F438236

General Info

Members Datasets Scaffolds Average Seq Length
414 261 368 201

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100011280|Ga0068869_1000112803
Length 202
Sequence MNVTKDYDRRYFDRWYREDDAGVGRGALLRRKVALAVAMAEHYLGRPLRSVLDVGCGEGAWRAPLLKLRPKLAYLGVDSSEYAVARYGAKRNLRLVHFRQLGELRLGAPVDLLVCADVLHYLPAADLRHGLSGFADAVEGDKHGFIPRSAAFYRQAIAAAGFTACGSHGYLSPTLAADAVALELAAPVAKTRARRSRGPGFE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221727 Lysobacter sp. Root96 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2739367700 Dyella sp. YR388 Isolate Unclassified
14 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
17 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
18 2818991457 Xanthomonas translucens 569 Isolate Unclassified
19 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
20 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
21 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
22 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
23 2884411467 Dyella sp. AD56 Isolate Rhizosphere
24 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
25 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
26 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
27 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
28 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
29 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
30 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
31 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
32 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
33 2928963466 Dyella japonica 1073 Isolate Unclassified
34 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
35 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
36 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
37 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
38 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
39 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
40 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
41 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
42 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
43 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
49 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
56 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
103 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
115 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
118 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
173 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
182 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
183 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
192 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
193 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
194 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
195 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
254 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
258 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
259 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
260 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
261 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.89
Metatranscriptomes 0
Isolates 11.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.95
Nodule 0.24
Rhizoplane 4.83
Rhizosphere 50.72
Stem 0
Stem Tuber 0
Unclassified 21.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2389512 2162886007 Bacteria 4301
2 JGI24735J21928_10001248 3300002067 Bacteria 9035
3 JGI25156J39149_1008673 3300002705 Bacteria 2537
4 JGI25162J39368_1000260 3300002737 Bacteria 50536
5 JGI25162J39368_1003520 3300002737 Unclassified 4440
6 JGI25157J39369_1000867 3300002741 Bacteria 14653
7 JGI25163J39215_1002529 3300002771 Bacteria 1833
8 JGI25164J39214_1000133 3300002772 Bacteria 71595
9 JGI25151J46595_10027857 3300003187 Bacteria 2258
10 JGI25165J46597_1000255 3300003214 Bacteria 71595
11 rootH2_10017930 3300003320 Bacteria 6833
12 rootH2_10041321 3300003320 Bacteria 1933
13 rootL2_10291567 3300003322 Bacteria 1912
14 rootH1_10167707 3300003323 Bacteria 1474
15 Ga0055538_1000340 3300003751 Bacteria 20779
16 Ga0055533_1001312 3300003756 Bacteria 6757
17 Ga0055535_1001910 3300003761 Bacteria 8751
18 Ga0055535_1001965 3300003761 Bacteria 8529
19 Ga0055542_1000082 3300003762 Bacteria 128120
20 Ga0055542_1000327 3300003762 Bacteria 50536
21 Ga0055529_1000228 3300003763 Bacteria 71595
22 Ga0055537_1000007 3300003773 Bacteria 144691
23 Ga0055524_1000034 3300003775 Bacteria 180672
24 Ga0055524_1010699 3300003775 Bacteria 3635
25 Ga0055524_1042936 3300003775 Bacteria 1118
26 Ga0055536_1000574 3300003781 Bacteria 25068
27 Ga0055536_1013863 3300003781 Bacteria 2872
28 Ga0055534_1000013 3300003784 Bacteria 151209
29 Ga0055528_1000005 3300003790 Bacteria 236316
30 Ga0055528_1059521 3300003790 Bacteria 727
31 Ga0055540_1047305 3300003792 Bacteria 901
32 Ga0055531_10003850 3300003794 Bacteria 9393
33 Ga0055531_10009651 3300003794 Bacteria 4909
34 Ga0055531_10028574 3300003794 Bacteria 1919
35 Ga0055531_10043779 3300003794 Bacteria 1263
36 Ga0055531_10067946 3300003794 Bacteria 836
37 Ga0058692_1000020 3300003856 Bacteria 250589
38 Ga0065704_10071577 3300005289 Bacteria 10644
39 Ga0065715_10097858 3300005293 Bacteria 3639
40 Ga0070670_100016085 3300005331 Bacteria 6421
41 Ga0068869_100011280 3300005334 Bacteria 5855
42 Ga0070660_100408419 3300005339 Bacteria 1123
43 Ga0070689_100004531 3300005340 Bacteria 9407
44 Ga0070668_100013066 3300005347 Bacteria 6185
45 Ga0070668_100281981 3300005347 Bacteria 1388
46 Ga0070668_100658954 3300005347 Bacteria 920
47 Ga0070669_100026442 3300005353 Bacteria 4175
48 Ga0070688_100020859 3300005365 Bacteria 3818
49 Ga0070662_100853017 3300005457 Bacteria 776
50 Ga0070681_10456033 3300005458 Bacteria 1191
51 Ga0070685_10410080 3300005466 Bacteria 940
52 Ga0070679_100033075 3300005530 Bacteria 5118
53 Ga0068853_100456546 3300005539 Bacteria 1202
54 Ga0070672_100038786 3300005543 Bacteria 3643
55 Ga0070693_100141065 3300005547 Bacteria 1517
56 Ga0070693_100490099 3300005547 Bacteria 870
57 Ga0070665_100218154 3300005548 Bacteria 1908
58 Ga0070665_101043014 3300005548 Bacteria 830
59 Ga0068855_101000094 3300005563 Bacteria 879
60 Ga0070664_100511850 3300005564 Bacteria 1107
61 Ga0068859_100220955 3300005617 Bacteria 1982
62 Ga0068863_100494432 3300005841 Bacteria 1204
63 Ga0068860_100304993 3300005843 Bacteria 1561
64 Ga0068862_100308318 3300005844 Bacteria 1458
65 Ga0075365_10104844 3300006038 Bacteria 1939
66 Ga0075364_10000206 3300006051 Bacteria 27651
67 Ga0075369_10005753 3300006186 Bacteria 4654
68 Ga0097620_100220965 3300006931 Bacteria 1982
69 Ga0105251_10000010 3300009011 Bacteria 186242
70 Ga0105244_10122571 3300009036 Bacteria 1258
71 Ga0105244_10134560 3300009036 Bacteria 1191
72 Ga0105240_10040273 3300009093 Bacteria 5977
73 Ga0111539_10791903 3300009094 Bacteria 1103
74 Ga0105243_10009736 3300009148 Bacteria 7320
75 Ga0105243_10033621 3300009148 Bacteria 3966
76 Ga0105248_10012500 3300009177 Bacteria 9364
77 Ga0105237_11550522 3300009545 Bacteria 669
78 Ga0105029_100728 3300009984 Bacteria 1849
79 Ga0105028_102719 3300009993 Bacteria 1859
80 Ga0157373_10440348 3300013100 Bacteria 937
81 Ga0157371_10023740 3300013102 Bacteria 4483
82 Ga0157371_10046717 3300013102 Bacteria 3079
83 Ga0157371_10100863 3300013102 Bacteria 2048
84 Ga0157371_10126679 3300013102 Bacteria 1816
85 Ga0157370_10070903 3300013104 Bacteria 3288
86 Ga0157370_10200647 3300013104 Bacteria 1850
87 Ga0157370_10486168 3300013104 Bacteria 1134
88 Ga0157370_10553244 3300013104 Bacteria 1055
89 Ga0157370_10554162 3300013104 Bacteria 1054
90 Ga0157370_10961242 3300013104 Bacteria 774
91 Ga0157369_10052643 3300013105 Bacteria 4404
92 Ga0157374_10078704 3300013296 Bacteria 3123
93 Ga0163162_10416403 3300013306 Bacteria 1476
94 Ga0157372_10193970 3300013307 Bacteria 2353
95 Ga0157380_10062398 3300014326 Bacteria 2985
96 Ga0157376_10025383 3300014969 Bacteria 4666
97 Ga0182005_1003607 3300015265 Bacteria 5203
98 Ga0183368_1004 3300015687 Bacteria 1211761
99 Ga0183360_10001 3300015689 Bacteria 3943671
100 Ga0163161_10603042 3300017792 Bacteria 905
101 Ga0209435_107577 3300025206 Bacteria 1200
102 Ga0209760_100357 3300025207 Bacteria 12636
103 Ga0209784_100133 3300025224 Bacteria 72169
104 Ga0209674_100269 3300025226 Bacteria 39856
105 Ga0209672_105542 3300025228 Bacteria 2150
106 Ga0209672_106011 3300025228 Bacteria 2020
107 Ga0207427_100013 3300025231 Bacteria 581419
108 Ga0207427_109343 3300025231 Bacteria 1059
109 Ga0209437_100015 3300025233 Bacteria 713457
110 Ga0209437_100106 3300025233 Bacteria 219071
111 Ga0209437_107776 3300025233 Bacteria 1730
112 Ga0209258_100413 3300025242 Bacteria 51260
113 Ga0209258_100991 3300025242 Bacteria 13111
114 Ga0209258_103362 3300025242 Bacteria 3489
115 Ga0207425_1018507 3300025245 Bacteria 1511
116 Ga0209646_1001735 3300025246 Bacteria 5500
117 Ga0209026_1000092 3300025250 Bacteria 170960
118 Ga0209026_1006858 3300025250 Bacteria 2692
119 Ga0209148_1000002 3300025254 Bacteria 2399500
120 Ga0209148_1000010 3300025254 Bacteria 1265567
121 Ga0209759_1000278 3300025256 Bacteria 71965
122 Ga0209759_1005468 3300025256 Bacteria 4442
123 Ga0209233_1000009 3300025261 Bacteria 1265567
124 Ga0209233_1010724 3300025261 Bacteria 2729
125 Ga0209233_1015435 3300025261 Bacteria 2127
126 Ga0209565_1000005 3300025263 Bacteria 947317
127 Ga0209565_1007783 3300025263 Bacteria 2855
128 Ga0209455_1000120 3300025272 Bacteria 173966
129 Ga0209455_1029715 3300025272 Bacteria 939
130 Ga0209673_1000011 3300025273 Bacteria 586604
131 Ga0209673_1012256 3300025273 Bacteria 3467
132 Ga0209130_1013916 3300025284 Bacteria 2041
133 Ga0209675_1000004 3300025291 Bacteria 947166
134 Ga0209675_1006738 3300025291 Bacteria 4546
135 Ga0209675_1010433 3300025291 Bacteria 3171
136 Ga0209676_1000047 3300025292 Bacteria 408645
137 Ga0209676_1000299 3300025292 Bacteria 100419
138 Ga0209676_1004106 3300025292 Bacteria 8310
139 Ga0209676_1006043 3300025292 Bacteria 6101
140 Ga0209676_1006724 3300025292 Bacteria 5595
141 Ga0209676_1039556 3300025292 Bacteria 1338
142 Ga0209025_1000036 3300025294 Bacteria 404113
143 Ga0209025_1001523 3300025294 Bacteria 29655
144 Ga0209025_1002538 3300025294 Bacteria 19066
145 Ga0209025_1104329 3300025294 Bacteria 888
146 Ga0209564_1000018 3300025295 Bacteria 586913
147 Ga0209564_1014685 3300025295 Bacteria 3237
148 Ga0209564_1035113 3300025295 Bacteria 1457
149 Ga0209758_1011761 3300025297 Bacteria 5013
150 Ga0209050_1000974 3300025298 Bacteria 36653
151 Ga0209050_1022821 3300025298 Bacteria 2228
152 Ga0209050_1047017 3300025298 Bacteria 1128
153 Ga0209256_1000021 3300025299 Bacteria 537097
154 Ga0209256_1002619 3300025299 Bacteria 14223
155 Ga0209256_1002852 3300025299 Bacteria 13174
156 Ga0209256_1003535 3300025299 Bacteria 10864
157 Ga0209256_1011716 3300025299 Bacteria 3462
158 Ga0209051_1010323 3300025303 Bacteria 4733
159 Ga0209257_1000133 3300025304 Bacteria 208808
160 Ga0209257_1000278 3300025304 Bacteria 114707
161 Ga0209257_1000302 3300025304 Bacteria 108038
162 Ga0209257_1003685 3300025304 Bacteria 12780
163 Ga0209257_1011892 3300025304 Bacteria 4112
164 Ga0209257_1015025 3300025304 Bacteria 3263
165 Ga0209257_1016054 3300025304 Bacteria 3058
166 Ga0207713_1000452 3300025735 Bacteria 42991
167 Ga0207647_10014594 3300025904 Bacteria 5411
168 Ga0207705_10464243 3300025909 Bacteria 982
169 Ga0207707_10183355 3300025912 Bacteria 1827
170 Ga0207695_10085614 3300025913 Bacteria 3180
171 Ga0207657_10020989 3300025919 Bacteria 6159
172 Ga0207649_10156470 3300025920 Bacteria 1575
173 Ga0207652_10232769 3300025921 Bacteria 1660
174 Ga0207681_10068483 3300025923 Bacteria 2465
175 Ga0207650_10050808 3300025925 Bacteria 3067
176 Ga0207709_10002528 3300025935 Bacteria 11405
177 Ga0207709_10017863 3300025935 Bacteria 3966
178 Ga0207670_10005647 3300025936 Bacteria 6882
179 Ga0207691_10022322 3300025940 Bacteria 5969
180 Ga0207691_10408342 3300025940 Bacteria 1158
181 Ga0207711_10039591 3300025941 Bacteria 4010
182 Ga0207689_10009982 3300025942 Bacteria 8187
183 Ga0207667_10769611 3300025949 Bacteria 961
184 Ga0207668_10044347 3300025972 Bacteria 3024
185 Ga0207668_10131371 3300025972 Bacteria 1912
186 Ga0207668_10538528 3300025972 Bacteria 1010
187 Ga0207658_10345864 3300025986 Bacteria 1294
188 Ga0207639_10840711 3300026041 Bacteria 857
189 Ga0207641_10282147 3300026088 Bacteria 1563
190 Ga0207683_10207053 3300026121 Bacteria 1784
191 Ga0209371_1000004 3300027312 Bacteria 1098197
192 Ga0209371_1000011 3300027312 Bacteria 848456
193 Ga0209970_1014387 3300027614 Bacteria 1315
194 Ga0209983_1000195 3300027665 Bacteria 11905
195 Ga0209971_1000653 3300027682 Bacteria 9043
196 Ga0209974_10002600 3300027876 Bacteria 6558
197 Ga0268266_10166174 3300028379 Bacteria 1999
198 Ga0268256_1000005 3300030500 Bacteria 1082342
199 Ga0268256_1000011 3300030500 Bacteria 848625
200 Ga0316177_1125731 3300030731 Bacteria 1001
201 Ga0316181_1081205 3300030744 Bacteria 1688
202 Ga0307513_10024959 3300031456 Bacteria 6940
203 Ga0307413_10098380 3300031824 Bacteria 1926
204 Ga0307413_10547357 3300031824 Bacteria 938
205 Ga0307406_10234135 3300031901 Bacteria 1373
206 Ga0307412_10046965 3300031911 Bacteria 2832
207 Ga0307412_10239118 3300031911 Bacteria 1403
208 Ga0307412_10824206 3300031911 Bacteria 807
209 Ga0307414_10001147 3300032004 Bacteria 13572
210 Ga0307414_10005257 3300032004 Bacteria 7116
211 Ga0307414_10026448 3300032004 Bacteria 3734
212 Ga0307414_10048610 3300032004 Bacteria 2927
213 Ga0307414_10107689 3300032004 Bacteria 2112
214 Ga0307414_10112595 3300032004 Bacteria 2075
215 Ga0307414_10126079 3300032004 Bacteria 1978
216 Ga0307414_10239423 3300032004 Bacteria 1501
217 Ga0307414_10292159 3300032004 Bacteria 1374
218 Ga0307414_10335303 3300032004 Bacteria 1292
219 Ga0307414_10425362 3300032004 Bacteria 1159
220 Ga0307414_10499029 3300032004 Bacteria 1076
221 Ga0307411_10850001 3300032005 Bacteria 807
222 Ga0373952_0112148 3300035092 Bacteria 731
223 Ga0237819_13891 3300038705 Bacteria 960
224 Ga0237816_00097 3300039145 Bacteria 6479
225 Ga0439436_0000552 3300041404 Bacteria 9870
226 Ga0439436_0011926 3300041404 Bacteria 2638
227 Ga0439436_0021349 3300041404 Bacteria 1925
228 Ga0439439_0034869 3300041406 Bacteria 1291
229 Ga0439447_019128 3300041407 Bacteria 1830
230 Ga0439461_0019013 3300041410 Bacteria 1350
231 Ga0439465_0000883 3300041413 Bacteria 9482
232 Ga0439465_0002742 3300041413 Bacteria 5762
233 Ga0439465_0052063 3300041413 Bacteria 1343
234 Ga0451787_100068 3300041441 Bacteria 909
235 Ga0451791_1688733 3300041451 Bacteria 1690
236 Ga0451791_1699805 3300041451 Bacteria 2242
237 Ga0451791_1771095 3300041451 Bacteria 2001
238 Ga0451793_0286284 3300041452 Bacteria 1063
239 Ga0451793_0353390 3300041452 Bacteria 3925
240 Ga0451793_0610649 3300041452 Bacteria 1681
241 Ga0451797_1064593 3300041453 Bacteria 1118
242 Ga0451797_1567948 3300041453 Bacteria 1340
243 Ga0451795_0381857 3300041456 Bacteria 760
244 Ga0451800_0043135 3300041459 Bacteria 15391
245 Ga0451806_227471 3300041462 Bacteria 9726
246 Ga0451804_0422292 3300041463 Bacteria 4557
247 Ga0451807_0245276 3300041486 Bacteria 759
248 Ga0451807_0896054 3300041486 Bacteria 1092
249 Ga0451807_1184572 3300041486 Bacteria 5477
250 Ga0451807_1416860 3300041486 Bacteria 1452
251 Ga0451837_0618110 3300041494 Bacteria 2452
252 Ga0451843_1219447 3300041509 Bacteria 1301
253 Ga0439431_0044072 3300041997 Bacteria 1143
254 Ga0439431_0096265 3300041997 Bacteria 810
255 Ga0439445_0060605 3300042004 Bacteria 1034
256 Ga0439445_0067905 3300042004 Bacteria 983
257 Ga0439449_0005232 3300042007 Bacteria 4977
258 Ga0439449_0070659 3300042007 Bacteria 1286
259 Ga0439462_0030393 3300042015 Bacteria 1429
260 Ga0450911_004223 3300042115 Bacteria 2385
261 Ga0451577_0002744 3300042876 Bacteria 20405
262 Ga0466965_0467189 3300044683 Bacteria 704
263 Ga0453684_0000615 3300044712 Bacteria 130336
264 Ga0453684_0311166 3300044712 Bacteria 1787
265 Ga0451576_0000201 3300045051 Bacteria 150175
266 Ga0495627_012652 3300046453 Bacteria 2989
267 Ga0495627_035203 3300046453 Bacteria 1561
268 Ga0495638_0000065 3300046460 Bacteria 170849
269 Ga0495638_0000094 3300046460 Bacteria 142168
270 Ga0495638_0040130 3300046460 Bacteria 2967
271 Ga0495650_0000078 3300046471 Bacteria 245487
272 Ga0495607_0033369 3300046501 Bacteria 3132
273 Ga0495606_0001012 3300046507 Bacteria 40883
274 Ga0495606_0211974 3300046507 Bacteria 1096
275 Ga0495610_0045291 3300046512 Bacteria 2177
276 Ga0495610_0089893 3300046512 Bacteria 1394
277 Ga0495631_0052761 3300046518 Bacteria 1775
278 Ga0495632_0119423 3300046519 Bacteria 1233
279 Ga0495663_0000180 3300046525 Bacteria 25223
280 Ga0495663_0003893 3300046525 Bacteria 4253
281 Ga0495663_0019137 3300046525 Bacteria 1956
282 Ga0495663_0035709 3300046525 Bacteria 1493
283 Ga0495654_0074838 3300046530 Bacteria 1599
284 Ga0495597_0078707 3300046542 Bacteria 1412
285 Ga0495622_0014098 3300046557 Bacteria 3710
286 Ga0495633_0008677 3300046558 Bacteria 5704
287 Ga0495633_0019234 3300046558 Bacteria 3454
288 Ga0495633_0052540 3300046558 Bacteria 1919
289 Ga0495633_0167610 3300046558 Bacteria 1013
290 Ga0495668_0053702 3300046616 Bacteria 2227
291 Ga0495625_0026251 3300046660 Bacteria 4404
292 Ga0495625_0032476 3300046660 Bacteria 3869
293 Ga0495671_0078254 3300046692 Bacteria 1621
294 Ga0495672_0195505 3300047320 Bacteria 1014
295 Ga0496113_0556161 3300048916 Bacteria 920
296 Ga0496115_0005442 3300048918 Bacteria 9261
297 Ga0496115_0178579 3300048918 Bacteria 1755
298 Ga0496116_0003550 3300048919 Bacteria 15344
299 Ga0496116_0182750 3300048919 Bacteria 1120
300 Ga0496116_0272645 3300048919 Bacteria 825
301 Ga0496117_0005370 3300048920 Bacteria 13499
302 Ga0496117_0040021 3300048920 Bacteria 3453
303 Ga0496117_0060661 3300048920 Bacteria 2604
304 Ga0496117_0077460 3300048920 Bacteria 2200
305 Ga0496117_0170456 3300048920 Bacteria 1264
306 Ga0496118_0005917 3300048921 Bacteria 13681
307 Ga0496118_0049783 3300048921 Bacteria 3222
308 Ga0496118_0073270 3300048921 Bacteria 2454
309 Ga0496118_0097927 3300048921 Bacteria 1993
310 Ga0496118_0323532 3300048921 Bacteria 836
311 Ga0496119_0000768 3300048922 Bacteria 43140
312 Ga0496120_0000780 3300048923 Bacteria 46094
313 Ga0496121_0006840 3300048924 Bacteria 13949
314 Ga0496121_0078296 3300048924 Bacteria 2629
315 Ga0496121_0112611 3300048924 Bacteria 2072
316 Ga0496121_0510650 3300048924 Bacteria 761
317 Ga0496122_0001130 3300048925 Bacteria 45920
318 Ga0496122_0002422 3300048925 Bacteria 26530
319 Ga0496122_0023754 3300048925 Bacteria 5388
320 Ga0496122_0039098 3300048925 Bacteria 3788
321 Ga0496122_0056901 3300048925 Bacteria 2910
322 Ga0496122_0071321 3300048925 Bacteria 2476
323 Ga0496123_0000852 3300048926 Bacteria 48678
324 Ga0496123_0016719 3300048926 Bacteria 5939
325 Ga0496123_0018783 3300048926 Bacteria 5479
326 Ga0496123_0072773 3300048926 Bacteria 2136
327 Ga0496123_0183109 3300048926 Bacteria 1092
328 Ga0496123_0258544 3300048926 Bacteria 854
329 Ga0496124_0002997 3300048927 Bacteria 21122
330 Ga0496124_0025370 3300048927 Bacteria 5369
331 Ga0496124_0051221 3300048927 Bacteria 3513
332 Ga0496124_0114608 3300048927 Bacteria 2164
333 Ga0496124_0484918 3300048927 Bacteria 833
334 Ga0496125_0028259 3300048928 Bacteria 5071
335 Ga0496125_0105210 3300048928 Bacteria 2063
336 Ga0496125_0144235 3300048928 Bacteria 1649
337 Ga0496125_0160678 3300048928 Bacteria 1526
338 Ga0496125_0172729 3300048928 Bacteria 1450
339 Ga0496126_0045844 3300048929 Bacteria 4015
340 Ga0496126_0051371 3300048929 Bacteria 3753
341 Ga0496126_0362095 3300048929 Bacteria 1184
342 Ga0495682_0189958 3300049460 Bacteria 729
343 Ga0501290_000701 3300049513 Bacteria 4981
344 Ga0501031_0020474 3300049568 Bacteria 4313
345 Ga0501032_0112219 3300049569 Bacteria 1803
346 Ga0501033_0000492 3300049570 Bacteria 37245
347 Ga0501034_0000221 3300049571 Bacteria 108958
348 Ga0501034_0228813 3300049571 Bacteria 1809
349 Ga0501034_0333964 3300049571 Bacteria 1447
350 Ga0501036_0317230 3300049572 Bacteria 1303
351 Ga0501037_0100998 3300049573 Bacteria 2082
352 Ga0501038_0449875 3300049574 Bacteria 990
353 Ga0501039_0021560 3300049575 Bacteria 4941
354 Ga0501043_0000526 3300049579 Bacteria 34405
355 Ga0501043_0161775 3300049579 Bacteria 1749
356 Ga0501043_0278202 3300049579 Bacteria 1283
357 Ga0501047_0327065 3300049581 Bacteria 1372
358 Ga0501048_0106402 3300049582 Bacteria 1980
359 Ga0501225_0050242 3300049705 Bacteria 1160
360 Ga0501080_0922470 3300049742 Bacteria 760
361 Ga0501265_030200 3300049762 Bacteria 776
362 Ga0501275_000042 3300049772 Bacteria 12700
363 Ga0501035_0065029 3300049822 Bacteria 3240
364 nmdc:mga00v17_109967_c1 3300050491 Bacteria 1748
365 nmdc:mga00v17_118_c1 3300050491 Bacteria 46536
366 nmdc:mga00v17_179540_c1 3300050491 Bacteria 1366
367 nmdc:mga00v17_98491_c1 3300050491 Bacteria 1844
368 Ga0500634_0006480 3300053161 Bacteria 5672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10791903 Ga0111539_107919032 185
2 3300005334 Ga0068869_100011280 Ga0068869_1000112803 186
3 3300013296 Ga0157374_10078704 Ga0157374_100787043 186
4 3300025942 Ga0207689_10009982 Ga0207689_100099823 186
5 iso_pu_bacteria 2547132130 2547501528 192
6 iso_pu_bacteria 2747842428 2747950073 192
7 iso_pu_bacteria 2765235840 2765578330 192
8 iso_pu_bacteria 2816332141 2816516348 192
9 iso_pu_bacteria 2842391507 2842392941 192
10 iso_pu_bacteria 2842757796 2842758717 192
11 iso_pu_bacteria 2884411467 2884413287 192
12 iso_pu_bacteria 2894414249 2894416309 192
13 iso_pu_bacteria 2895498888 2895499356 192
14 iso_pu_bacteria 2895511927 2895512376 192
15 iso_pu_bacteria 2895522137 2895522388 192
16 iso_pu_bacteria 2895525241 2895525842 192
17 iso_pu_bacteria 2919134579 2919136806 192
18 iso_pu_bacteria 2961064222 2961067056 192
19 iso_pu_bacteria 8002869464 8002869477 192
20 iso_pu_bacteria 2524614729 2525557021 193
21 iso_pu_bacteria 2627854209 2630648617 193
22 iso_pu_bacteria 2643221559 2643815769 193
23 iso_pu_bacteria 2643221573 2643878105 193
24 iso_pu_bacteria 2643221586 2643940725 193
25 iso_pu_bacteria 2643221593 2643975546 193
26 iso_pu_bacteria 2643221612 2644080227 193
27 iso_pu_bacteria 2643221720 2644659414 193
28 iso_pu_bacteria 2643221727 2644695824 193
29 iso_pu_bacteria 2643221728 2644700841 193
30 iso_pu_bacteria 2941489479 2941491655 193
31 iso_pu_bacteria 2995948881 2995952719 193
32 iso_pu_bacteria 8003014200 8003016516 193
33 iso_pu_bacteria 2874220319 2874220950 194
34 iso_pu_bacteria 2919089067 2919091159 194
35 iso_pu_bacteria 2928496128 2928497792 194
36 iso_pu_bacteria 2931380184 2931381405 194
37 iso_pu_bacteria 2937610967 2937611771 194
38 iso_pu_bacteria 2939626828 2939627710 194
39 iso_pu_bacteria 2961047084 2961047715 194
40 iso_pu_bacteria 2977247770 2977250220 194
41 iso_pu_bacteria 2987605356 2987608266 194
42 3300038705 Ga0237819_13891 Ga0237819_13891_45_632 195
43 3300041413 Ga0439465_0002742 Ga0439465_0002742_1013_1600 195
44 3300042007 Ga0439449_0005232 Ga0439449_0005232_4143_4730 195
45 iso_pu_bacteria 2928963466 2928964376 195
46 3300003320 rootH2_10017930 rootH2_100179306 196
47 3300003323 rootH1_10167707 rootH1_101677071 196
48 3300003781 Ga0055536_1000574 Ga0055536_10005744 196
49 3300003794 Ga0055531_10009651 Ga0055531_100096514 196
50 3300005347 Ga0070668_100013066 Ga0070668_1000130662 196
51 3300005353 Ga0070669_100026442 Ga0070669_1000264423 196
52 3300005547 Ga0070693_100141065 Ga0070693_1001410652 196
53 3300006038 Ga0075365_10104844 Ga0075365_101048442 196
54 3300006051 Ga0075364_10000206 Ga0075364_100002065 196
55 3300006186 Ga0075369_10005753 Ga0075369_100057536 196
56 3300009036 Ga0105244_10134560 Ga0105244_101345602 196
57 3300009148 Ga0105243_10033621 Ga0105243_100336212 196
58 3300013104 Ga0157370_10486168 Ga0157370_104861681 196
59 3300025206 Ga0209435_107577 Ga0209435_1075772 196
60 3300025233 Ga0209437_107776 Ga0209437_1077762 196
61 3300025256 Ga0209759_1005468 Ga0209759_10054684 196
62 3300025261 Ga0209233_1015435 Ga0209233_10154352 196
63 3300025292 Ga0209676_1000047 Ga0209676_1000047355 196
64 3300025298 Ga0209050_1022821 Ga0209050_10228212 196
65 3300025298 Ga0209050_1047017 Ga0209050_10470172 196
66 3300025304 Ga0209257_1000278 Ga0209257_100027880 196
67 3300025923 Ga0207681_10068483 Ga0207681_100684833 196
68 3300025935 Ga0207709_10017863 Ga0207709_100178632 196
69 3300025940 Ga0207691_10408342 Ga0207691_104083422 196
70 3300025972 Ga0207668_10044347 Ga0207668_100443473 196
71 3300027312 Ga0209371_1000004 Ga0209371_1000004586 196
72 3300030500 Ga0268256_1000005 Ga0268256_1000005460 196
73 3300032004 Ga0307414_10001147 Ga0307414_1000114715 196
74 3300032004 Ga0307414_10026448 Ga0307414_100264484 196
75 3300032004 Ga0307414_10292159 Ga0307414_102921592 196
76 3300041404 Ga0439436_0021349 Ga0439436_0021349_232_822 196
77 3300041451 Ga0451791_1688733 Ga0451791_1688733_854_1444 196
78 3300041453 Ga0451797_1567948 Ga0451797_1567948_565_1155 196
79 3300041494 Ga0451837_0618110 Ga0451837_0618110_1761_2351 196
80 3300044712 Ga0453684_0000615 Ga0453684_0000615_6187_6777 196
81 3300045051 Ga0451576_0000201 Ga0451576_0000201_6187_6777 196
82 3300046453 Ga0495627_035203 Ga0495627_035203_561_1151 196
83 3300046471 Ga0495650_0000078 Ga0495650_0000078_3537_4133 196
84 3300046519 Ga0495632_0119423 Ga0495632_0119423_160_750 196
85 3300046525 Ga0495663_0003893 Ga0495663_0003893_3217_3807 196
86 3300046558 Ga0495633_0008677 Ga0495633_0008677_4170_4760 196
87 3300046558 Ga0495633_0019234 Ga0495633_0019234_471_1061 196
88 3300047320 Ga0495672_0195505 Ga0495672_0195505_165_800 196
89 3300048921 Ga0496118_0323532 Ga0496118_0323532_62_712 196
90 3300048925 Ga0496122_0002422 Ga0496122_0002422_25227_25817 196
91 3300048926 Ga0496123_0016719 Ga0496123_0016719_2056_2646 196
92 3300049571 Ga0501034_0000221 Ga0501034_0000221_18352_18942 196
93 3300049571 Ga0501034_0333964 Ga0501034_0333964_597_1187 196
94 3300049705 Ga0501225_0050242 Ga0501225_0050242_159_749 196
95 3300050491 nmdc:mga00v17_118_c1 nmdc:mga00v17_118_c1_39216_39809 196
96 3300050491 nmdc:mga00v17_98491_c1 nmdc:mga00v17_98491_c1_919_1509 196
97 3300053161 Ga0500634_0006480 Ga0500634_0006480_4362_4952 196
98 iso_pu_bacteria 2739367700 2739730559 196
99 iso_pu_bacteria 2747842501 2748015962 196
100 3300003187 JGI25151J46595_10027857 JGI25151J46595_100278572 197
101 3300003320 rootH2_10041321 rootH2_100413213 197
102 3300003773 Ga0055537_1000007 Ga0055537_1000007111 197
103 3300003775 Ga0055524_1000034 Ga0055524_100003465 197
104 3300003775 Ga0055524_1010699 Ga0055524_10106995 197
105 3300003775 Ga0055524_1042936 Ga0055524_10429361 197
106 3300003781 Ga0055536_1013863 Ga0055536_10138633 197
107 3300003784 Ga0055534_1000013 Ga0055534_100001336 197
108 3300003790 Ga0055528_1000005 Ga0055528_1000005111 197
109 3300003790 Ga0055528_1059521 Ga0055528_10595211 197
110 3300003792 Ga0055540_1047305 Ga0055540_10473052 197
111 3300003794 Ga0055531_10003850 Ga0055531_100038503 197
112 3300003794 Ga0055531_10028574 Ga0055531_100285743 197
113 3300003794 Ga0055531_10043779 Ga0055531_100437792 197
114 3300003794 Ga0055531_10067946 Ga0055531_100679461 197
115 3300005293 Ga0065715_10097858 Ga0065715_100978582 197
116 3300005339 Ga0070660_100408419 Ga0070660_1004084192 197
117 3300005457 Ga0070662_100853017 Ga0070662_1008530171 197
118 3300005458 Ga0070681_10456033 Ga0070681_104560331 197
119 3300005530 Ga0070679_100033075 Ga0070679_1000330753 197
120 3300005539 Ga0068853_100456546 Ga0068853_1004565461 197
121 3300005543 Ga0070672_100038786 Ga0070672_1000387865 197
122 3300005547 Ga0070693_100490099 Ga0070693_1004900992 197
123 3300005548 Ga0070665_101043014 Ga0070665_1010430141 197
124 3300005563 Ga0068855_101000094 Ga0068855_1010000941 197
125 3300005564 Ga0070664_100511850 Ga0070664_1005118502 197
126 3300005617 Ga0068859_100220955 Ga0068859_1002209553 197
127 3300005841 Ga0068863_100494432 Ga0068863_1004944322 197
128 3300006931 Ga0097620_100220965 Ga0097620_1002209653 197
129 3300013102 Ga0157371_10023740 Ga0157371_100237405 197
130 3300013104 Ga0157370_10200647 Ga0157370_102006472 197
131 3300013105 Ga0157369_10052643 Ga0157369_100526431 197
132 3300014326 Ga0157380_10062398 Ga0157380_100623983 197
133 3300015689 Ga0183360_10001 Ga0183360_10001487 197
134 3300025245 Ga0207425_1018507 Ga0207425_10185071 197
135 3300025263 Ga0209565_1000005 Ga0209565_1000005620 197
136 3300025263 Ga0209565_1007783 Ga0209565_10077831 197
137 3300025273 Ga0209673_1000011 Ga0209673_1000011275 197
138 3300025273 Ga0209673_1012256 Ga0209673_10122564 197
139 3300025284 Ga0209130_1013916 Ga0209130_10139161 197
140 3300025291 Ga0209675_1000004 Ga0209675_1000004620 197
141 3300025291 Ga0209675_1006738 Ga0209675_10067386 197
142 3300025291 Ga0209675_1010433 Ga0209675_10104332 197
143 3300025292 Ga0209676_1000299 Ga0209676_100029910 197
144 3300025292 Ga0209676_1004106 Ga0209676_10041066 197
145 3300025292 Ga0209676_1006043 Ga0209676_10060435 197
146 3300025292 Ga0209676_1006724 Ga0209676_10067242 197
147 3300025292 Ga0209676_1039556 Ga0209676_10395562 197
148 3300025294 Ga0209025_1000036 Ga0209025_1000036168 197
149 3300025294 Ga0209025_1001523 Ga0209025_100152311 197
150 3300025294 Ga0209025_1002538 Ga0209025_100253811 197
151 3300025294 Ga0209025_1104329 Ga0209025_11043292 197
152 3300025295 Ga0209564_1000018 Ga0209564_1000018275 197
153 3300025295 Ga0209564_1014685 Ga0209564_10146856 197
154 3300025295 Ga0209564_1035113 Ga0209564_10351132 197
155 3300025297 Ga0209758_1011761 Ga0209758_10117615 197
156 3300025298 Ga0209050_1000974 Ga0209050_100097413 197
157 3300025299 Ga0209256_1000021 Ga0209256_1000021223 197
158 3300025299 Ga0209256_1002619 Ga0209256_10026193 197
159 3300025299 Ga0209256_1002852 Ga0209256_100285210 197
160 3300025299 Ga0209256_1003535 Ga0209256_10035353 197
161 3300025299 Ga0209256_1011716 Ga0209256_10117162 197
162 3300025303 Ga0209051_1010323 Ga0209051_10103233 197
163 3300025304 Ga0209257_1000133 Ga0209257_1000133195 197
164 3300025304 Ga0209257_1000302 Ga0209257_100030251 197
165 3300025304 Ga0209257_1003685 Ga0209257_100368511 197
166 3300025304 Ga0209257_1011892 Ga0209257_10118923 197
167 3300025304 Ga0209257_1015025 Ga0209257_10150254 197
168 3300025304 Ga0209257_1016054 Ga0209257_10160545 197
169 3300025909 Ga0207705_10464243 Ga0207705_104642432 197
170 3300025912 Ga0207707_10183355 Ga0207707_101833554 197
171 3300025919 Ga0207657_10020989 Ga0207657_100209897 197
172 3300025921 Ga0207652_10232769 Ga0207652_102327691 197
173 3300025940 Ga0207691_10022322 Ga0207691_100223228 197
174 3300025949 Ga0207667_10769611 Ga0207667_107696111 197
175 3300025986 Ga0207658_10345864 Ga0207658_103458642 197
176 3300026041 Ga0207639_10840711 Ga0207639_108407111 197
177 3300026088 Ga0207641_10282147 Ga0207641_102821472 197
178 3300026121 Ga0207683_10207053 Ga0207683_102070532 197
179 3300027614 Ga0209970_1014387 Ga0209970_10143872 197
180 3300027665 Ga0209983_1000195 Ga0209983_10001957 197
181 3300027682 Ga0209971_1000653 Ga0209971_10006532 197
182 3300027876 Ga0209974_10002600 Ga0209974_100026006 197
183 3300031456 Ga0307513_10024959 Ga0307513_100249594 197
184 3300031824 Ga0307413_10098380 Ga0307413_100983803 197
185 3300031824 Ga0307413_10547357 Ga0307413_105473572 197
186 3300031901 Ga0307406_10234135 Ga0307406_102341352 197
187 3300031911 Ga0307412_10239118 Ga0307412_102391182 197
188 3300031911 Ga0307412_10824206 Ga0307412_108242061 197
189 3300032004 Ga0307414_10005257 Ga0307414_100052574 197
190 3300032004 Ga0307414_10048610 Ga0307414_100486102 197
191 3300032004 Ga0307414_10112595 Ga0307414_101125952 197
192 3300032004 Ga0307414_10126079 Ga0307414_101260792 197
193 3300032004 Ga0307414_10239423 Ga0307414_102394232 197
194 3300032004 Ga0307414_10335303 Ga0307414_103353031 197
195 3300032004 Ga0307414_10425362 Ga0307414_104253621 197
196 3300032004 Ga0307414_10499029 Ga0307414_104990292 197
197 3300032005 Ga0307411_10850001 Ga0307411_108500011 197
198 3300035092 Ga0373952_0112148 Ga0373952_0112148_80_673 197
199 3300039145 Ga0237816_00097 Ga0237816_00097_5507_6109 197
200 3300041404 Ga0439436_0000552 Ga0439436_0000552_5921_6526 197
201 3300041404 Ga0439436_0011926 Ga0439436_0011926_409_1017 197
202 3300041406 Ga0439439_0034869 Ga0439439_0034869_484_1089 197
203 3300041407 Ga0439447_019128 Ga0439447_019128_501_1109 197
204 3300041410 Ga0439461_0019013 Ga0439461_0019013_533_1126 197
205 3300041413 Ga0439465_0000883 Ga0439465_0000883_3445_4038 197
206 3300041413 Ga0439465_0052063 Ga0439465_0052063_383_988 197
207 3300041441 Ga0451787_100068 Ga0451787_100068_56_649 197
208 3300041451 Ga0451791_1771095 Ga0451791_1771095_740_1333 197
209 3300041452 Ga0451793_0286284 Ga0451793_0286284_372_965 197
210 3300041452 Ga0451793_0610649 Ga0451793_0610649_79_672 197
211 3300041456 Ga0451795_0381857 Ga0451795_0381857_47_697 197
212 3300041486 Ga0451807_0245276 Ga0451807_0245276_71_721 197
213 3300041486 Ga0451807_0896054 Ga0451807_0896054_351_944 197
214 3300041486 Ga0451807_1416860 Ga0451807_1416860_140_733 197
215 3300041509 Ga0451843_1219447 Ga0451843_1219447_331_981 197
216 3300041997 Ga0439431_0044072 Ga0439431_0044072_345_938 197
217 3300041997 Ga0439431_0096265 Ga0439431_0096265_174_767 197
218 3300042004 Ga0439445_0060605 Ga0439445_0060605_196_801 197
219 3300042004 Ga0439445_0067905 Ga0439445_0067905_257_850 197
220 3300042007 Ga0439449_0070659 Ga0439449_0070659_586_1179 197
221 3300042015 Ga0439462_0030393 Ga0439462_0030393_584_1189 197
222 3300042876 Ga0451577_0002744 Ga0451577_0002744_14146_14745 197
223 3300044683 Ga0466965_0467189 Ga0466965_0467189_20_613 197
224 3300044712 Ga0453684_0311166 Ga0453684_0311166_832_1431 197
225 3300046460 Ga0495638_0040130 Ga0495638_0040130_943_1551 197
226 3300046501 Ga0495607_0033369 Ga0495607_0033369_2164_2757 197
227 3300046507 Ga0495606_0211974 Ga0495606_0211974_459_1052 197
228 3300046512 Ga0495610_0089893 Ga0495610_0089893_719_1312 197
229 3300046525 Ga0495663_0000180 Ga0495663_0000180_1449_2042 197
230 3300046525 Ga0495663_0035709 Ga0495663_0035709_390_986 197
231 3300046530 Ga0495654_0074838 Ga0495654_0074838_239_832 197
232 3300046558 Ga0495633_0167610 Ga0495633_0167610_409_1002 197
233 3300046616 Ga0495668_0053702 Ga0495668_0053702_1264_1872 197
234 3300046692 Ga0495671_0078254 Ga0495671_0078254_987_1580 197
235 3300048916 Ga0496113_0556161 Ga0496113_0556161_148_744 197
236 3300048924 Ga0496121_0006840 Ga0496121_0006840_1924_2532 197
237 3300048925 Ga0496122_0023754 Ga0496122_0023754_905_1501 197
238 3300048925 Ga0496122_0056901 Ga0496122_0056901_494_1087 197
239 3300048926 Ga0496123_0018783 Ga0496123_0018783_3935_4531 197
240 3300048926 Ga0496123_0183109 Ga0496123_0183109_22_615 197
241 3300048928 Ga0496125_0160678 Ga0496125_0160678_337_933 197
242 3300049513 Ga0501290_000701 Ga0501290_000701_126_728 197
243 3300049568 Ga0501031_0020474 Ga0501031_0020474_1730_2335 197
244 3300049569 Ga0501032_0112219 Ga0501032_0112219_37_642 197
245 3300049570 Ga0501033_0000492 Ga0501033_0000492_34992_35741 197
246 3300049571 Ga0501034_0228813 Ga0501034_0228813_1098_1700 197
247 3300049572 Ga0501036_0317230 Ga0501036_0317230_498_1103 197
248 3300049574 Ga0501038_0449875 Ga0501038_0449875_150_755 197
249 3300049579 Ga0501043_0000526 Ga0501043_0000526_28933_29541 197
250 3300049579 Ga0501043_0161775 Ga0501043_0161775_1076_1681 197
251 3300049581 Ga0501047_0327065 Ga0501047_0327065_69_674 197
252 3300049742 Ga0501080_0922470 Ga0501080_0922470_51_656 197
253 3300049762 Ga0501265_030200 Ga0501265_030200_42_644 197
254 3300049772 Ga0501275_000042 Ga0501275_000042_5080_5682 197
255 3300049822 Ga0501035_0065029 Ga0501035_0065029_2062_2667 197
256 3300050491 nmdc:mga00v17_109967_c1 nmdc:mga00v17_109967_c1_182_805 197
257 iso_pu_bacteria 2818991457 2819663665 197
258 iso_pu_bacteria 2852684882 2852686360 197
259 iso_pu_bacteria 2919130084 2919132477 197
260 iso_pu_bacteria 2929195423 2929197055 197
261 iso_pu_bacteria 8021622325 8021625921 197
262 iso_pu_bacteria 8021648035 8021648553 197
263 3300005347 Ga0070668_100281981 Ga0070668_1002819812 198
264 3300005548 Ga0070665_100218154 Ga0070665_1002181542 198
265 3300009036 Ga0105244_10122571 Ga0105244_101225712 198
266 3300009984 Ga0105029_100728 Ga0105029_1007284 198
267 3300013100 Ga0157373_10440348 Ga0157373_104403481 198
268 3300013102 Ga0157371_10100863 Ga0157371_101008631 198
269 3300013102 Ga0157371_10126679 Ga0157371_101266791 198
270 3300013104 Ga0157370_10070903 Ga0157370_100709031 198
271 3300013104 Ga0157370_10961242 Ga0157370_109612421 198
272 3300017792 Ga0163161_10603042 Ga0163161_106030422 198
273 3300025972 Ga0207668_10131371 Ga0207668_101313712 198
274 3300028379 Ga0268266_10166174 Ga0268266_101661742 198
275 3300030744 Ga0316181_1081205 Ga0316181_10812052 198
276 3300031911 Ga0307412_10046965 Ga0307412_100469652 198
277 3300032004 Ga0307414_10107689 Ga0307414_101076893 198
278 3300042115 Ga0450911_004223 Ga0450911_004223_1443_2039 198
279 3300046453 Ga0495627_012652 Ga0495627_012652_428_1033 198
280 3300046512 Ga0495610_0045291 Ga0495610_0045291_867_1463 198
281 3300046518 Ga0495631_0052761 Ga0495631_0052761_806_1402 198
282 3300046525 Ga0495663_0019137 Ga0495663_0019137_1226_1822 198
283 3300046558 Ga0495633_0052540 Ga0495633_0052540_1153_1749 198
284 3300048919 Ga0496116_0003550 Ga0496116_0003550_4436_5032 198
285 3300048919 Ga0496116_0182750 Ga0496116_0182750_138_743 198
286 3300048919 Ga0496116_0272645 Ga0496116_0272645_97_705 198
287 3300048920 Ga0496117_0005370 Ga0496117_0005370_3921_4517 198
288 3300048920 Ga0496117_0040021 Ga0496117_0040021_2427_3032 198
289 3300048920 Ga0496117_0077460 Ga0496117_0077460_352_948 198
290 3300048920 Ga0496117_0170456 Ga0496117_0170456_359_955 198
291 3300048921 Ga0496118_0005917 Ga0496118_0005917_9066_9662 198
292 3300048921 Ga0496118_0049783 Ga0496118_0049783_362_967 198
293 3300048921 Ga0496118_0097927 Ga0496118_0097927_1384_1980 198
294 3300048924 Ga0496121_0078296 Ga0496121_0078296_1165_1761 198
295 3300048924 Ga0496121_0112611 Ga0496121_0112611_129_725 198
296 3300048925 Ga0496122_0039098 Ga0496122_0039098_1749_2357 198
297 3300048925 Ga0496122_0071321 Ga0496122_0071321_1539_2135 198
298 3300048926 Ga0496123_0072773 Ga0496123_0072773_1197_1805 198
299 3300048926 Ga0496123_0258544 Ga0496123_0258544_113_709 198
300 3300048927 Ga0496124_0025370 Ga0496124_0025370_176_781 198
301 3300048927 Ga0496124_0051221 Ga0496124_0051221_1477_2073 198
302 3300048927 Ga0496124_0114608 Ga0496124_0114608_1344_1940 198
303 3300048927 Ga0496124_0484918 Ga0496124_0484918_164_760 198
304 3300048928 Ga0496125_0105210 Ga0496125_0105210_1251_1847 198
305 3300048928 Ga0496125_0144235 Ga0496125_0144235_167_763 198
306 3300048928 Ga0496125_0172729 Ga0496125_0172729_390_986 198
307 3300048929 Ga0496126_0362095 Ga0496126_0362095_295_900 198
308 3300050491 nmdc:mga00v17_179540_c1 nmdc:mga00v17_179540_c1_692_1288 198
309 3300002705 JGI25156J39149_1008673 JGI25156J39149_10086732 199
310 3300002737 JGI25162J39368_1000260 JGI25162J39368_100026053 199
311 3300002737 JGI25162J39368_1003520 JGI25162J39368_10035205 199
312 3300002741 JGI25157J39369_1000867 JGI25157J39369_10008678 199
313 3300002771 JGI25163J39215_1002529 JGI25163J39215_10025292 199
314 3300002772 JGI25164J39214_1000133 JGI25164J39214_100013321 199
315 3300003214 JGI25165J46597_1000255 JGI25165J46597_100025521 199
316 3300003322 rootL2_10291567 rootL2_102915673 199
317 3300003751 Ga0055538_1000340 Ga0055538_100034021 199
318 3300003761 Ga0055535_1001910 Ga0055535_10019105 199
319 3300003761 Ga0055535_1001965 Ga0055535_10019655 199
320 3300003762 Ga0055542_1000082 Ga0055542_1000082129 199
321 3300003762 Ga0055542_1000327 Ga0055542_100032753 199
322 3300003763 Ga0055529_1000228 Ga0055529_100022821 199
323 3300005365 Ga0070688_100020859 Ga0070688_1000208592 199
324 3300005466 Ga0070685_10410080 Ga0070685_104100802 199
325 3300009993 Ga0105028_102719 Ga0105028_1027192 199
326 3300014969 Ga0157376_10025383 Ga0157376_100253833 199
327 3300025207 Ga0209760_100357 Ga0209760_1003578 199
328 3300025224 Ga0209784_100133 Ga0209784_10013353 199
329 3300025228 Ga0209672_105542 Ga0209672_1055423 199
330 3300025231 Ga0207427_100013 Ga0207427_100013230 199
331 3300025231 Ga0207427_109343 Ga0207427_1093431 199
332 3300025233 Ga0209437_100015 Ga0209437_100015307 199
333 3300025233 Ga0209437_100106 Ga0209437_100106198 199
334 3300025242 Ga0209258_100413 Ga0209258_1004135 199
335 3300025242 Ga0209258_103362 Ga0209258_1033623 199
336 3300025246 Ga0209646_1001735 Ga0209646_10017353 199
337 3300025250 Ga0209026_1000092 Ga0209026_100009253 199
338 3300025250 Ga0209026_1006858 Ga0209026_10068582 199
339 3300025254 Ga0209148_1000002 Ga0209148_10000021732 199
340 3300025254 Ga0209148_1000010 Ga0209148_1000010607 199
341 3300025256 Ga0209759_1000278 Ga0209759_100027821 199
342 3300025261 Ga0209233_1000009 Ga0209233_1000009564 199
343 3300025261 Ga0209233_1010724 Ga0209233_10107243 199
344 3300025272 Ga0209455_1000120 Ga0209455_10001206 199
345 3300049582 Ga0501048_0106402 Ga0501048_0106402_1260_1874 199
346 3300003756 Ga0055533_1001312 Ga0055533_10013128 200
347 3300005340 Ga0070689_100004531 Ga0070689_1000045312 200
348 3300005347 Ga0070668_100658954 Ga0070668_1006589542 200
349 3300005843 Ga0068860_100304993 Ga0068860_1003049932 200
350 3300005844 Ga0068862_100308318 Ga0068862_1003083181 200
351 3300009093 Ga0105240_10040273 Ga0105240_100402735 200
352 3300009545 Ga0105237_11550522 Ga0105237_115505221 200
353 3300013102 Ga0157371_10046717 Ga0157371_100467173 200
354 3300013104 Ga0157370_10553244 Ga0157370_105532442 200
355 3300013104 Ga0157370_10554162 Ga0157370_105541621 200
356 3300013306 Ga0163162_10416403 Ga0163162_104164031 200
357 3300013307 Ga0157372_10193970 Ga0157372_101939703 200
358 3300025226 Ga0209674_100269 Ga0209674_10026919 200
359 3300025228 Ga0209672_106011 Ga0209672_1060112 200
360 3300025242 Ga0209258_100991 Ga0209258_1009913 200
361 3300025272 Ga0209455_1029715 Ga0209455_10297151 200
362 3300025913 Ga0207695_10085614 Ga0207695_100856141 200
363 3300025920 Ga0207649_10156470 Ga0207649_101564702 200
364 3300025936 Ga0207670_10005647 Ga0207670_100056476 200
365 3300025972 Ga0207668_10538528 Ga0207668_105385282 200
366 3300046460 Ga0495638_0000065 Ga0495638_0000065_1926_2534 200
367 3300046460 Ga0495638_0000094 Ga0495638_0000094_141114_141722 200
368 3300046507 Ga0495606_0001012 Ga0495606_0001012_11496_12104 200
369 3300046542 Ga0495597_0078707 Ga0495597_0078707_38_646 200
370 3300046557 Ga0495622_0014098 Ga0495622_0014098_3034_3642 200
371 3300046660 Ga0495625_0026251 Ga0495625_0026251_3487_4095 200
372 3300046660 Ga0495625_0032476 Ga0495625_0032476_3214_3822 200
373 3300048918 Ga0496115_0005442 Ga0496115_0005442_8127_8735 200
374 3300048918 Ga0496115_0178579 Ga0496115_0178579_81_689 200
375 3300048924 Ga0496121_0510650 Ga0496121_0510650_22_708 200
376 3300048929 Ga0496126_0045844 Ga0496126_0045844_500_1108 200
377 3300049460 Ga0495682_0189958 Ga0495682_0189958_98_706 200
378 3300049573 Ga0501037_0100998 Ga0501037_0100998_1244_1852 200
379 3300049575 Ga0501039_0021560 Ga0501039_0021560_2424_3032 200
380 2162886007 SwRhRL2b_contig_2389512 SwRhRL2b_0502.00012670 201
381 3300002067 JGI24735J21928_10001248 JGI24735J21928_100012484 201
382 3300003856 Ga0058692_1000020 Ga0058692_1000020128 201
383 3300005289 Ga0065704_10071577 Ga0065704_100715778 201
384 3300005331 Ga0070670_100016085 Ga0070670_1000160852 201
385 3300009011 Ga0105251_10000010 Ga0105251_1000001089 201
386 3300009148 Ga0105243_10009736 Ga0105243_100097364 201
387 3300009177 Ga0105248_10012500 Ga0105248_100125003 201
388 3300015265 Ga0182005_1003607 Ga0182005_10036075 201
389 3300015687 Ga0183368_1004 Ga0183368_100413 201
390 3300025735 Ga0207713_1000452 Ga0207713_100045210 201
391 3300025904 Ga0207647_10014594 Ga0207647_100145944 201
392 3300025925 Ga0207650_10050808 Ga0207650_100508082 201
393 3300025935 Ga0207709_10002528 Ga0207709_100025285 201
394 3300025941 Ga0207711_10039591 Ga0207711_100395912 201
395 3300027312 Ga0209371_1000011 Ga0209371_1000011393 201
396 3300030500 Ga0268256_1000011 Ga0268256_1000011393 201
397 3300030731 Ga0316177_1125731 Ga0316177_11257312 201
398 3300041451 Ga0451791_1699805 Ga0451791_1699805_239_844 201
399 3300041452 Ga0451793_0353390 Ga0451793_0353390_2052_2657 201
400 3300041453 Ga0451797_1064593 Ga0451797_1064593_467_1072 201
401 3300041459 Ga0451800_0043135 Ga0451800_0043135_6410_7015 201
402 3300041462 Ga0451806_227471 Ga0451806_227471_2739_3344 201
403 3300041463 Ga0451804_0422292 Ga0451804_0422292_1349_1954 201
404 3300041486 Ga0451807_1184572 Ga0451807_1184572_4272_4877 201
405 3300048920 Ga0496117_0060661 Ga0496117_0060661_543_1148 201
406 3300048921 Ga0496118_0073270 Ga0496118_0073270_1228_1833 201
407 3300048922 Ga0496119_0000768 Ga0496119_0000768_4185_4790 201
408 3300048923 Ga0496120_0000780 Ga0496120_0000780_41430_42035 201
409 3300048925 Ga0496122_0001130 Ga0496122_0001130_4137_4742 201
410 3300048926 Ga0496123_0000852 Ga0496123_0000852_41311_41916 201
411 3300048927 Ga0496124_0002997 Ga0496124_0002997_4121_4726 201
412 3300048928 Ga0496125_0028259 Ga0496125_0028259_4418_5041 201
413 3300048929 Ga0496126_0051371 Ga0496126_0051371_2510_3115 201
414 3300049579 Ga0501043_0278202 Ga0501043_0278202_527_1147 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

51

140

0.82

PF08242

Methyltransf_12

Methyltransferase domain

52

140

0.79

PF13489

Methyltransf_23

Methyltransferase domain

16

146

0.77

PF08241

Methyltransf_11

Methyltransferase domain

52

138

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m83-assembly1.cif.gz_A-2 crystal structure of tylm1 s120a bound to sah and dtdp-phenol 0.7793 4 182
6m82-assembly1.cif.gz_A crystal structure of tylm1 y14paf bound to sah and dtdp-phenol 0.7773 6 184
3h2b-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase cg3271 from corynebacterium glutamicum in complex with s-adenosyl-l-homocysteine and pyrophosphate. northeast structural genomics consortium target cgr113a 0.77 46 182
6ecv-assembly1.cif.gz_B stid o-mt residues 976-1266 0.7671 44 176
4oqe-assembly1.cif.gz_A crystal structure of the tylm1 n,n-dimethyltransferase in complex with sah and tdp-fuc3nme 0.7644 4 184
ID Description Score Start End Superfamily
af_A0A1D6MP53_133_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8097 19 143 3.40.50.150
af_P9WLW9_47_240_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7961 45 172 3.40.50.150
af_A0A1D6I0D9_80_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7858 32 147 3.40.50.150
af_O53979_54_244_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7751 15 147 3.40.50.150
af_Q33AG7_179_362_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7657 32 138 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6L5BIL9-F1-model_v4 deleted 0.9936 1 162
AF-A0A3D4TRG4-F1-model_v4 Methyltransferase 0.9936 45 196 GO:0008168
GO:0032259
AF-A0A6C8X398-F1-model_v4 deleted 0.993 1 182
AF-A0A6L5BIL9-F1-model_v4 deleted 0.9875 1 162
AF-A0A3D4TRG4-F1-model_v4 Methyltransferase 0.9871 45 196 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map