||
| 571 | Ga0207664_10018496 | |||
| 572 | Ga0207664_11128302 | |||
| 573 | Ga0207644_10259356 | |||
| 574 | Ga0207690_10048752 | |||
| 575 | Ga0207690_10190918 | |||
| 576 | Ga0207690_10640551 | |||
| 577 | Ga0207706_10008946 | |||
| 578 | Ga0207686_10701050 | |||
| 579 | Ga0207669_10707676 | |||
| 580 | Ga0207665_10489638 | |||
| 581 | Ga0207691_10621660 | |||
| 582 | Ga0207689_10120825 | |||
| 583 | Ga0207661_10049709 | |||
| 584 | Ga0207679_10614568 | |||
| 585 | Ga0207667_10057887 | |||
| 586 | Ga0207667_10335574 | |||
| 587 | Ga0207712_10102142 | |||
| 588 | Ga0207668_10100506 | |||
| 589 | Ga0207658_11492711 | |||
| 590 | Ga0207703_10320557 | |||
| 591 | Ga0207703_11405300 | |||
| 592 | Ga0207639_10251391 | |||
| 593 | Ga0207639_10915762 | |||
| 594 | Ga0207678_10012522 | |||
| 595 | Ga0207678_10363097 | |||
| 596 | Ga0207702_10686126 | |||
| 597 | Ga0207702_11843176 | |||
| 598 | Ga0207698_10080828 | |||
| 599 | Ga0265338_10929030 | |||
| 600 | Ga0265320_10029779 | |||
| 601 | Ga0265325_10200904 | |||
| 602 | Ga0265329_10059973 | |||
| 603 | Ga0265340_10181442 | |||
| 604 | Ga0265331_10100703 | |||
| 605 | Ga0265316_10065441 | |||
| 606 | Ga0307508_10014017 | |||
| 607 | Ga0307516_10439660 | |||
| 608 | Ga0373959_0103435 | |||
| 609 | Ga0373926_0034578 | |||
| 610 | Ga0373928_0029267 | |||
| 611 | Ga0373934_0030894 | |||
| 612 | Ga0373944_0026353 | |||
| 613 | Ga0373923_0065272 | |||
| 614 | Ga0373936_0024164 | |||
| 615 | Ga0373945_0187220 | |||
| 616 | Ga0373953_0015043 | |||
| 617 | Ga0373954_0021646 | |||
| 618 | Ga0373954_0211400 | |||
| 619 | Ga0373956_0037918 | |||
| 620 | Ga0373957_0012739 | |||
| 621 | Ga0373957_0027993 | |||
| 622 | Ga0373943_0048130 | |||
| 623 | Ga0373943_0068307 | |||
| 624 | Ga0373946_0290356 | |||
| 625 | Ga0373955_0093075 | |||
| 626 | Ga0373955_0192309 | |||
| 627 | Ga0373924_0356303 | |||
| 628 | Ga0373927_0451692 | |||
| 629 | Ga0373947_0185403 | |||
| 630 | Ga0373947_0586458 | |||
| 631 | Ga0373947_0605781 | |||
| 632 | Ga0373937_0117213 | |||
| 633 | Ga0373925_0068706 | |||
| 634 | Ga0395900_1021791 | |||
| 635 | Ga0395905_0012215 | |||
| 636 | Ga0436364_0033830 | |||
| 637 | Ga0436364_0676030 | |||
| 638 | Ga0436364_1144367 | |||
| 639 | Ga0436365_0006628 | |||
| 640 | Ga0436365_0180680 | |||
| 641 | Ga0436365_0317550 | |||
| 642 | Ga0436365_0632248 | |||
| 643 | Ga0436365_1055500 | |||
| 644 | Ga0436361_0719196 | |||
| 645 | Ga0436363_0720333 | |||
| 646 | Ga0436363_1444614 | |||
| 647 | Ga0436362_0770020 | |||
| 648 | Ga0451805_057048 | |||
| 649 | Ga0466966_0581435 | |||
| 650 | Ga0466964_0132017 | |||
| 651 | Ga0466968_0077093 | |||
| 652 | Ga0466970_0117185 | |||
| 653 | Ga0466957_0109852 | |||
| 654 | Ga0466959_0015438 | |||
| 655 | Ga0466958_0740055 | |||
| 656 | Ga0495592_0099969 | |||
| 657 | Ga0495603_0004705 | |||
| 658 | Ga0495629_0068662 | |||
| 659 | Ga0495641_0035337 | |||
| 660 | Ga0495641_0117075 | |||
| 661 | Ga0495651_0005630 | |||
| 662 | Ga0495651_0077733 | |||
| 663 | Ga0495580_0067286 | |||
| 664 | Ga0495582_0005614 | |||
| 665 | Ga0495639_0021830 | |||
| 666 | Ga0495639_0063341 | |||
| 667 | Ga0495639_0367534 | |||
| 668 | Ga0495664_0021350 | |||
| 669 | Ga0495664_0023650 | |||
| 670 | Ga0495585_0038071 | |||
| 671 | Ga0495607_0022654 | |||
| 672 | Ga0495608_0004974 | |||
| 673 | Ga0495608_0055264 | |||
| 674 | Ga0495616_0296263 | |||
| 675 | Ga0495618_0035468 | |||
| 676 | Ga0495628_0126916 | |||
| 677 | Ga0495630_0141525 | |||
| 678 | Ga0495630_0252586 | |||
| 679 | Ga0495644_0116037 | |||
| 680 | Ga0495666_0084496 | |||
| 681 | Ga0495652_0097158 | |||
| 682 | Ga0495665_0022641 | |||
| 683 | Ga0495665_0181580 | |||
| 684 | Ga0495640_0041540 | |||
| 685 | Ga0495586_0156324 | |||
| 686 | Ga0495586_0181797 | |||
| 687 | Ga0495586_0194505 | |||
| 688 | Ga0495587_0030347 | |||
| 689 | Ga0495587_0073618 | |||
| 690 | Ga0495587_0254571 | |||
| 691 | Ga0495645_0007208 | |||
| 692 | Ga0495645_0062535 | |||
| 693 | Ga0495622_0093515 | |||
| 694 | Ga0495633_0018051 | |||
| 695 | Ga0495667_0040058 | |||
| 696 | Ga0495667_0209302 | |||
| 697 | Ga0495667_0504993 | |||
| 698 | Ga0495656_0018783 | |||
| 699 | Ga0495634_0036273 | |||
| 700 | Ga0495634_0230192 | |||
| 701 | Ga0495635_0087983 | |||
| 702 | Ga0495635_0515501 | |||
| 703 | Ga0495659_0003087 | |||
| 704 | Ga0495588_0029241 | |||
| 705 | Ga0495588_0088445 | |||
| 706 | Ga0495657_0055508 | |||
| 707 | Ga0495623_0164434 | |||
| 708 | Ga0495647_0018144 | |||
| 709 | Ga0495658_0400850 | |||
| 710 | Ga0495613_0178537 | |||
| 711 | Ga0495624_0073376 | |||
| 712 | Ga0495670_0126196 | |||
| 713 | Ga0495600_0063908 | |||
| 714 | Ga0495581_0070310 | |||
| 715 | Ga0495604_0092467 | |||
| 716 | Ga0495604_0579056 | |||
| 717 | Ga0495674_0068004 | |||
| 718 | Ga0495676_0043230 | |||
| 719 | Ga0495676_0048399 | |||
| 720 | Ga0495676_0079603 | |||
| 721 | Ga0495680_0012109 | |||
| 722 | Ga0495680_0135784 | |||
| 723 | Ga0495675_0488861 | |||
| 724 | Ga0495673_0119280 | |||
| 725 | Ga0495684_0089606 | |||
| 726 | Ga0495684_0282546 | |||
| 727 | Ga0495593_0064972 | |||
| 728 | Ga0495602_0205901 | |||
| 729 | Ga0495602_0269567 | |||
| 730 | Ga0495602_0338753 | |||
| 731 | Ga0495614_0084814 | |||
| 732 | Ga0496101_0553568 | |||
| 733 | Ga0496102_0443342 | |||
| 734 | Ga0496104_0008745 | |||
| 735 | Ga0496105_0025061 | |||
| 736 | Ga0496106_0728757 | |||
| 737 | Ga0496107_0141755 | |||
| 738 | Ga0496107_0739944 | |||
| 739 | Ga0496109_0010841 | |||
| 740 | Ga0496110_0013858 | |||
| 741 | Ga0496111_0007424 | |||
| 742 | Ga0496112_0080768 | |||
| 743 | Ga0496113_0007682 | |||
| 744 | Ga0496114_0129737 | |||
| 745 | Ga0496115_0054101 | |||
| 746 | Ga0496118_0016388 | |||
| 747 | Ga0496121_0032131 | |||
| 748 | Ga0496121_0075648 | |||
| 749 | Ga0496121_0178475 | |||
| 750 | Ga0496121_0345909 | |||
| 751 | Ga0496122_0108277 | |||
| 752 | Ga0496126_0023468 | |||
| 753 | Ga0496126_0131077 | |||
| 754 | Ga0496126_0167793 | |||
| 755 | Ga0501031_0311766 | |||
| 756 | Ga0501033_0087542 | |||
| 757 | Ga0501034_0620404 | |||
| 758 | Ga0501036_0260560 | |||
| 759 | Ga0501037_0095926 | |||
| 760 | Ga0501038_0190712 | |||
| 761 | Ga0501039_0499105 | |||
| 762 | Ga0501043_0623533 | |||
| 763 | Ga0501046_0033403 | |||
| 764 | Ga0501047_0197476 | |||
| 765 | Ga0501048_0162287 | |||
| 766 | Ga0501069_0094898 | |||
| 767 | Ga0501073_0035009 | |||
| 768 | Ga0501074_0217752 | |||
| 769 | Ga0501080_0086000 | |||
| 770 | Ga0501044_0095790 | |||
| 771 | Ga0501044_0553092 | |||
| 772 | Ga0501045_0934226 | |||
| 773 | nmdc:mga08x19_486023_c1 | |||
| 774 | Ga0495601_0042780 | |||
| 775 | Ga0495601_0103131 | |||
| 776 | Ga0495612_0051885 | |||
| 777 | Ga0495612_0079414 | |||
| 778 | Ga0495595_0045023 | |||
| 779 | Ga0495595_0045952 | |||
| 780 | Ga0495619_0555923 | |||
| 781 | Ga0500641_0018924 | |||
| 782 | Ga0500616_0005116 | |||
| 783 | Ga0587066_007611 | |||
| 784 | Ga0587070_010616 | |||
| 785 | Ga0587073_0007366 | |||
| 786 | Ga0587083_0060809 | |||
| 787 | Ga0587089_026203 | |||
| 788 | Ga0587067_101375 | |||
| 789 | Ga0587069_028335 | |||
| 790 | Ga0587075_014835 | |||
| 791 | Ga0587076_115282 | |||
| 792 | 2513672095 | |||
| 793 | 2513894792 | |||
| 794 | 2728753426 | |||
| 795 | 2793071293 | |||
| 796 | 2876763181 | |||
| 797 | 2885387916 | |||
| 798 | 2903749251 | |||
| 799 | 2903771308 | |||
| 800 | 2906611200 | |||
| 801 | 2932803813 | |||
| 802 | 2935654901 | |||
| 803 | 2935663829 | |||
| 804 | 2935770685 | |||
| 805 | 2935782918 | |||
| 806 | 2935787029 | |||
| 807 | 2935795077 | |||
| 808 | 2935884309 | |||
| 809 | 2936017985 | |||
| 810 | 2936026488 | |||
| 811 | 2936035105 | |||
| 812 | 2936053255 | |||
| 813 | 3005488682 | |||
| 814 | 3005720283 | |||
| 815 | 8006928481 | |||
| 816 | 8006943106 | |||
| 817 | 8006982901 | |||
| 818 | 8016523418 | |||
| 819 | 8016541188 | |||
| 820 | 8016552065 | |||
| 821 | 8016560443 | |||
| 822 | 8016566578 | |||
| 823 | 8016579322 | |||
| 824 | 8016589874 | |||
| 825 | 8016598345 | |||
| 826 | 8016621025 | |||
| 827 | 8016628981 | |||
| 828 | 8019536618 | |||
| 829 | 8019542843 | |||
| 830 | 8019547905 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6onq-assembly1.cif.gz_A | crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 | 0.8991 | 24 | 163 |
| 6onq-assembly1.cif.gz_A | crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 | 0.7705 | 24 | 163 |
| 1n90-assembly1.cif.gz_A | following the c heme reduction in nitrite reductase from pseudomonas aeruginosa | 0.7225 | 52 | 133 |
| 1k3g-assembly1.cif.gz_A | nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii | 0.6998 | 55 | 135 |
| 1c75-assembly1.cif.gz_A | "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" | 0.6834 | 58 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n15B01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7285 | 52 | 133 | 1.10.760.10 |
| 1k3gA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6998 | 55 | 135 | 1.10.760.10 |
| af_I1LGG8_13_193_2.40.160.200 | Mainly Beta;Beta Barrel;Porin;LURP1-related | 0.6841 | 31 | 45 | 2.40.160.200 |
| 1k3gA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.677 | 55 | 135 | 1.10.760.10 |
| 1kv9A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6752 | 52 | 138 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M9XT89-F1-model_v4 | C-type cytochrome, methanol metabolism-related | 0.9019 | 21 | 166 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A4P7F7Y3-F1-model_v4 | C-type cytochrome, methanol metabolism-related | 0.8949 | 21 | 164 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A1L9BRS1-F1-model_v4 | Cytochrome c domain-containing protein | 0.8943 | 23 | 164 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A5N7MS82-F1-model_v4 | C-type cytochrome, methanol metabolism-related | 0.8934 | 24 | 164 |
GO:0009055
GO:0020037 |
| AF-A0A6G9WCI7-F1-model_v4 | C-type cytochrome, methanol metabolism-related | 0.891 | 21 | 164 |
GO:0009055
GO:0020037 GO:0046872 |