F438271

General Info

Members Datasets Scaffolds Average Seq Length
414 214 828 393

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100043090|Ga0070686_1000430902
Length 438
Sequence VLVFYFLCAVAIWLGLVSLRGGLRFSAYVRREVTAQRSDYTPLVSVIAPFRGVDQHQRENLNALFEQRYPAYEIVFVTDSVADPGISILTEVCSSRSDKLQFVDDSQKNLAYEAGQLFVEGSTSNLNDNLKIVGLKLVIAGAATDSGQKVHNLQAAIAHINPKSEVIVLVDSDARPHAFWLQYLVAPLSDENLGVATGYRWFTPPGFSFSGALRSVWNASITSALGAATDKNFCWGGSTAIRRKTFDELNVNARWRGSISDDFTLTRVLHEAGLPIKFVPQCLLVSADECGFRELLEFTTRQLKITRVYAGHLWKASLLGSAQFVLVFFGGLGLLLWRXXMGLSIEPLAILLLIIFLLGALKSWFRLKAVEVALESYRLRLGKDLPAHLLLWPLASALFLWNSIAAAFSKRINWRGISYELKSPQEAVIIARESNQDG

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
196 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.72
Rhizosphere 97.34
Stem 0
Stem Tuber 0
Unclassified 20.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100043090 3300005544 Unclassified 2830
2 LJQas_1000190 3300000549 Bacteria 11083
3 JGI24030J14995_100180 3300001426 Unclassified 1728
4 JGI24748J21848_1000005 3300002074 Bacteria 228924
5 JGI24034J26672_10000003 3300002239 Bacteria 501747
6 JGI24751J29686_10000006 3300002459 Bacteria 134556
7 JGI25406J46586_10003991 3300003203 Bacteria 6904
8 JGI25406J46586_10007037 3300003203 Bacteria 5159
9 Ga0065714_10064454 3300005288 Bacteria 72991
10 Ga0065704_10076020 3300005289 Bacteria 5303
11 Ga0065704_10140902 3300005289 Unclassified 1488
12 Ga0065704_10148622 3300005289 Bacteria 1449
13 Ga0065712_10000129 3300005290 Bacteria 72972
14 Ga0065712_10002929 3300005290 Unclassified 4389
15 Ga0065712_10110053 3300005290 Unclassified 1844
16 Ga0065715_10095797 3300005293 Bacteria 4005
17 Ga0065707_10002257 3300005295 Bacteria 9187
18 Ga0065707_10087607 3300005295 Bacteria 4954
19 Ga0065707_10117859 3300005295 Bacteria 2201
20 Ga0070658_10013015 3300005327 Bacteria 6677
21 Ga0070676_10028501 3300005328 Bacteria 3172
22 Ga0070690_100039405 3300005330 Bacteria 2985
23 Ga0070670_100000739 3300005331 Bacteria 25384
24 Ga0070670_100001970 3300005331 Bacteria 16800
25 Ga0070670_100144875 3300005331 Unclassified 2055
26 Ga0070677_10005025 3300005333 Unclassified 4347
27 Ga0068869_100006951 3300005334 Bacteria 7202
28 Ga0068869_100023702 3300005334 Bacteria 4244
29 Ga0068869_100028807 3300005334 Bacteria 3885
30 Ga0068869_100110217 3300005334 Unclassified 2093
31 Ga0070666_10113394 3300005335 Bacteria 1876
32 Ga0070680_100127644 3300005336 Unclassified 2125
33 Ga0070682_100000053 3300005337 Bacteria 114824
34 Ga0068868_100070355 3300005338 Bacteria 2790
35 Ga0068868_100118742 3300005338 Unclassified 2155
36 Ga0070660_100058007 3300005339 Bacteria 3001
37 Ga0070689_100000228 3300005340 Bacteria 33646
38 Ga0070689_100025047 3300005340 Bacteria 4480
39 Ga0070661_100259870 3300005344 Bacteria 1342
40 Ga0070692_10031989 3300005345 Bacteria 2642
41 Ga0070669_100025928 3300005353 Unclassified 4215
42 Ga0070669_100048981 3300005353 Bacteria 3085
43 Ga0070669_100122106 3300005353 Unclassified 1989
44 Ga0070671_100057651 3300005355 Bacteria 3232
45 Ga0070673_100076060 3300005364 Unclassified 2710
46 Ga0070659_100002273 3300005366 Bacteria 13683
47 Ga0070667_100078989 3300005367 Bacteria 2812
48 Ga0070703_10000059 3300005406 Bacteria 54442
49 Ga0070711_100288049 3300005439 Unclassified 1302
50 Ga0070705_100175170 3300005440 Unclassified 1448
51 Ga0070700_100000569 3300005441 Bacteria 18502
52 Ga0070694_100001922 3300005444 Bacteria 12299
53 Ga0070694_100016906 3300005444 Unclassified 4600
54 Ga0070694_100111551 3300005444 Unclassified 1949
55 Ga0070694_100149155 3300005444 Bacteria 1706
56 Ga0070708_100000088 3300005445 Bacteria 60447
57 Ga0070708_100035240 3300005445 Unclassified 4359
58 Ga0070708_100209984 3300005445 Bacteria 1824
59 Ga0070708_100328750 3300005445 Bacteria 1440
60 Ga0070678_100024738 3300005456 Unclassified 4026
61 Ga0070662_100131086 3300005457 Bacteria 1933
62 Ga0070681_10015191 3300005458 Bacteria 7658
63 Ga0070681_10024780 3300005458 Bacteria 6035
64 Ga0068867_100103744 3300005459 Unclassified 2175
65 Ga0068867_100195650 3300005459 Unclassified 1616
66 Ga0068867_100211213 3300005459 Bacteria 1559
67 Ga0070706_100000044 3300005467 Bacteria 146303
68 Ga0070706_100013079 3300005467 Bacteria 7680
69 Ga0070706_100037767 3300005467 Bacteria 4459
70 Ga0070706_100272184 3300005467 Bacteria 1580
71 Ga0070707_100000295 3300005468 Bacteria 48468
72 Ga0070707_100024286 3300005468 Bacteria 5739
73 Ga0070707_100066106 3300005468 Bacteria 3474
74 Ga0070698_100000302 3300005471 Bacteria 50349
75 Ga0070698_100000857 3300005471 Bacteria 33406
76 Ga0070698_100021486 3300005471 Bacteria 6760
77 Ga0070698_100022131 3300005471 Bacteria 6654
78 Ga0070698_100032220 3300005471 Bacteria 5429
79 Ga0070698_100034683 3300005471 Bacteria 5221
80 Ga0070698_100114648 3300005471 Bacteria 2659
81 Ga0070698_100125146 3300005471 Unclassified 2528
82 Ga0070698_100187407 3300005471 Bacteria 2006
83 Ga0070699_100002843 3300005518 Bacteria 15446
84 Ga0070699_100003368 3300005518 Bacteria 14140
85 Ga0070699_100009363 3300005518 Bacteria 8483
86 Ga0070699_100009653 3300005518 Bacteria 8354
87 Ga0070699_100032774 3300005518 Unclassified 4487
88 Ga0070679_100030221 3300005530 Bacteria 5348
89 Ga0070697_100017634 3300005536 Bacteria 5623
90 Ga0070697_100030111 3300005536 Bacteria 4358
91 Ga0068853_100011588 3300005539 Bacteria 7167
92 Ga0068853_100040739 3300005539 Bacteria 3965
93 Ga0070672_100042596 3300005543 Unclassified 3496
94 Ga0070686_100109460 3300005544 Bacteria 1880
95 Ga0070686_100150639 3300005544 Bacteria 1629
96 Ga0070695_100123282 3300005545 Bacteria 1776
97 Ga0070696_100056412 3300005546 Unclassified 2740
98 Ga0070696_100181754 3300005546 Unclassified 1560
99 Ga0070693_100044443 3300005547 Bacteria 2513
100 Ga0070693_100072510 3300005547 Bacteria 2031
101 Ga0070665_100142629 3300005548 Bacteria 2399
102 Ga0070704_100008763 3300005549 Bacteria 6085
103 Ga0070704_100016614 3300005549 Bacteria 4655
104 Ga0070704_100025177 3300005549 Unclassified 3915
105 Ga0070704_100056704 3300005549 Bacteria 2783
106 Ga0070704_100185076 3300005549 Bacteria 1669
107 Ga0068855_100009160 3300005563 Bacteria 11955
108 Ga0070664_100003825 3300005564 Bacteria 12152
109 Ga0070664_100017325 3300005564 Bacteria 5914
110 Ga0068857_100004594 3300005577 Bacteria 11693
111 Ga0068857_100062153 3300005577 Bacteria 3319
112 Ga0068854_100154092 3300005578 Bacteria 1774
113 Ga0068852_100052966 3300005616 Bacteria 3491
114 Ga0068859_100012155 3300005617 Bacteria 8652
115 Ga0068859_100014043 3300005617 Bacteria 8031
116 Ga0068859_100014303 3300005617 Bacteria 7960
117 Ga0068859_100029722 3300005617 Bacteria 5482
118 Ga0068859_100072946 3300005617 Bacteria 3470
119 Ga0068859_100250948 3300005617 Bacteria 1860
120 Ga0068864_100009677 3300005618 Bacteria 7952
121 Ga0068864_100032553 3300005618 Bacteria 4430
122 Ga0068864_100043197 3300005618 Unclassified 3859
123 Ga0068864_100072506 3300005618 Bacteria 3001
124 Ga0068861_100092962 3300005719 Bacteria 2384
125 Ga0068851_10007463 3300005834 Bacteria 5023
126 Ga0068870_10005061 3300005840 Bacteria 5728
127 Ga0068870_10015038 3300005840 Bacteria 3665
128 Ga0068863_100076969 3300005841 Unclassified 3156
129 Ga0068858_100000565 3300005842 Bacteria 38655
130 Ga0068858_100030625 3300005842 Bacteria 4996
131 Ga0068858_100059826 3300005842 Unclassified 3521
132 Ga0068858_100070773 3300005842 Unclassified 3234
133 Ga0068858_100274567 3300005842 Unclassified 1604
134 Ga0068860_100013902 3300005843 Bacteria 7891
135 Ga0068860_100089168 3300005843 Bacteria 2936
136 Ga0068860_100276099 3300005843 Bacteria 1641
137 Ga0068860_100317238 3300005843 Bacteria 1529
138 Ga0068862_100053382 3300005844 Bacteria 3460
139 Ga0068862_100098951 3300005844 Bacteria 2548
140 Ga0081539_10000022 3300005985 Bacteria 356710
141 Ga0081539_10002342 3300005985 Bacteria 27236
142 Ga0081539_10004578 3300005985 Bacteria 15102
143 Ga0081539_10071099 3300005985 Unclassified 1865
144 Ga0070715_10000005 3300006163 Bacteria 298716
145 Ga0097621_100047169 3300006237 Bacteria 3490
146 Ga0097621_100085067 3300006237 Bacteria 2637
147 Ga0068871_100001909 3300006358 Bacteria 14090
148 Ga0068871_100253520 3300006358 Bacteria 1533
149 Ga0075430_100061117 3300006846 Unclassified 3166
150 Ga0075431_100071881 3300006847 Bacteria 3570
151 Ga0075431_100216475 3300006847 Bacteria 1955
152 Ga0075433_10033063 3300006852 Bacteria 4433
153 Ga0075433_10098057 3300006852 Bacteria 2594
154 Ga0075433_10273141 3300006852 Bacteria 1498
155 Ga0075434_100032170 3300006871 Bacteria 5172
156 Ga0075429_100076720 3300006880 Bacteria 2911
157 Ga0075436_100000005 3300006914 Bacteria 360336
158 Ga0097620_100012155 3300006931 Bacteria 8652
159 Ga0097620_100014043 3300006931 Bacteria 8031
160 Ga0097620_100014302 3300006931 Bacteria 7960
161 Ga0097620_100029722 3300006931 Bacteria 5482
162 Ga0097620_100072949 3300006931 Bacteria 3470
163 Ga0097620_100250938 3300006931 Bacteria 1860
164 Ga0075435_100000378 3300007076 Bacteria 27163
165 Ga0075435_100030138 3300007076 Bacteria 4262
166 Ga0099794_10014630 3300007265 Unclassified 3442
167 Ga0105240_10005234 3300009093 Bacteria 19389
168 Ga0111539_10001823 3300009094 Bacteria 28370
169 Ga0111539_10005448 3300009094 Bacteria 16464
170 Ga0111539_10224689 3300009094 Unclassified 2187
171 Ga0105245_10143684 3300009098 Bacteria 2250
172 Ga0105247_10000003 3300009101 Bacteria 694517
173 Ga0114129_10002864 3300009147 Bacteria 24130
174 Ga0114129_10014663 3300009147 Bacteria 11165
175 Ga0114129_10037695 3300009147 Bacteria 6824
176 Ga0114129_10131173 3300009147 Unclassified 3441
177 Ga0114129_10192388 3300009147 Bacteria 2769
178 Ga0114129_10233076 3300009147 Bacteria 2479
179 Ga0105243_10003281 3300009148 Bacteria 13146
180 Ga0105243_10115178 3300009148 Bacteria 2257
181 Ga0105243_10137837 3300009148 Bacteria 2078
182 Ga0105241_10160623 3300009174 Bacteria 1847
183 Ga0105242_10000007 3300009176 Bacteria 177073
184 Ga0105242_10002365 3300009176 Bacteria 14888
185 Ga0105242_10010619 3300009176 Bacteria 7069
186 Ga0105242_10045987 3300009176 Bacteria 3540
187 Ga0105242_10093938 3300009176 Bacteria 2529
188 Ga0105248_10017799 3300009177 Bacteria 7841
189 Ga0105248_10021045 3300009177 Bacteria 7227
190 Ga0105248_10089068 3300009177 Bacteria 3474
191 Ga0105248_10095965 3300009177 Bacteria 3339
192 Ga0105248_10122222 3300009177 Bacteria 2937
193 Ga0105248_10188453 3300009177 Unclassified 2324
194 Ga0105248_10228013 3300009177 Bacteria 2097
195 Ga0105248_10357125 3300009177 Unclassified 1645
196 Ga0105248_10413886 3300009177 Bacteria 1518
197 Ga0105237_10037993 3300009545 Bacteria 4864
198 Ga0105237_10078650 3300009545 Bacteria 3287
199 Ga0105238_10003265 3300009551 Bacteria 16179
200 Ga0105238_10023112 3300009551 Bacteria 6340
201 Ga0105249_10023063 3300009553 Bacteria 5580
202 Ga0105249_10034607 3300009553 Bacteria 4579
203 Ga0105249_10037069 3300009553 Unclassified 4425
204 Ga0105239_10140762 3300010375 Bacteria 2688
205 Ga0105246_10024150 3300011119 Bacteria 3945
206 Ga0157373_10051730 3300013100 Bacteria 2925
207 Ga0157373_10100972 3300013100 Bacteria 2030
208 Ga0157370_10060474 3300013104 Bacteria 3597
209 Ga0157374_10021074 3300013296 Bacteria 5793
210 Ga0157378_10000028 3300013297 Bacteria 128346
211 Ga0157378_10016840 3300013297 Bacteria 6407
212 Ga0157378_10027553 3300013297 Bacteria 5012
213 Ga0157378_10213936 3300013297 Unclassified 1829
214 Ga0157378_10334090 3300013297 Bacteria 1476
215 Ga0157378_10430315 3300013297 Bacteria 1306
216 Ga0163162_10000019 3300013306 Bacteria 220603
217 Ga0163162_10002140 3300013306 Bacteria 18529
218 Ga0163162_10007396 3300013306 Bacteria 10679
219 Ga0163162_10138482 3300013306 Unclassified 2545
220 Ga0163162_10239820 3300013306 Bacteria 1944
221 Ga0157372_10039956 3300013307 Bacteria 5180
222 Ga0157372_10174568 3300013307 Bacteria 2487
223 Ga0157372_10223105 3300013307 Bacteria 2185
224 Ga0157375_10018240 3300013308 Bacteria 6360
225 Ga0157375_10436228 3300013308 Bacteria 1476
226 Ga0157375_10446650 3300013308 Bacteria 1459
227 Ga0163163_10000983 3300014325 Bacteria 24185
228 Ga0163163_10031341 3300014325 Bacteria 5130
229 Ga0163163_10049769 3300014325 Bacteria 4125
230 Ga0163163_10179625 3300014325 Bacteria 2163
231 Ga0163163_10309467 3300014325 Unclassified 1632
232 Ga0157380_10002038 3300014326 Bacteria 13514
233 Ga0157380_10010125 3300014326 Bacteria 6774
234 Ga0157380_10013487 3300014326 Bacteria 5960
235 Ga0157380_10125013 3300014326 Unclassified 2184
236 Ga0157380_10200437 3300014326 Unclassified 1770
237 Ga0157377_10107086 3300014745 Unclassified 1675
238 Ga0157379_10026966 3300014968 Bacteria 5113
239 Ga0157376_10037023 3300014969 Bacteria 3956
240 Ga0163161_10000782 3300017792 Bacteria 25019
241 Ga0163161_10006671 3300017792 Bacteria 7990
242 Ga0213876_10000024 3300021384 Bacteria 237488
243 Ga0213876_10000347 3300021384 Bacteria 39952
244 Ga0213876_10034950 3300021384 Bacteria 2651
245 Ga0207672_1000486 3300025223 Bacteria 4991
246 Ga0207656_10019672 3300025321 Unclassified 2673
247 Ga0207653_10000095 3300025885 Bacteria 64003
248 Ga0207710_10000001 3300025900 Bacteria 1797433
249 Ga0207647_10041729 3300025904 Bacteria 2883
250 Ga0207685_10000026 3300025905 Bacteria 109892
251 Ga0207645_10087444 3300025907 Bacteria 2003
252 Ga0207643_10010333 3300025908 Bacteria 5025
253 Ga0207643_10027589 3300025908 Unclassified 3148
254 Ga0207705_10020853 3300025909 Unclassified 4678
255 Ga0207684_10001881 3300025910 Bacteria 21837
256 Ga0207684_10007446 3300025910 Bacteria 9851
257 Ga0207684_10094864 3300025910 Bacteria 2545
258 Ga0207707_10021337 3300025912 Bacteria 5662
259 Ga0207707_10034384 3300025912 Bacteria 4434
260 Ga0207695_10066657 3300025913 Bacteria 3696
261 Ga0207671_10037332 3300025914 Bacteria 3603
262 Ga0207671_10125759 3300025914 Bacteria 1964
263 Ga0207660_10044043 3300025917 Unclassified 3139
264 Ga0207662_10025093 3300025918 Bacteria 3432
265 Ga0207652_10168072 3300025921 Bacteria 1967
266 Ga0207646_10001466 3300025922 Bacteria 29185
267 Ga0207646_10002401 3300025922 Bacteria 22102
268 Ga0207646_10004509 3300025922 Bacteria 15086
269 Ga0207646_10036869 3300025922 Bacteria 4412
270 Ga0207681_10000856 3300025923 Bacteria 19992
271 Ga0207681_10035907 3300025923 Unclassified 3267
272 Ga0207694_10034854 3300025924 Bacteria 3860
273 Ga0207694_10104533 3300025924 Unclassified 2247
274 Ga0207650_10000028 3300025925 Bacteria 236867
275 Ga0207650_10000526 3300025925 Bacteria 31386
276 Ga0207644_10055551 3300025931 Bacteria 2854
277 Ga0207706_10142728 3300025933 Bacteria 2106
278 Ga0207686_10000002 3300025934 Bacteria 453961
279 Ga0207686_10001017 3300025934 Bacteria 16600
280 Ga0207686_10002861 3300025934 Bacteria 9306
281 Ga0207709_10000027 3300025935 Bacteria 339731
282 Ga0207709_10002075 3300025935 Bacteria 12925
283 Ga0207709_10066680 3300025935 Bacteria 2268
284 Ga0207670_10000207 3300025936 Bacteria 38519
285 Ga0207670_10012177 3300025936 Bacteria 5021
286 Ga0207704_10048256 3300025938 Unclassified 2551
287 Ga0207691_10038661 3300025940 Bacteria 4416
288 Ga0207711_10009753 3300025941 Bacteria 7989
289 Ga0207711_10041042 3300025941 Bacteria 3939
290 Ga0207711_10182509 3300025941 Bacteria 1909
291 Ga0207711_10355309 3300025941 Bacteria 1357
292 Ga0207689_10019390 3300025942 Bacteria 5733
293 Ga0207689_10065338 3300025942 Bacteria 2992
294 Ga0207689_10095445 3300025942 Unclassified 2442
295 Ga0207679_10007697 3300025945 Bacteria 6843
296 Ga0207679_10091146 3300025945 Bacteria 2358
297 Ga0207667_10195943 3300025949 Bacteria 2073
298 Ga0207651_10135872 3300025960 Unclassified 1891
299 Ga0207712_10000068 3300025961 Bacteria 130032
300 Ga0207712_10045275 3300025961 Bacteria 3046
301 Ga0207712_10147667 3300025961 Bacteria 1812
302 Ga0207640_10041263 3300025981 Bacteria 2934
303 Ga0207658_10037489 3300025986 Bacteria 3485
304 Ga0207677_10029177 3300026023 Unclassified 3502
305 Ga0207703_10001649 3300026035 Bacteria 20087
306 Ga0207703_10040317 3300026035 Unclassified 3737
307 Ga0207703_10162250 3300026035 Unclassified 1958
308 Ga0207703_10276429 3300026035 Bacteria 1523
309 Ga0207639_10052477 3300026041 Unclassified 3107
310 Ga0207639_10118325 3300026041 Bacteria 2172
311 Ga0207708_10000386 3300026075 Bacteria 34516
312 Ga0207708_10010665 3300026075 Bacteria 6825
313 Ga0207708_10103269 3300026075 Unclassified 2208
314 Ga0207702_10242746 3300026078 Bacteria 1688
315 Ga0207641_10066317 3300026088 Bacteria 3090
316 Ga0207641_10084571 3300026088 Bacteria 2762
317 Ga0207641_10159693 3300026088 Unclassified 2048
318 Ga0207648_10239114 3300026089 Unclassified 1616
319 Ga0207676_10012506 3300026095 Bacteria 6084
320 Ga0207676_10022641 3300026095 Bacteria 4622
321 Ga0207676_10031499 3300026095 Unclassified 3990
322 Ga0207676_10071379 3300026095 Unclassified 2788
323 Ga0207674_10000790 3300026116 Bacteria 41276
324 Ga0207674_10013143 3300026116 Bacteria 9213
325 Ga0207674_10053921 3300026116 Bacteria 4096
326 Ga0207674_10107073 3300026116 Unclassified 2773
327 Ga0207674_10214580 3300026116 Bacteria 1873
328 Ga0207674_10246480 3300026116 Unclassified 1734
329 Ga0207675_100001608 3300026118 Bacteria 22636
330 Ga0207675_100038158 3300026118 Bacteria 4482
331 Ga0207675_100192678 3300026118 Bacteria 1955
332 Ga0207675_100215284 3300026118 Bacteria 1849
333 Ga0207675_100240361 3300026118 Bacteria 1750
334 Ga0207683_10015454 3300026121 Bacteria 6502
335 Ga0207428_10003507 3300027907 Bacteria 15190
336 Ga0268265_10125092 3300028380 Bacteria 2126
337 Ga0268264_10018284 3300028381 Bacteria 5733
338 Ga0268264_10054522 3300028381 Bacteria 3338
339 Ga0268264_10273869 3300028381 Bacteria 1578
340 Ga0265770_1002316 3300030878 Bacteria 2591
341 Ga0307513_10002148 3300031456 Bacteria 27570
342 Ga0307408_100103290 3300031548 Bacteria 2175
343 Ga0307405_10077557 3300031731 Bacteria 2160
344 Ga0307413_10014722 3300031824 Bacteria 3984
345 Ga0307413_10020825 3300031824 Unclassified 3497
346 Ga0307410_10057895 3300031852 Unclassified 2640
347 Ga0307410_10269633 3300031852 Bacteria 1331
348 Ga0307406_10011382 3300031901 Bacteria 5048
349 Ga0307406_10115939 3300031901 Bacteria 1852
350 Ga0307407_10020385 3300031903 Unclassified 3396
351 Ga0307412_10023683 3300031911 Unclassified 3781
352 Ga0307409_100053275 3300031995 Bacteria 3108
353 Ga0307409_100131366 3300031995 Unclassified 2140
354 Ga0307416_100037197 3300032002 Bacteria 3742
355 Ga0307414_10002951 3300032004 Bacteria 8990
356 Ga0307411_10103308 3300032005 Unclassified 2021
357 Ga0307415_100053867 3300032126 Unclassified 2743
358 Ga0373951_0014114 3300035091 Bacteria 1794
359 Ga0373956_0001785 3300035119 Bacteria 8869
360 Ga0373933_0000039 3300035724 Bacteria 80657
361 Ga0373937_0000072 3300036401 Bacteria 92459
362 Ga0395900_0083688 3300037418 Bacteria 3278
363 Ga0395900_0228790 3300037418 Bacteria 1871
364 Ga0395900_0265202 3300037418 Unclassified 1714
365 Ga0395898_0425854 3300037466 Unclassified 1265
366 Ga0395905_0015108 3300037471 Bacteria 7350
367 Ga0395905_0077255 3300037471 Bacteria 3120
368 Ga0395901_0590578 3300038443 Unclassified 1121
369 Ga0436365_0289912 3300039437 Bacteria 336570
370 Ga0436365_0723872 3300039437 Bacteria 4090
371 Ga0436365_1744743 3300039437 Bacteria 193023
372 Ga0439455_0001969 3300042012 Unclassified 3622
373 Ga0439464_0017451 3300042439 Unclassified 1947
374 Ga0495651_0010411 3300046462 Bacteria 7146
375 Ga0495653_0135888 3300046463 Unclassified 1735
376 Ga0495663_0000223 3300046525 Bacteria 22614
377 Ga0495587_0030815 3300046536 Unclassified 3251
378 Ga0495598_0000279 3300046537 Bacteria 9216
379 Ga0495621_0000462 3300046539 Bacteria 9951
380 Ga0495672_0131466 3300047320 Bacteria 1316
381 Ga0495675_0027100 3300047444 Bacteria 3652
382 Ga0495602_0000183 3300048088 Bacteria 58980
383 Ga0496106_0019558 3300048909 Bacteria 5024
384 Ga0496106_0051833 3300048909 Bacteria 3095
385 Ga0496112_0056027 3300048915 Bacteria 3879
386 Ga0501290_004537 3300049513 Bacteria 1730
387 Ga0501296_005840 3300049519 Bacteria 1383
388 Ga0501067_0147512 3300049583 Bacteria 1311
389 Ga0501216_001279 3300049660 Bacteria 3366
390 Ga0501217_000250 3300049661 Bacteria 8329
391 Ga0501217_020401 3300049661 Bacteria 1556
392 Ga0501223_002014 3300049663 Bacteria 4557
393 Ga0501227_000481 3300049665 Bacteria 8499
394 Ga0501235_001782 3300049669 Bacteria 4615
395 Ga0501235_010929 3300049669 Bacteria 1987
396 Ga0501225_0001977 3300049705 Bacteria 6403
397 Ga0501234_001274 3300049707 Bacteria 3959
398 Ga0501226_000330 3300049853 Bacteria 6940
399 nmdc:mga05p37_57242_c1 3300050507 Bacteria 4801
400 nmdc:mga05p37_5971_c1 3300050507 Bacteria 14330
401 nmdc:mga09592_166319_c1 3300050508 Unclassified 1906
402 nmdc:mga06r32_129603_c1 3300050510 Bacteria 2493
403 nmdc:mga08y16_1720_c1 3300050511 Bacteria 22215
404 nmdc:mga08y16_301020_c1 3300050511 Unclassified 1653
405 nmdc:mga08y16_88042_c1 3300050511 Bacteria 3236
406 nmdc:mga0n895_186839_c1 3300050512 Bacteria 2103
407 nmdc:mga0n895_195471_c1 3300050512 Bacteria 2054
408 nmdc:mga0n895_23966_c1 3300050512 Bacteria 5744
409 nmdc:mga0rr50_172_c1 3300050513 Bacteria 34462
410 nmdc:mga08x19_122_c1 3300050514 Bacteria 69668
411 nmdc:mga0a205_123228_c1 3300050515 Bacteria 2492
412 nmdc:mga0a205_178367_c1 3300050515 Unclassified 2019
413 nmdc:mga0a205_208161_c1 3300050515 Unclassified 1845
414 Ga0500616_0000378 3300053153 Bacteria 62462
415 Ga0070686_100043090
416 LJQas_1000190
417 JGI24030J14995_100180
418 JGI24748J21848_1000005
419 JGI24034J26672_10000003
420 JGI24751J29686_10000006
421 JGI25406J46586_10003991
422 JGI25406J46586_10007037
423 Ga0065714_10064454
424 Ga0065704_10076020
425 Ga0065704_10140902
426 Ga0065704_10148622
427 Ga0065712_10000129
428 Ga0065712_10002929
429 Ga0065712_10110053
430 Ga0065715_10095797
431 Ga0065707_10002257
432 Ga0065707_10087607
433 Ga0065707_10117859
434 Ga0070658_10013015
435 Ga0070676_10028501
436 Ga0070690_100039405
437 Ga0070670_100000739
438 Ga0070670_100001970
439 Ga0070670_100144875
440 Ga0070677_10005025
441 Ga0068869_100006951
442 Ga0068869_100023702
443 Ga0068869_100028807
444 Ga0068869_100110217
445 Ga0070666_10113394
446 Ga0070680_100127644
447 Ga0070682_100000053
448 Ga0068868_100070355
449 Ga0068868_100118742
450 Ga0070660_100058007
451 Ga0070689_100000228
452 Ga0070689_100025047
453 Ga0070661_100259870
454 Ga0070692_10031989
455 Ga0070669_100025928
456 Ga0070669_100048981
457 Ga0070669_100122106
458 Ga0070671_100057651
459 Ga0070673_100076060
460 Ga0070659_100002273
461 Ga0070667_100078989
462 Ga0070703_10000059
463 Ga0070711_100288049
464 Ga0070705_100175170
465 Ga0070700_100000569
466 Ga0070694_100001922
467 Ga0070694_100016906
468 Ga0070694_100111551
469 Ga0070694_100149155
470 Ga0070708_100000088
471 Ga0070708_100035240
472 Ga0070708_100209984
473 Ga0070708_100328750
474 Ga0070678_100024738
475 Ga0070662_100131086
476 Ga0070681_10015191
477 Ga0070681_10024780
478 Ga0068867_100103744
479 Ga0068867_100195650
480 Ga0068867_100211213
481 Ga0070706_100000044
482 Ga0070706_100013079
483 Ga0070706_100037767
484 Ga0070706_100272184
485 Ga0070707_100000295
486 Ga0070707_100024286
487 Ga0070707_100066106
488 Ga0070698_100000302
489 Ga0070698_100000857
490 Ga0070698_100021486
491 Ga0070698_100022131
492 Ga0070698_100032220
493 Ga0070698_100034683
494 Ga0070698_100114648
495 Ga0070698_100125146
496 Ga0070698_100187407
497 Ga0070699_100002843
498 Ga0070699_100003368
499 Ga0070699_100009363
500 Ga0070699_100009653
501 Ga0070699_100032774
502 Ga0070679_100030221
503 Ga0070697_100017634
504 Ga0070697_100030111
505 Ga0068853_100011588
506 Ga0068853_100040739
507 Ga0070672_100042596
508 Ga0070686_100109460
509 Ga0070686_100150639
510 Ga0070695_100123282
511 Ga0070696_100056412
512 Ga0070696_100181754
513 Ga0070693_100044443
514 Ga0070693_100072510
515 Ga0070665_100142629
516 Ga0070704_100008763
517 Ga0070704_100016614
518 Ga0070704_100025177
519 Ga0070704_100056704
520 Ga0070704_100185076
521 Ga0068855_100009160
522 Ga0070664_100003825
523 Ga0070664_100017325
524 Ga0068857_100004594
525 Ga0068857_100062153
526 Ga0068854_100154092
527 Ga0068852_100052966
528 Ga0068859_100012155
529 Ga0068859_100014043
530 Ga0068859_100014303
531 Ga0068859_100029722
532 Ga0068859_100072946
533 Ga0068859_100250948
534 Ga0068864_100009677
535 Ga0068864_100032553
536 Ga0068864_100043197
537 Ga0068864_100072506
538 Ga0068861_100092962
539 Ga0068851_10007463
540 Ga0068870_10005061
541 Ga0068870_10015038
542 Ga0068863_100076969
543 Ga0068858_100000565
544 Ga0068858_100030625
545 Ga0068858_100059826
546 Ga0068858_100070773
547 Ga0068858_100274567
548 Ga0068860_100013902
549 Ga0068860_100089168
550 Ga0068860_100276099
551 Ga0068860_100317238
552 Ga0068862_100053382
553 Ga0068862_100098951
554 Ga0081539_10000022
555 Ga0081539_10002342
556 Ga0081539_10004578
557 Ga0081539_10071099
558 Ga0070715_10000005
559 Ga0097621_100047169
560 Ga0097621_100085067
561 Ga0068871_100001909
562 Ga0068871_100253520
563 Ga0075430_100061117
564 Ga0075431_100071881
565 Ga0075431_100216475
566 Ga0075433_10033063
567 Ga0075433_10098057
568 Ga0075433_10273141
569 Ga0075434_100032170
570 Ga0075429_100076720
571 Ga0075436_100000005
572 Ga0097620_100012155
573 Ga0097620_100014043
574 Ga0097620_100014302
575 Ga0097620_100029722
576 Ga0097620_100072949
577 Ga0097620_100250938
578 Ga0075435_100000378
579 Ga0075435_100030138
580 Ga0099794_10014630
581 Ga0105240_10005234
582 Ga0111539_10001823
583 Ga0111539_10005448
584 Ga0111539_10224689
585 Ga0105245_10143684
586 Ga0105247_10000003
587 Ga0114129_10002864
588 Ga0114129_10014663
589 Ga0114129_10037695
590 Ga0114129_10131173
591 Ga0114129_10192388
592 Ga0114129_10233076
593 Ga0105243_10003281
594 Ga0105243_10115178
595 Ga0105243_10137837
596 Ga0105241_10160623
597 Ga0105242_10000007
598 Ga0105242_10002365
599 Ga0105242_10010619
600 Ga0105242_10045987
601 Ga0105242_10093938
602 Ga0105248_10017799
603 Ga0105248_10021045
604 Ga0105248_10089068
605 Ga0105248_10095965
606 Ga0105248_10122222
607 Ga0105248_10188453
608 Ga0105248_10228013
609 Ga0105248_10357125
610 Ga0105248_10413886
611 Ga0105237_10037993
612 Ga0105237_10078650
613 Ga0105238_10003265
614 Ga0105238_10023112
615 Ga0105249_10023063
616 Ga0105249_10034607
617 Ga0105249_10037069
618 Ga0105239_10140762
619 Ga0105246_10024150
620 Ga0157373_10051730
621 Ga0157373_10100972
622 Ga0157370_10060474
623 Ga0157374_10021074
624 Ga0157378_10000028
625 Ga0157378_10016840
626 Ga0157378_10027553
627 Ga0157378_10213936
628 Ga0157378_10334090
629 Ga0157378_10430315
630 Ga0163162_10000019
631 Ga0163162_10002140
632 Ga0163162_10007396
633 Ga0163162_10138482
634 Ga0163162_10239820
635 Ga0157372_10039956
636 Ga0157372_10174568
637 Ga0157372_10223105
638 Ga0157375_10018240
639 Ga0157375_10436228
640 Ga0157375_10446650
641 Ga0163163_10000983
642 Ga0163163_10031341
643 Ga0163163_10049769
644 Ga0163163_10179625
645 Ga0163163_10309467
646 Ga0157380_10002038
647 Ga0157380_10010125
648 Ga0157380_10013487
649 Ga0157380_10125013
650 Ga0157380_10200437
651 Ga0157377_10107086
652 Ga0157379_10026966
653 Ga0157376_10037023
654 Ga0163161_10000782
655 Ga0163161_10006671
656 Ga0213876_10000024
657 Ga0213876_10000347
658 Ga0213876_10034950
659 Ga0207672_1000486
660 Ga0207656_10019672
661 Ga0207653_10000095
662 Ga0207710_10000001
663 Ga0207647_10041729
664 Ga0207685_10000026
665 Ga0207645_10087444
666 Ga0207643_10010333
667 Ga0207643_10027589
668 Ga0207705_10020853
669 Ga0207684_10001881
670 Ga0207684_10007446
671 Ga0207684_10094864
672 Ga0207707_10021337
673 Ga0207707_10034384
674 Ga0207695_10066657
675 Ga0207671_10037332
676 Ga0207671_10125759
677 Ga0207660_10044043
678 Ga0207662_10025093
679 Ga0207652_10168072
680 Ga0207646_10001466
681 Ga0207646_10002401
682 Ga0207646_10004509
683 Ga0207646_10036869
684 Ga0207681_10000856
685 Ga0207681_10035907
686 Ga0207694_10034854
687 Ga0207694_10104533
688 Ga0207650_10000028
689 Ga0207650_10000526
690 Ga0207644_10055551
691 Ga0207706_10142728
692 Ga0207686_10000002
693 Ga0207686_10001017
694 Ga0207686_10002861
695 Ga0207709_10000027
696 Ga0207709_10002075
697 Ga0207709_10066680
698 Ga0207670_10000207
699 Ga0207670_10012177
700 Ga0207704_10048256
701 Ga0207691_10038661
702 Ga0207711_10009753
703 Ga0207711_10041042
704 Ga0207711_10182509
705 Ga0207711_10355309
706 Ga0207689_10019390
707 Ga0207689_10065338
708 Ga0207689_10095445
709 Ga0207679_10007697
710 Ga0207679_10091146
711 Ga0207667_10195943
712 Ga0207651_10135872
713 Ga0207712_10000068
714 Ga0207712_10045275
715 Ga0207712_10147667
716 Ga0207640_10041263
717 Ga0207658_10037489
718 Ga0207677_10029177
719 Ga0207703_10001649
720 Ga0207703_10040317
721 Ga0207703_10162250
722 Ga0207703_10276429
723 Ga0207639_10052477
724 Ga0207639_10118325
725 Ga0207708_10000386
726 Ga0207708_10010665
727 Ga0207708_10103269
728 Ga0207702_10242746
729 Ga0207641_10066317
730 Ga0207641_10084571
731 Ga0207641_10159693
732 Ga0207648_10239114
733 Ga0207676_10012506
734 Ga0207676_10022641
735 Ga0207676_10031499
736 Ga0207676_10071379
737 Ga0207674_10000790
738 Ga0207674_10013143
739 Ga0207674_10053921
740 Ga0207674_10107073
741 Ga0207674_10214580
742 Ga0207674_10246480
743 Ga0207675_100001608
744 Ga0207675_100038158
745 Ga0207675_100192678
746 Ga0207675_100215284
747 Ga0207675_100240361
748 Ga0207683_10015454
749 Ga0207428_10003507
750 Ga0268265_10125092
751 Ga0268264_10018284
752 Ga0268264_10054522
753 Ga0268264_10273869
754 Ga0265770_1002316
755 Ga0307513_10002148
756 Ga0307408_100103290
757 Ga0307405_10077557
758 Ga0307413_10014722
759 Ga0307413_10020825
760 Ga0307410_10057895
761 Ga0307410_10269633
762 Ga0307406_10011382
763 Ga0307406_10115939
764 Ga0307407_10020385
765 Ga0307412_10023683
766 Ga0307409_100053275
767 Ga0307409_100131366
768 Ga0307416_100037197
769 Ga0307414_10002951
770 Ga0307411_10103308
771 Ga0307415_100053867
772 Ga0373951_0014114
773 Ga0373956_0001785
774 Ga0373933_0000039
775 Ga0373937_0000072
776 Ga0395900_0083688
777 Ga0395900_0228790
778 Ga0395900_0265202
779 Ga0395898_0425854
780 Ga0395905_0015108
781 Ga0395905_0077255
782 Ga0395901_0590578
783 Ga0436365_0289912
784 Ga0436365_0723872
785 Ga0436365_1744743
786 Ga0439455_0001969
787 Ga0439464_0017451
788 Ga0495651_0010411
789 Ga0495653_0135888
790 Ga0495663_0000223
791 Ga0495587_0030815
792 Ga0495598_0000279
793 Ga0495621_0000462
794 Ga0495672_0131466
795 Ga0495675_0027100
796 Ga0495602_0000183
797 Ga0496106_0019558
798 Ga0496106_0051833
799 Ga0496112_0056027
800 Ga0501290_004537
801 Ga0501296_005840
802 Ga0501067_0147512
803 Ga0501216_001279
804 Ga0501217_000250
805 Ga0501217_020401
806 Ga0501223_002014
807 Ga0501227_000481
808 Ga0501235_001782
809 Ga0501235_010929
810 Ga0501225_0001977
811 Ga0501234_001274
812 Ga0501226_000330
813 nmdc:mga05p37_57242_c1
814 nmdc:mga05p37_5971_c1
815 nmdc:mga09592_166319_c1
816 nmdc:mga06r32_129603_c1
817 nmdc:mga08y16_1720_c1
818 nmdc:mga08y16_301020_c1
819 nmdc:mga08y16_88042_c1
820 nmdc:mga0n895_186839_c1
821 nmdc:mga0n895_195471_c1
822 nmdc:mga0n895_23966_c1
823 nmdc:mga0rr50_172_c1
824 nmdc:mga08x19_122_c1
825 nmdc:mga0a205_123228_c1
826 nmdc:mga0a205_178367_c1
827 nmdc:mga0a205_208161_c1
828 Ga0500616_0000378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13506

Glyco_transf_21

Glycosyl transferase family 21

132

306

0.86

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

122

309

0.79

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

166

409

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
6te3-assembly1.cif.gz_A crystal structure of full-length human lysyl hydroxylase lh3 - cocrystal with fe2+, mn2+, udp 0.6712 43 251
7sp6-assembly1.cif.gz_A chlorella virus hyaluronan synthase 0.6703 5 380
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.6703 25 261
7sp7-assembly1.cif.gz_A chlorella virus hyaluronan synthase inhibited by udp 0.6677 5 380
1h7q-assembly1.cif.gz_A dtdp-manganese complex of spsa from bacillus subtilis 0.6566 45 266
ID Description Score Start End Superfamily
af_K7KRR5_71_304_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9237 43 262 3.90.550.10
af_K7KRR5_71_304_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8668 43 262 3.90.550.10
af_F1QNT4_83_310_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8632 36 258 3.90.550.10
af_I1J4I9_70_344_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8619 39 298 3.90.550.10
af_Q21054_95_328_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8462 27 263 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3M2D3W0-F1-model_v4 Glycosyltransferase 0.9926 1 394 GO:0006679
GO:0008120
GO:0016020
AF-A0A2V8STD4-F1-model_v4 Glycosyltransferase 0.9914 1 406 GO:0006679
GO:0008120
GO:0016020
AF-A0A2V8STD4-F1-model_v4 Glycosyltransferase 0.9865 1 406 GO:0006679
GO:0008120
GO:0016020
AF-A0A7Y2DTC4-F1-model_v4 Glycosyltransferase family 2 protein 0.984 3 406 GO:0006679
GO:0008120
GO:0016020
AF-A0A3M2D3W0-F1-model_v4 Glycosyltransferase 0.9825 1 394 GO:0006679
GO:0008120
GO:0016020

Map