F438444

General Info

Members Datasets Scaffolds Average Seq Length
414 221 828 142

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_821611_c1|nmdc:mga08y16_821611_c1_454_900
Length 148
Sequence LGQEEGVMQATHPSYQGSHRELATTNPAWQAYQALHIGFVVAPVLAGLDKFTNLLTDWTKYLAPSVANVLPVDARTFMYGVGVVEVIAGLLVAIRPRIGGYVVSAWLVGIIFNLLIHSQRFYDVALRDLGLAIGAFALARLATSFGKK

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
177 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
178 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
184 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
189 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
194 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
195 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
196 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
201 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.58
Metatranscriptomes 9.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.48
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 22.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_821611_c1 3300050511 Bacteria 921
2 SwRhRL2b_contig_3472316 2162886007 Bacteria 842
3 MBSR1b_contig_4627402 2162886012 Unclassified 1329
4 Ga0006778J45830_1024648 3300003162 Unclassified 771
5 Ga0006777J48905_1018299 3300003308 Unclassified 643
6 rootH2_10186774 3300003320 Bacteria 1317
7 rootH2_10264896 3300003320 Bacteria 1645
8 Ga0032354_1027513 3300003693 Unclassified 628
9 Ga0006780_1011744 3300003735 Unclassified 594
10 Ga0058861_11903739 3300004800 Bacteria 642
11 Ga0058862_12585914 3300004803 Bacteria 813
12 Ga0065704_10015574 3300005289 Bacteria 2968
13 Ga0065712_10123830 3300005290 Bacteria 1633
14 Ga0065715_10114537 3300005293 Unclassified 2447
15 Ga0065715_10165934 3300005293 Unclassified 1587
16 Ga0065707_10130039 3300005295 Bacteria 1936
17 Ga0070658_10351005 3300005327 Bacteria 1262
18 Ga0070676_10553879 3300005328 Bacteria 823
19 Ga0070683_100005339 3300005329 Bacteria 10713
20 Ga0070683_100712099 3300005329 Bacteria 961
21 Ga0070683_100783580 3300005329 Bacteria 914
22 Ga0070670_100384836 3300005331 Bacteria 1236
23 Ga0070670_100447184 3300005331 Unclassified 1145
24 Ga0070670_100814813 3300005331 Bacteria 844
25 Ga0070680_100168864 3300005336 Bacteria 1840
26 Ga0068868_100742247 3300005338 Unclassified 881
27 Ga0070660_100026015 3300005339 Bacteria 4355
28 Ga0070660_100290377 3300005339 Bacteria 1339
29 Ga0070661_100011464 3300005344 Bacteria 6175
30 Ga0070661_100261567 3300005344 Bacteria 1338
31 Ga0070675_100178324 3300005354 Bacteria 1836
32 Ga0070675_101468210 3300005354 Unclassified 629
33 Ga0070671_100062767 3300005355 Bacteria 3093
34 Ga0070671_100110910 3300005355 Bacteria 2305
35 Ga0070671_101663174 3300005355 Unclassified 566
36 Ga0070673_100053897 3300005364 Bacteria 3162
37 Ga0070673_100746847 3300005364 Unclassified 901
38 Ga0070659_100066021 3300005366 Bacteria 2867
39 Ga0070659_100569801 3300005366 Bacteria 971
40 Ga0070659_100731230 3300005366 Unclassified 857
41 Ga0070714_100000086 3300005435 Bacteria 79323
42 Ga0070714_100765620 3300005435 Bacteria 934
43 Ga0070713_100645303 3300005436 Bacteria 1008
44 Ga0070694_101185996 3300005444 Bacteria 639
45 Ga0070708_100099446 3300005445 Bacteria 2661
46 Ga0070708_101266639 3300005445 Unclassified 689
47 Ga0070663_100372982 3300005455 Unclassified 1160
48 Ga0070678_100679677 3300005456 Bacteria 926
49 Ga0070662_100016596 3300005457 Bacteria 4947
50 Ga0070662_100568374 3300005457 Bacteria 951
51 Ga0070662_100661260 3300005457 Bacteria 882
52 Ga0070662_100751443 3300005457 Bacteria 827
53 Ga0070662_100851599 3300005457 Bacteria 776
54 Ga0070681_10007298 3300005458 Bacteria 10788
55 Ga0070681_10054690 3300005458 Bacteria 3977
56 Ga0070681_10147687 3300005458 Bacteria 2279
57 Ga0070707_101611704 3300005468 Bacteria 616
58 Ga0070698_100013449 3300005471 Bacteria 8662
59 Ga0070679_100052851 3300005530 Bacteria 4044
60 Ga0070679_100055834 3300005530 Bacteria 3934
61 Ga0070679_100121149 3300005530 Unclassified 2601
62 Ga0070684_100019462 3300005535 Bacteria 5615
63 Ga0070684_100040952 3300005535 Bacteria 3991
64 Ga0070684_100077519 3300005535 Bacteria 2935
65 Ga0070684_101071053 3300005535 Bacteria 757
66 Ga0070684_102165055 3300005535 Bacteria 525
67 Ga0068853_100026198 3300005539 Unclassified 4895
68 Ga0068853_100043695 3300005539 Bacteria 3833
69 Ga0068853_100060092 3300005539 Bacteria 3283
70 Ga0068853_100090510 3300005539 Bacteria 2689
71 Ga0068853_100206425 3300005539 Bacteria 1789
72 Ga0068853_100541556 3300005539 Bacteria 1102
73 Ga0068853_100859334 3300005539 Bacteria 870
74 Ga0070672_100243937 3300005543 Bacteria 1512
75 Ga0070672_100744680 3300005543 Bacteria 860
76 Ga0070665_100575911 3300005548 Bacteria 1139
77 Ga0070704_100041429 3300005549 Bacteria 3178
78 Ga0068855_100142710 3300005563 Bacteria 2728
79 Ga0068855_100148850 3300005563 Bacteria 2663
80 Ga0068855_100417901 3300005563 Bacteria 1467
81 Ga0068855_100812151 3300005563 Bacteria 993
82 Ga0068855_101218335 3300005563 Bacteria 782
83 Ga0068855_101244970 3300005563 Bacteria 772
84 Ga0068855_101533474 3300005563 Unclassified 683
85 Ga0070664_100070685 3300005564 Bacteria 2990
86 Ga0070664_100097743 3300005564 Bacteria 2549
87 Ga0070664_100124530 3300005564 Unclassified 2259
88 Ga0070664_100184800 3300005564 Bacteria 1854
89 Ga0070664_100355329 3300005564 Bacteria 1334
90 Ga0070664_100843764 3300005564 Bacteria 858
91 Ga0070664_100997686 3300005564 Bacteria 787
92 Ga0068857_100011195 3300005577 Bacteria 7802
93 Ga0068857_100145537 3300005577 Unclassified 2144
94 Ga0068854_100118950 3300005578 Bacteria 2003
95 Ga0068854_100126151 3300005578 Unclassified 1949
96 Ga0068854_100270502 3300005578 Bacteria 1364
97 Ga0070702_100545173 3300005615 Bacteria 860
98 Ga0068852_100716136 3300005616 Bacteria 1012
99 Ga0068852_101595471 3300005616 Bacteria 675
100 Ga0068852_102345867 3300005616 Bacteria 554
101 Ga0068859_100032161 3300005617 Bacteria 5270
102 Ga0068859_100099124 3300005617 Unclassified 2969
103 Ga0068864_100007957 3300005618 Bacteria 8736
104 Ga0068864_100038236 3300005618 Bacteria 4097
105 Ga0068864_100181943 3300005618 Bacteria 1922
106 Ga0068861_100761432 3300005719 Bacteria 905
107 Ga0068861_100856400 3300005719 Bacteria 857
108 Ga0068851_10142956 3300005834 Bacteria 1302
109 Ga0068870_10855569 3300005840 Bacteria 639
110 Ga0068863_100086039 3300005841 Bacteria 2978
111 Ga0068858_100085814 3300005842 Bacteria 2929
112 Ga0068858_100859042 3300005842 Bacteria 886
113 Ga0068860_100828258 3300005843 Bacteria 939
114 Ga0081540_1000127 3300005983 Bacteria 80551
115 Ga0081540_1281148 3300005983 Bacteria 574
116 Ga0070717_10010987 3300006028 Bacteria 6856
117 Ga0070712_100520995 3300006175 Bacteria 999
118 Ga0070712_101039458 3300006175 Bacteria 710
119 Ga0097621_100856831 3300006237 Bacteria 844
120 Ga0068871_100523209 3300006358 Bacteria 1071
121 Ga0068871_100534384 3300006358 Bacteria 1060
122 Ga0075428_100258270 3300006844 Bacteria 1876
123 Ga0075428_100394372 3300006844 Bacteria 1484
124 Ga0075430_100006441 3300006846 Bacteria 9898
125 Ga0075430_100088157 3300006846 Bacteria 2596
126 Ga0075430_101006090 3300006846 Unclassified 687
127 Ga0075431_100009945 3300006847 Bacteria 9554
128 Ga0075431_100312550 3300006847 Bacteria 1586
129 Ga0075434_100161355 3300006871 Bacteria 2261
130 Ga0075434_100191799 3300006871 Unclassified 2064
131 Ga0075429_100007058 3300006880 Bacteria 9755
132 Ga0075436_100425587 3300006914 Unclassified 964
133 Ga0097620_100032161 3300006931 Bacteria 5270
134 Ga0097620_100099121 3300006931 Unclassified 2969
135 Ga0097620_102891109 3300006931 Bacteria 526
136 Ga0075435_100062110 3300007076 Bacteria 3031
137 Ga0075435_100149779 3300007076 Bacteria 1961
138 Ga0105240_10103177 3300009093 Bacteria 3465
139 Ga0111539_10001939 3300009094 Bacteria 27598
140 Ga0111539_10781008 3300009094 Bacteria 1112
141 Ga0105245_12088753 3300009098 Bacteria 620
142 Ga0114129_10000386 3300009147 Bacteria 51383
143 Ga0114129_10021382 3300009147 Bacteria 9183
144 Ga0114129_10104277 3300009147 Bacteria 3918
145 Ga0114129_10408692 3300009147 Unclassified 1788
146 Ga0105241_10088971 3300009174 Bacteria 2432
147 Ga0105241_11213201 3300009174 Unclassified 715
148 Ga0105248_10354922 3300009177 Bacteria 1651
149 Ga0105237_10161797 3300009545 Bacteria 2237
150 Ga0105237_10466805 3300009545 Unclassified 1268
151 Ga0105237_10656458 3300009545 Bacteria 1055
152 Ga0105237_11594256 3300009545 Unclassified 660
153 Ga0105238_11503846 3300009551 Bacteria 702
154 Ga0105239_10002506 3300010375 Bacteria 23371
155 Ga0105239_10044391 3300010375 Bacteria 4873
156 Ga0105239_10534423 3300010375 Bacteria 1334
157 Ga0105239_11116565 3300010375 Unclassified 908
158 Ga0105246_10083617 3300011119 Bacteria 2281
159 Ga0157373_10004816 3300013100 Bacteria 10158
160 Ga0157373_10005869 3300013100 Bacteria 9186
161 Ga0157373_10239446 3300013100 Bacteria 1283
162 Ga0157371_10256621 3300013102 Bacteria 1260
163 Ga0157371_10626383 3300013102 Bacteria 801
164 Ga0157371_11219569 3300013102 Bacteria 580
165 Ga0157370_10036135 3300013104 Bacteria 4796
166 Ga0157370_10230073 3300013104 Bacteria 1716
167 Ga0157369_10036732 3300013105 Bacteria 5366
168 Ga0157369_10054248 3300013105 Bacteria 4329
169 Ga0157369_10449019 3300013105 Bacteria 1335
170 Ga0157369_10781815 3300013105 Unclassified 981
171 Ga0157374_10413638 3300013296 Bacteria 1346
172 Ga0157374_10940896 3300013296 Bacteria 882
173 Ga0157378_12689088 3300013297 Unclassified 550
174 Ga0163162_10172045 3300013306 Bacteria 2291
175 Ga0163162_10351233 3300013306 Bacteria 1607
176 Ga0163162_11492669 3300013306 Unclassified 770
177 Ga0157372_10017804 3300013307 Bacteria 7630
178 Ga0157372_10067786 3300013307 Bacteria 4011
179 Ga0157372_10236815 3300013307 Bacteria 2117
180 Ga0157372_10304292 3300013307 Bacteria 1855
181 Ga0157372_10329032 3300013307 Bacteria 1779
182 Ga0157372_10425067 3300013307 Bacteria 1548
183 Ga0157372_10447388 3300013307 Bacteria 1506
184 Ga0157372_10799980 3300013307 Bacteria 1095
185 Ga0157372_11624830 3300013307 Bacteria 744
186 Ga0157375_10609260 3300013308 Bacteria 1251
187 Ga0157375_13103629 3300013308 Bacteria 554
188 Ga0163163_10024111 3300014325 Bacteria 5788
189 Ga0163163_10201350 3300014325 Bacteria 2039
190 Ga0163163_10318737 3300014325 Unclassified 1608
191 Ga0163163_10896196 3300014325 Bacteria 950
192 Ga0157377_10916041 3300014745 Bacteria 657
193 Ga0157376_11662991 3300014969 Bacteria 673
194 Ga0182007_10393905 3300015262 Bacteria 527
195 Ga0197907_10014238 3300020069 Bacteria 993
196 Ga0197907_10614475 3300020069 Unclassified 544
197 Ga0206356_10274978 3300020070 Bacteria 570
198 Ga0206356_10864651 3300020070 Unclassified 568
199 Ga0206356_11409095 3300020070 Bacteria 582
200 Ga0206356_11518218 3300020070 Unclassified 568
201 Ga0206349_1319812 3300020075 Unclassified 622
202 Ga0206351_10278569 3300020077 Unclassified 513
203 Ga0206352_10859502 3300020078 Bacteria 836
204 Ga0206350_10086181 3300020080 Unclassified 571
205 Ga0206354_10869713 3300020081 Bacteria 504
206 Ga0206354_11483110 3300020081 Unclassified 512
207 Ga0154015_1497765 3300020610 Bacteria 794
208 Ga0154015_1693169 3300020610 Unclassified 545
209 Ga0213874_10198998 3300021377 Unclassified 720
210 Ga0224712_10432547 3300022467 Unclassified 630
211 Ga0224712_10445028 3300022467 Bacteria 622
212 Ga0224712_10511154 3300022467 Unclassified 581
213 Ga0224712_10622045 3300022467 Bacteria 528
214 Ga0207710_10011394 3300025900 Bacteria 3745
215 Ga0207680_11197237 3300025903 Unclassified 542
216 Ga0207647_10001274 3300025904 Bacteria 19392
217 Ga0207645_10320060 3300025907 Bacteria 1034
218 Ga0207705_10362422 3300025909 Bacteria 1118
219 Ga0207684_10908696 3300025910 Unclassified 740
220 Ga0207654_10551057 3300025911 Unclassified 819
221 Ga0207654_10857927 3300025911 Unclassified 657
222 Ga0207707_10010206 3300025912 Bacteria 8153
223 Ga0207707_10140623 3300025912 Bacteria 2110
224 Ga0207707_10555200 3300025912 Bacteria 975
225 Ga0207671_10431382 3300025914 Bacteria 1049
226 Ga0207693_10552654 3300025915 Bacteria 898
227 Ga0207693_10830607 3300025915 Bacteria 711
228 Ga0207660_10724260 3300025917 Unclassified 811
229 Ga0207657_10049356 3300025919 Bacteria 3668
230 Ga0207649_10059013 3300025920 Bacteria 2405
231 Ga0207649_11135492 3300025920 Unclassified 617
232 Ga0207652_10068580 3300025921 Bacteria 3078
233 Ga0207681_10210037 3300025923 Bacteria 1500
234 Ga0207650_10008419 3300025925 Bacteria 7041
235 Ga0207650_10331887 3300025925 Bacteria 1247
236 Ga0207659_10113648 3300025926 Bacteria 2063
237 Ga0207659_11148031 3300025926 Bacteria 668
238 Ga0207687_11898748 3300025927 Unclassified 509
239 Ga0207664_10000497 3300025929 Bacteria 27982
240 Ga0207664_10551085 3300025929 Bacteria 1034
241 Ga0207690_10772385 3300025932 Unclassified 793
242 Ga0207706_10009593 3300025933 Bacteria 8884
243 Ga0207706_10357280 3300025933 Bacteria 1270
244 Ga0207706_11164302 3300025933 Bacteria 642
245 Ga0207665_10936981 3300025939 Unclassified 688
246 Ga0207665_11153639 3300025939 Unclassified 618
247 Ga0207691_10069365 3300025940 Unclassified 3184
248 Ga0207691_10142820 3300025940 Bacteria 2108
249 Ga0207691_10539747 3300025940 Bacteria 989
250 Ga0207661_10260810 3300025944 Bacteria 1544
251 Ga0207661_11722839 3300025944 Unclassified 572
252 Ga0207661_12063025 3300025944 Unclassified 516
253 Ga0207679_10014923 3300025945 Bacteria 5118
254 Ga0207679_10108074 3300025945 Bacteria 2190
255 Ga0207679_10282846 3300025945 Bacteria 1423
256 Ga0207679_10401739 3300025945 Bacteria 1205
257 Ga0207667_10112800 3300025949 Bacteria 2803
258 Ga0207667_10175168 3300025949 Bacteria 2204
259 Ga0207667_10214251 3300025949 Bacteria 1974
260 Ga0207667_10425956 3300025949 Bacteria 1350
261 Ga0207667_10767430 3300025949 Bacteria 962
262 Ga0207651_10128447 3300025960 Bacteria 1936
263 Ga0207640_10187763 3300025981 Bacteria 1555
264 Ga0207640_10232952 3300025981 Bacteria 1418
265 Ga0207640_10240417 3300025981 Unclassified 1399
266 Ga0207658_10153699 3300025986 Bacteria 1878
267 Ga0207703_10188169 3300026035 Bacteria 1826
268 Ga0207639_10001897 3300026041 Bacteria 14034
269 Ga0207639_10022266 3300026041 Unclassified 4563
270 Ga0207639_10023516 3300026041 Bacteria 4451
271 Ga0207639_10141241 3300026041 Bacteria 2007
272 Ga0207639_10381576 3300026041 Bacteria 1266
273 Ga0207639_10864743 3300026041 Bacteria 844
274 Ga0207678_10002690 3300026067 Bacteria 16119
275 Ga0207678_10372047 3300026067 Bacteria 1234
276 Ga0207676_10125183 3300026095 Bacteria 2175
277 Ga0207676_10293248 3300026095 Unclassified 1482
278 Ga0207676_11134815 3300026095 Bacteria 773
279 Ga0207674_10040637 3300026116 Bacteria 4817
280 Ga0207674_10870553 3300026116 Bacteria 868
281 Ga0207675_100227272 3300026118 Bacteria 1799
282 Ga0207675_100426227 3300026118 Bacteria 1311
283 Ga0207698_10031428 3300026142 Bacteria 3832
284 Ga0207698_10362368 3300026142 Unclassified 1373
285 Ga0207698_11298797 3300026142 Bacteria 742
286 Ga0207698_11812798 3300026142 Bacteria 625
287 Ga0209995_1046821 3300027471 Bacteria 732
288 Ga0209974_10062370 3300027876 Bacteria 1263
289 Ga0209974_10068464 3300027876 Bacteria 1209
290 Ga0207428_10007410 3300027907 Bacteria 10002
291 Ga0268266_10039087 3300028379 Bacteria 4041
292 Ga0268264_10013983 3300028381 Bacteria 6599
293 Ga0268264_10781376 3300028381 Bacteria 953
294 Ga0307408_100003969 3300031548 Bacteria 10078
295 Ga0307408_100130154 3300031548 Bacteria 1962
296 Ga0307405_10058802 3300031731 Unclassified 2421
297 Ga0307405_10061338 3300031731 Bacteria 2377
298 Ga0307405_10196288 3300031731 Bacteria 1462
299 Ga0307405_10675728 3300031731 Bacteria 852
300 Ga0307413_10125641 3300031824 Bacteria 1746
301 Ga0307413_10729846 3300031824 Bacteria 826
302 Ga0307413_11429727 3300031824 Bacteria 609
303 Ga0307406_10400598 3300031901 Bacteria 1088
304 Ga0307406_10898283 3300031901 Unclassified 754
305 Ga0307407_10182399 3300031903 Bacteria 1392
306 Ga0307407_10207073 3300031903 Bacteria 1318
307 Ga0307412_10003427 3300031911 Bacteria 8811
308 Ga0307412_10042084 3300031911 Bacteria 2965
309 Ga0307412_10382998 3300031911 Bacteria 1139
310 Ga0307409_100174680 3300031995 Unclassified 1895
311 Ga0307409_100317348 3300031995 Bacteria 1457
312 Ga0307416_100060414 3300032002 Bacteria 3087
313 Ga0307416_100151178 3300032002 Bacteria 2129
314 Ga0307416_100561322 3300032002 Bacteria 1216
315 Ga0307416_101740312 3300032002 Unclassified 728
316 Ga0307414_10305500 3300032004 Bacteria 1348
317 Ga0307414_10323905 3300032004 Bacteria 1313
318 Ga0307414_10585339 3300032004 Bacteria 999
319 Ga0307414_11182467 3300032004 Bacteria 708
320 Ga0307411_10583612 3300032005 Unclassified 958
321 Ga0307415_100041264 3300032126 Bacteria 3063
322 Ga0307415_100216541 3300032126 Bacteria 1532
323 Ga0307415_101482019 3300032126 Bacteria 649
324 Ga0373937_0587353 3300036401 Bacteria 1058
325 Ga0395899_0064461 3300037312 Unclassified 2694
326 Ga0395900_0024126 3300037418 Bacteria 6226
327 Ga0395900_0408923 3300037418 Unclassified 1320
328 Ga0395900_0428690 3300037418 Bacteria 1282
329 Ga0395900_0545137 3300037418 Bacteria 1105
330 Ga0395898_0020436 3300037466 Bacteria 6724
331 Ga0395898_1335087 3300037466 Unclassified 646
332 Ga0395905_0176659 3300037471 Bacteria 2005
333 Ga0395905_0261393 3300037471 Bacteria 1616
334 Ga0395905_0395024 3300037471 Bacteria 1277
335 Ga0395905_0515826 3300037471 Bacteria 1096
336 Ga0395905_0522885 3300037471 Unclassified 1087
337 Ga0436364_1194736 3300037853 Unclassified 656
338 Ga0395901_0012479 3300038443 Bacteria 8622
339 Ga0395901_0402248 3300038443 Bacteria 1407
340 Ga0395901_0963968 3300038443 Unclassified 831
341 Ga0436363_1169162 3300039450 Unclassified 828
342 Ga0439445_0079705 3300042004 Unclassified 914
343 Ga0439457_059882 3300042014 Bacteria 861
344 Ga0466959_0399338 3300045049 Bacteria 934
345 Ga0451576_0381297 3300045051 Bacteria 1478
346 Ga0451576_1144113 3300045051 Bacteria 814
347 Ga0495652_0195518 3300046529 Bacteria 1540
348 Ga0495667_0084872 3300046559 Bacteria 2055
349 Ga0495636_0639763 3300047318 Unclassified 522
350 Ga0495674_0863876 3300047319 Unclassified 700
351 Ga0495675_0315543 3300047444 Bacteria 925
352 Ga0495684_0019387 3300047471 Bacteria 5237
353 Ga0495602_1150457 3300048088 Bacteria 507
354 Ga0496109_0000050 3300048912 Bacteria 126918
355 Ga0496110_0593951 3300048913 Bacteria 1005
356 Ga0501297_039703 3300049520 Unclassified 658
357 Ga0501303_009109 3300049526 Unclassified 911
358 Ga0501311_102064 3300049527 Bacteria 509
359 Ga0501047_0720288 3300049581 Bacteria 815
360 Ga0501048_0193931 3300049582 Bacteria 1440
361 Ga0501076_0949350 3300049592 Bacteria 709
362 Ga0501198_061551 3300049649 Bacteria 690
363 Ga0501206_053390 3300049653 Unclassified 648
364 Ga0501209_066730 3300049656 Bacteria 1016
365 Ga0501217_040588 3300049661 Bacteria 1183
366 Ga0501233_091812 3300049668 Unclassified 794
367 Ga0501235_177104 3300049669 Unclassified 566
368 Ga0501242_011522 3300049674 Unclassified 1069
369 Ga0501243_041945 3300049675 Bacteria 806
370 Ga0501249_042417 3300049679 Bacteria 1034
371 Ga0501252_010807 3300049682 Bacteria 1085
372 Ga0501257_032676 3300049686 Bacteria 1259
373 Ga0501258_025664 3300049687 Bacteria 718
374 Ga0501259_003258 3300049688 Bacteria 2595
375 Ga0501261_095045 3300049690 Bacteria 559
376 Ga0501245_059392 3300049708 Bacteria 696
377 Ga0501079_0485665 3300049741 Bacteria 971
378 Ga0501263_011650 3300049760 Bacteria 1094
379 Ga0501268_014688 3300049765 Bacteria 1278
380 Ga0501268_175363 3300049765 Unclassified 508
381 Ga0501276_027142 3300049773 Bacteria 580
382 Ga0501212_063772 3300049851 Unclassified 642
383 nmdc:mga05p37_101_c1 3300050507 Bacteria 77106
384 nmdc:mga05p37_283161_c1 3300050507 Unclassified 1436
385 nmdc:mga05p37_43368_c1 3300050507 Bacteria 5533
386 nmdc:mga05p37_6731_c1 3300050507 Bacteria 13547
387 nmdc:mga09592_3116_c1 3300050508 Bacteria 13467
388 nmdc:mga0qj67_167248_c1 3300050509 Bacteria 1785
389 nmdc:mga0qj67_19139_c1 3300050509 Bacteria 5229
390 nmdc:mga06r32_309856_c1 3300050510 Bacteria 1564
391 nmdc:mga06r32_38646_c1 3300050510 Unclassified 4524
392 nmdc:mga06r32_883316_c1 3300050510 Unclassified 851
393 nmdc:mga08y16_814_c1 3300050511 Bacteria 29883
394 nmdc:mga0n895_191222_c1 3300050512 Unclassified 2077
395 nmdc:mga0n895_295046_c1 3300050512 Bacteria 1643
396 nmdc:mga0rr50_114168_c1 3300050513 Bacteria 2141
397 nmdc:mga0rr50_286178_c1 3300050513 Bacteria 1376
398 nmdc:mga08x19_217381_c1 3300050514 Unclassified 1313
399 nmdc:mga0a205_107699_c1 3300050515 Unclassified 2685
400 nmdc:mga0a205_193458_c1 3300050515 Bacteria 1925
401 Ga0587066_161246 3300059490 Unclassified 564
402 Ga0587073_0211666 3300059492 Bacteria 587
403 Ga0587073_0243579 3300059492 Unclassified 560
404 Ga0587083_0200730 3300059505 Bacteria 569
405 Ga0587092_113114 3300059512 Bacteria 572
406 Ga0587098_046517 3300059604 Bacteria 647
407 Ga0587106_116439 3300059605 Bacteria 562
408 Ga0587131_021644 3300059609 Bacteria 533
409 Ga0587113_040197 3300059625 Bacteria 558
410 Ga0587115_072460 3300059626 Bacteria 597
411 Ga0587067_165795 3300059640 Bacteria 565
412 Ga0587067_172013 3300059640 Unclassified 558
413 Ga0587114_081146 3300059655 Bacteria 604
414 Ga0587119_063164 3300059658 Bacteria 575
415 nmdc:mga08y16_821611_c1
416 SwRhRL2b_contig_3472316
417 MBSR1b_contig_4627402
418 Ga0006778J45830_1024648
419 Ga0006777J48905_1018299
420 rootH2_10186774
421 rootH2_10264896
422 Ga0032354_1027513
423 Ga0006780_1011744
424 Ga0058861_11903739
425 Ga0058862_12585914
426 Ga0065704_10015574
427 Ga0065712_10123830
428 Ga0065715_10114537
429 Ga0065715_10165934
430 Ga0065707_10130039
431 Ga0070658_10351005
432 Ga0070676_10553879
433 Ga0070683_100005339
434 Ga0070683_100712099
435 Ga0070683_100783580
436 Ga0070670_100384836
437 Ga0070670_100447184
438 Ga0070670_100814813
439 Ga0070680_100168864
440 Ga0068868_100742247
441 Ga0070660_100026015
442 Ga0070660_100290377
443 Ga0070661_100011464
444 Ga0070661_100261567
445 Ga0070675_100178324
446 Ga0070675_101468210
447 Ga0070671_100062767
448 Ga0070671_100110910
449 Ga0070671_101663174
450 Ga0070673_100053897
451 Ga0070673_100746847
452 Ga0070659_100066021
453 Ga0070659_100569801
454 Ga0070659_100731230
455 Ga0070714_100000086
456 Ga0070714_100765620
457 Ga0070713_100645303
458 Ga0070694_101185996
459 Ga0070708_100099446
460 Ga0070708_101266639
461 Ga0070663_100372982
462 Ga0070678_100679677
463 Ga0070662_100016596
464 Ga0070662_100568374
465 Ga0070662_100661260
466 Ga0070662_100751443
467 Ga0070662_100851599
468 Ga0070681_10007298
469 Ga0070681_10054690
470 Ga0070681_10147687
471 Ga0070707_101611704
472 Ga0070698_100013449
473 Ga0070679_100052851
474 Ga0070679_100055834
475 Ga0070679_100121149
476 Ga0070684_100019462
477 Ga0070684_100040952
478 Ga0070684_100077519
479 Ga0070684_101071053
480 Ga0070684_102165055
481 Ga0068853_100026198
482 Ga0068853_100043695
483 Ga0068853_100060092
484 Ga0068853_100090510
485 Ga0068853_100206425
486 Ga0068853_100541556
487 Ga0068853_100859334
488 Ga0070672_100243937
489 Ga0070672_100744680
490 Ga0070665_100575911
491 Ga0070704_100041429
492 Ga0068855_100142710
493 Ga0068855_100148850
494 Ga0068855_100417901
495 Ga0068855_100812151
496 Ga0068855_101218335
497 Ga0068855_101244970
498 Ga0068855_101533474
499 Ga0070664_100070685
500 Ga0070664_100097743
501 Ga0070664_100124530
502 Ga0070664_100184800
503 Ga0070664_100355329
504 Ga0070664_100843764
505 Ga0070664_100997686
506 Ga0068857_100011195
507 Ga0068857_100145537
508 Ga0068854_100118950
509 Ga0068854_100126151
510 Ga0068854_100270502
511 Ga0070702_100545173
512 Ga0068852_100716136
513 Ga0068852_101595471
514 Ga0068852_102345867
515 Ga0068859_100032161
516 Ga0068859_100099124
517 Ga0068864_100007957
518 Ga0068864_100038236
519 Ga0068864_100181943
520 Ga0068861_100761432
521 Ga0068861_100856400
522 Ga0068851_10142956
523 Ga0068870_10855569
524 Ga0068863_100086039
525 Ga0068858_100085814
526 Ga0068858_100859042
527 Ga0068860_100828258
528 Ga0081540_1000127
529 Ga0081540_1281148
530 Ga0070717_10010987
531 Ga0070712_100520995
532 Ga0070712_101039458
533 Ga0097621_100856831
534 Ga0068871_100523209
535 Ga0068871_100534384
536 Ga0075428_100258270
537 Ga0075428_100394372
538 Ga0075430_100006441
539 Ga0075430_100088157
540 Ga0075430_101006090
541 Ga0075431_100009945
542 Ga0075431_100312550
543 Ga0075434_100161355
544 Ga0075434_100191799
545 Ga0075429_100007058
546 Ga0075436_100425587
547 Ga0097620_100032161
548 Ga0097620_100099121
549 Ga0097620_102891109
550 Ga0075435_100062110
551 Ga0075435_100149779
552 Ga0105240_10103177
553 Ga0111539_10001939
554 Ga0111539_10781008
555 Ga0105245_12088753
556 Ga0114129_10000386
557 Ga0114129_10021382
558 Ga0114129_10104277
559 Ga0114129_10408692
560 Ga0105241_10088971
561 Ga0105241_11213201
562 Ga0105248_10354922
563 Ga0105237_10161797
564 Ga0105237_10466805
565 Ga0105237_10656458
566 Ga0105237_11594256
567 Ga0105238_11503846
568 Ga0105239_10002506
569 Ga0105239_10044391
570 Ga0105239_10534423
571 Ga0105239_11116565
572 Ga0105246_10083617
573 Ga0157373_10004816
574 Ga0157373_10005869
575 Ga0157373_10239446
576 Ga0157371_10256621
577 Ga0157371_10626383
578 Ga0157371_11219569
579 Ga0157370_10036135
580 Ga0157370_10230073
581 Ga0157369_10036732
582 Ga0157369_10054248
583 Ga0157369_10449019
584 Ga0157369_10781815
585 Ga0157374_10413638
586 Ga0157374_10940896
587 Ga0157378_12689088
588 Ga0163162_10172045
589 Ga0163162_10351233
590 Ga0163162_11492669
591 Ga0157372_10017804
592 Ga0157372_10067786
593 Ga0157372_10236815
594 Ga0157372_10304292
595 Ga0157372_10329032
596 Ga0157372_10425067
597 Ga0157372_10447388
598 Ga0157372_10799980
599 Ga0157372_11624830
600 Ga0157375_10609260
601 Ga0157375_13103629
602 Ga0163163_10024111
603 Ga0163163_10201350
604 Ga0163163_10318737
605 Ga0163163_10896196
606 Ga0157377_10916041
607 Ga0157376_11662991
608 Ga0182007_10393905
609 Ga0197907_10014238
610 Ga0197907_10614475
611 Ga0206356_10274978
612 Ga0206356_10864651
613 Ga0206356_11409095
614 Ga0206356_11518218
615 Ga0206349_1319812
616 Ga0206351_10278569
617 Ga0206352_10859502
618 Ga0206350_10086181
619 Ga0206354_10869713
620 Ga0206354_11483110
621 Ga0154015_1497765
622 Ga0154015_1693169
623 Ga0213874_10198998
624 Ga0224712_10432547
625 Ga0224712_10445028
626 Ga0224712_10511154
627 Ga0224712_10622045
628 Ga0207710_10011394
629 Ga0207680_11197237
630 Ga0207647_10001274
631 Ga0207645_10320060
632 Ga0207705_10362422
633 Ga0207684_10908696
634 Ga0207654_10551057
635 Ga0207654_10857927
636 Ga0207707_10010206
637 Ga0207707_10140623
638 Ga0207707_10555200
639 Ga0207671_10431382
640 Ga0207693_10552654
641 Ga0207693_10830607
642 Ga0207660_10724260
643 Ga0207657_10049356
644 Ga0207649_10059013
645 Ga0207649_11135492
646 Ga0207652_10068580
647 Ga0207681_10210037
648 Ga0207650_10008419
649 Ga0207650_10331887
650 Ga0207659_10113648
651 Ga0207659_11148031
652 Ga0207687_11898748
653 Ga0207664_10000497
654 Ga0207664_10551085
655 Ga0207690_10772385
656 Ga0207706_10009593
657 Ga0207706_10357280
658 Ga0207706_11164302
659 Ga0207665_10936981
660 Ga0207665_11153639
661 Ga0207691_10069365
662 Ga0207691_10142820
663 Ga0207691_10539747
664 Ga0207661_10260810
665 Ga0207661_11722839
666 Ga0207661_12063025
667 Ga0207679_10014923
668 Ga0207679_10108074
669 Ga0207679_10282846
670 Ga0207679_10401739
671 Ga0207667_10112800
672 Ga0207667_10175168
673 Ga0207667_10214251
674 Ga0207667_10425956
675 Ga0207667_10767430
676 Ga0207651_10128447
677 Ga0207640_10187763
678 Ga0207640_10232952
679 Ga0207640_10240417
680 Ga0207658_10153699
681 Ga0207703_10188169
682 Ga0207639_10001897
683 Ga0207639_10022266
684 Ga0207639_10023516
685 Ga0207639_10141241
686 Ga0207639_10381576
687 Ga0207639_10864743
688 Ga0207678_10002690
689 Ga0207678_10372047
690 Ga0207676_10125183
691 Ga0207676_10293248
692 Ga0207676_11134815
693 Ga0207674_10040637
694 Ga0207674_10870553
695 Ga0207675_100227272
696 Ga0207675_100426227
697 Ga0207698_10031428
698 Ga0207698_10362368
699 Ga0207698_11298797
700 Ga0207698_11812798
701 Ga0209995_1046821
702 Ga0209974_10062370
703 Ga0209974_10068464
704 Ga0207428_10007410
705 Ga0268266_10039087
706 Ga0268264_10013983
707 Ga0268264_10781376
708 Ga0307408_100003969
709 Ga0307408_100130154
710 Ga0307405_10058802
711 Ga0307405_10061338
712 Ga0307405_10196288
713 Ga0307405_10675728
714 Ga0307413_10125641
715 Ga0307413_10729846
716 Ga0307413_11429727
717 Ga0307406_10400598
718 Ga0307406_10898283
719 Ga0307407_10182399
720 Ga0307407_10207073
721 Ga0307412_10003427
722 Ga0307412_10042084
723 Ga0307412_10382998
724 Ga0307409_100174680
725 Ga0307409_100317348
726 Ga0307416_100060414
727 Ga0307416_100151178
728 Ga0307416_100561322
729 Ga0307416_101740312
730 Ga0307414_10305500
731 Ga0307414_10323905
732 Ga0307414_10585339
733 Ga0307414_11182467
734 Ga0307411_10583612
735 Ga0307415_100041264
736 Ga0307415_100216541
737 Ga0307415_101482019
738 Ga0373937_0587353
739 Ga0395899_0064461
740 Ga0395900_0024126
741 Ga0395900_0408923
742 Ga0395900_0428690
743 Ga0395900_0545137
744 Ga0395898_0020436
745 Ga0395898_1335087
746 Ga0395905_0176659
747 Ga0395905_0261393
748 Ga0395905_0395024
749 Ga0395905_0515826
750 Ga0395905_0522885
751 Ga0436364_1194736
752 Ga0395901_0012479
753 Ga0395901_0402248
754 Ga0395901_0963968
755 Ga0436363_1169162
756 Ga0439445_0079705
757 Ga0439457_059882
758 Ga0466959_0399338
759 Ga0451576_0381297
760 Ga0451576_1144113
761 Ga0495652_0195518
762 Ga0495667_0084872
763 Ga0495636_0639763
764 Ga0495674_0863876
765 Ga0495675_0315543
766 Ga0495684_0019387
767 Ga0495602_1150457
768 Ga0496109_0000050
769 Ga0496110_0593951
770 Ga0501297_039703
771 Ga0501303_009109
772 Ga0501311_102064
773 Ga0501047_0720288
774 Ga0501048_0193931
775 Ga0501076_0949350
776 Ga0501198_061551
777 Ga0501206_053390
778 Ga0501209_066730
779 Ga0501217_040588
780 Ga0501233_091812
781 Ga0501235_177104
782 Ga0501242_011522
783 Ga0501243_041945
784 Ga0501249_042417
785 Ga0501252_010807
786 Ga0501257_032676
787 Ga0501258_025664
788 Ga0501259_003258
789 Ga0501261_095045
790 Ga0501245_059392
791 Ga0501079_0485665
792 Ga0501263_011650
793 Ga0501268_014688
794 Ga0501268_175363
795 Ga0501276_027142
796 Ga0501212_063772
797 nmdc:mga05p37_101_c1
798 nmdc:mga05p37_283161_c1
799 nmdc:mga05p37_43368_c1
800 nmdc:mga05p37_6731_c1
801 nmdc:mga09592_3116_c1
802 nmdc:mga0qj67_167248_c1
803 nmdc:mga0qj67_19139_c1
804 nmdc:mga06r32_309856_c1
805 nmdc:mga06r32_38646_c1
806 nmdc:mga06r32_883316_c1
807 nmdc:mga08y16_814_c1
808 nmdc:mga0n895_191222_c1
809 nmdc:mga0n895_295046_c1
810 nmdc:mga0rr50_114168_c1
811 nmdc:mga0rr50_286178_c1
812 nmdc:mga08x19_217381_c1
813 nmdc:mga0a205_107699_c1
814 nmdc:mga0a205_193458_c1
815 Ga0587066_161246
816 Ga0587073_0211666
817 Ga0587073_0243579
818 Ga0587083_0200730
819 Ga0587092_113114
820 Ga0587098_046517
821 Ga0587106_116439
822 Ga0587131_021644
823 Ga0587113_040197
824 Ga0587115_072460
825 Ga0587067_165795
826 Ga0587067_172013
827 Ga0587114_081146
828 Ga0587119_063164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uzg-assembly1.cif.gz_f rat kidney v-atpase lacking subunit h, with sidk and ncoa7b, state 1 0.6695 22 85
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.5359 26 138
7uzg-assembly1.cif.gz_f rat kidney v-atpase lacking subunit h, with sidk and ncoa7b, state 1 0.5302 22 85
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.5229 31 139
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.5182 26 138
ID Description Score Start End Superfamily
af_A0A0R0G5K6_1_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6083 24 139 1.20.120.550
af_P40030_21_129_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6005 27 123 3.40.605.10
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5874 7 143 1.20.120.550
af_O65935_1_185_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5783 31 138 1.20.1250.20
af_O60636_1_106_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.576 28 86 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A4R2H631-F1-model_v4 DoxX-like protein 0.9825 18 143 GO:0016020
AF-A0A534Q1W8-F1-model_v4 DoxX family protein 0.9659 27 141 GO:0016020
AF-A0A1Q9S6F3-F1-model_v4 DoxX family protein 0.9505 21 143 GO:0016020
AF-A0A1M6FKU1-F1-model_v4 DoxX protein 0.9499 25 91 GO:0016020
AF-A0A150XMA1-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 0.9474 24 138 GO:0016020

Map