F438236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 414 | 261 | 368 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100011280|Ga0068869_1000112803 |
| Length | 202 |
| Sequence | MNVTKDYDRRYFDRWYREDDAGVGRGALLRRKVALAVAMAEHYLGRPLRSVLDVGCGEGAWRAPLLKLRPKLAYLGVDSSEYAVARYGAKRNLRLVHFRQLGELRLGAPVDLLVCADVLHYLPAADLRHGLSGFADAVEGDKHGFIPRSAAFYRQAIAAAGFTACGSHGYLSPTLAADAVALELAAPVAKTRARRSRGPGFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 7 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 8 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 9 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 10 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 11 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 12 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 13 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 14 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 15 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 16 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 17 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 18 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 19 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 20 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 21 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 22 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 23 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 24 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 25 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 26 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 27 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 28 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 29 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 30 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 31 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 32 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 33 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 34 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 35 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 36 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 37 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 38 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 39 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 40 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 41 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 42 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 43 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 44 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 45 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 46 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 47 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 48 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 49 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 51 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 54 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 55 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 68 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 103 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 115 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 173 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 182 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 183 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 184 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 185 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 186 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 187 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 188 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 198 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 199 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 203 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 228 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 229 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 230 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 231 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 258 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 259 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 260 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 261 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.89 |
| Metatranscriptomes | 0 |
| Isolates | 11.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.95 |
| Nodule | 0.24 |
| Rhizoplane | 4.83 |
| Rhizosphere | 50.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2389512 | 2162886007 | Bacteria | 4301 |
| 2 | JGI24735J21928_10001248 | 3300002067 | Bacteria | 9035 |
| 3 | JGI25156J39149_1008673 | 3300002705 | Bacteria | 2537 |
| 4 | JGI25162J39368_1000260 | 3300002737 | Bacteria | 50536 |
| 5 | JGI25162J39368_1003520 | 3300002737 | Unclassified | 4440 |
| 6 | JGI25157J39369_1000867 | 3300002741 | Bacteria | 14653 |
| 7 | JGI25163J39215_1002529 | 3300002771 | Bacteria | 1833 |
| 8 | JGI25164J39214_1000133 | 3300002772 | Bacteria | 71595 |
| 9 | JGI25151J46595_10027857 | 3300003187 | Bacteria | 2258 |
| 10 | JGI25165J46597_1000255 | 3300003214 | Bacteria | 71595 |
| 11 | rootH2_10017930 | 3300003320 | Bacteria | 6833 |
| 12 | rootH2_10041321 | 3300003320 | Bacteria | 1933 |
| 13 | rootL2_10291567 | 3300003322 | Bacteria | 1912 |
| 14 | rootH1_10167707 | 3300003323 | Bacteria | 1474 |
| 15 | Ga0055538_1000340 | 3300003751 | Bacteria | 20779 |
| 16 | Ga0055533_1001312 | 3300003756 | Bacteria | 6757 |
| 17 | Ga0055535_1001910 | 3300003761 | Bacteria | 8751 |
| 18 | Ga0055535_1001965 | 3300003761 | Bacteria | 8529 |
| 19 | Ga0055542_1000082 | 3300003762 | Bacteria | 128120 |
| 20 | Ga0055542_1000327 | 3300003762 | Bacteria | 50536 |
| 21 | Ga0055529_1000228 | 3300003763 | Bacteria | 71595 |
| 22 | Ga0055537_1000007 | 3300003773 | Bacteria | 144691 |
| 23 | Ga0055524_1000034 | 3300003775 | Bacteria | 180672 |
| 24 | Ga0055524_1010699 | 3300003775 | Bacteria | 3635 |
| 25 | Ga0055524_1042936 | 3300003775 | Bacteria | 1118 |
| 26 | Ga0055536_1000574 | 3300003781 | Bacteria | 25068 |
| 27 | Ga0055536_1013863 | 3300003781 | Bacteria | 2872 |
| 28 | Ga0055534_1000013 | 3300003784 | Bacteria | 151209 |
| 29 | Ga0055528_1000005 | 3300003790 | Bacteria | 236316 |
| 30 | Ga0055528_1059521 | 3300003790 | Bacteria | 727 |
| 31 | Ga0055540_1047305 | 3300003792 | Bacteria | 901 |
| 32 | Ga0055531_10003850 | 3300003794 | Bacteria | 9393 |
| 33 | Ga0055531_10009651 | 3300003794 | Bacteria | 4909 |
| 34 | Ga0055531_10028574 | 3300003794 | Bacteria | 1919 |
| 35 | Ga0055531_10043779 | 3300003794 | Bacteria | 1263 |
| 36 | Ga0055531_10067946 | 3300003794 | Bacteria | 836 |
| 37 | Ga0058692_1000020 | 3300003856 | Bacteria | 250589 |
| 38 | Ga0065704_10071577 | 3300005289 | Bacteria | 10644 |
| 39 | Ga0065715_10097858 | 3300005293 | Bacteria | 3639 |
| 40 | Ga0070670_100016085 | 3300005331 | Bacteria | 6421 |
| 41 | Ga0068869_100011280 | 3300005334 | Bacteria | 5855 |
| 42 | Ga0070660_100408419 | 3300005339 | Bacteria | 1123 |
| 43 | Ga0070689_100004531 | 3300005340 | Bacteria | 9407 |
| 44 | Ga0070668_100013066 | 3300005347 | Bacteria | 6185 |
| 45 | Ga0070668_100281981 | 3300005347 | Bacteria | 1388 |
| 46 | Ga0070668_100658954 | 3300005347 | Bacteria | 920 |
| 47 | Ga0070669_100026442 | 3300005353 | Bacteria | 4175 |
| 48 | Ga0070688_100020859 | 3300005365 | Bacteria | 3818 |
| 49 | Ga0070662_100853017 | 3300005457 | Bacteria | 776 |
| 50 | Ga0070681_10456033 | 3300005458 | Bacteria | 1191 |
| 51 | Ga0070685_10410080 | 3300005466 | Bacteria | 940 |
| 52 | Ga0070679_100033075 | 3300005530 | Bacteria | 5118 |
| 53 | Ga0068853_100456546 | 3300005539 | Bacteria | 1202 |
| 54 | Ga0070672_100038786 | 3300005543 | Bacteria | 3643 |
| 55 | Ga0070693_100141065 | 3300005547 | Bacteria | 1517 |
| 56 | Ga0070693_100490099 | 3300005547 | Bacteria | 870 |
| 57 | Ga0070665_100218154 | 3300005548 | Bacteria | 1908 |
| 58 | Ga0070665_101043014 | 3300005548 | Bacteria | 830 |
| 59 | Ga0068855_101000094 | 3300005563 | Bacteria | 879 |
| 60 | Ga0070664_100511850 | 3300005564 | Bacteria | 1107 |
| 61 | Ga0068859_100220955 | 3300005617 | Bacteria | 1982 |
| 62 | Ga0068863_100494432 | 3300005841 | Bacteria | 1204 |
| 63 | Ga0068860_100304993 | 3300005843 | Bacteria | 1561 |
| 64 | Ga0068862_100308318 | 3300005844 | Bacteria | 1458 |
| 65 | Ga0075365_10104844 | 3300006038 | Bacteria | 1939 |
| 66 | Ga0075364_10000206 | 3300006051 | Bacteria | 27651 |
| 67 | Ga0075369_10005753 | 3300006186 | Bacteria | 4654 |
| 68 | Ga0097620_100220965 | 3300006931 | Bacteria | 1982 |
| 69 | Ga0105251_10000010 | 3300009011 | Bacteria | 186242 |
| 70 | Ga0105244_10122571 | 3300009036 | Bacteria | 1258 |
| 71 | Ga0105244_10134560 | 3300009036 | Bacteria | 1191 |
| 72 | Ga0105240_10040273 | 3300009093 | Bacteria | 5977 |
| 73 | Ga0111539_10791903 | 3300009094 | Bacteria | 1103 |
| 74 | Ga0105243_10009736 | 3300009148 | Bacteria | 7320 |
| 75 | Ga0105243_10033621 | 3300009148 | Bacteria | 3966 |
| 76 | Ga0105248_10012500 | 3300009177 | Bacteria | 9364 |
| 77 | Ga0105237_11550522 | 3300009545 | Bacteria | 669 |
| 78 | Ga0105029_100728 | 3300009984 | Bacteria | 1849 |
| 79 | Ga0105028_102719 | 3300009993 | Bacteria | 1859 |
| 80 | Ga0157373_10440348 | 3300013100 | Bacteria | 937 |
| 81 | Ga0157371_10023740 | 3300013102 | Bacteria | 4483 |
| 82 | Ga0157371_10046717 | 3300013102 | Bacteria | 3079 |
| 83 | Ga0157371_10100863 | 3300013102 | Bacteria | 2048 |
| 84 | Ga0157371_10126679 | 3300013102 | Bacteria | 1816 |
| 85 | Ga0157370_10070903 | 3300013104 | Bacteria | 3288 |
| 86 | Ga0157370_10200647 | 3300013104 | Bacteria | 1850 |
| 87 | Ga0157370_10486168 | 3300013104 | Bacteria | 1134 |
| 88 | Ga0157370_10553244 | 3300013104 | Bacteria | 1055 |
| 89 | Ga0157370_10554162 | 3300013104 | Bacteria | 1054 |
| 90 | Ga0157370_10961242 | 3300013104 | Bacteria | 774 |
| 91 | Ga0157369_10052643 | 3300013105 | Bacteria | 4404 |
| 92 | Ga0157374_10078704 | 3300013296 | Bacteria | 3123 |
| 93 | Ga0163162_10416403 | 3300013306 | Bacteria | 1476 |
| 94 | Ga0157372_10193970 | 3300013307 | Bacteria | 2353 |
| 95 | Ga0157380_10062398 | 3300014326 | Bacteria | 2985 |
| 96 | Ga0157376_10025383 | 3300014969 | Bacteria | 4666 |
| 97 | Ga0182005_1003607 | 3300015265 | Bacteria | 5203 |
| 98 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 99 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 100 | Ga0163161_10603042 | 3300017792 | Bacteria | 905 |
| 101 | Ga0209435_107577 | 3300025206 | Bacteria | 1200 |
| 102 | Ga0209760_100357 | 3300025207 | Bacteria | 12636 |
| 103 | Ga0209784_100133 | 3300025224 | Bacteria | 72169 |
| 104 | Ga0209674_100269 | 3300025226 | Bacteria | 39856 |
| 105 | Ga0209672_105542 | 3300025228 | Bacteria | 2150 |
| 106 | Ga0209672_106011 | 3300025228 | Bacteria | 2020 |
| 107 | Ga0207427_100013 | 3300025231 | Bacteria | 581419 |
| 108 | Ga0207427_109343 | 3300025231 | Bacteria | 1059 |
| 109 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 110 | Ga0209437_100106 | 3300025233 | Bacteria | 219071 |
| 111 | Ga0209437_107776 | 3300025233 | Bacteria | 1730 |
| 112 | Ga0209258_100413 | 3300025242 | Bacteria | 51260 |
| 113 | Ga0209258_100991 | 3300025242 | Bacteria | 13111 |
| 114 | Ga0209258_103362 | 3300025242 | Bacteria | 3489 |
| 115 | Ga0207425_1018507 | 3300025245 | Bacteria | 1511 |
| 116 | Ga0209646_1001735 | 3300025246 | Bacteria | 5500 |
| 117 | Ga0209026_1000092 | 3300025250 | Bacteria | 170960 |
| 118 | Ga0209026_1006858 | 3300025250 | Bacteria | 2692 |
| 119 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 120 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 121 | Ga0209759_1000278 | 3300025256 | Bacteria | 71965 |
| 122 | Ga0209759_1005468 | 3300025256 | Bacteria | 4442 |
| 123 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 124 | Ga0209233_1010724 | 3300025261 | Bacteria | 2729 |
| 125 | Ga0209233_1015435 | 3300025261 | Bacteria | 2127 |
| 126 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 127 | Ga0209565_1007783 | 3300025263 | Bacteria | 2855 |
| 128 | Ga0209455_1000120 | 3300025272 | Bacteria | 173966 |
| 129 | Ga0209455_1029715 | 3300025272 | Bacteria | 939 |
| 130 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 131 | Ga0209673_1012256 | 3300025273 | Bacteria | 3467 |
| 132 | Ga0209130_1013916 | 3300025284 | Bacteria | 2041 |
| 133 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 134 | Ga0209675_1006738 | 3300025291 | Bacteria | 4546 |
| 135 | Ga0209675_1010433 | 3300025291 | Bacteria | 3171 |
| 136 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 137 | Ga0209676_1000299 | 3300025292 | Bacteria | 100419 |
| 138 | Ga0209676_1004106 | 3300025292 | Bacteria | 8310 |
| 139 | Ga0209676_1006043 | 3300025292 | Bacteria | 6101 |
| 140 | Ga0209676_1006724 | 3300025292 | Bacteria | 5595 |
| 141 | Ga0209676_1039556 | 3300025292 | Bacteria | 1338 |
| 142 | Ga0209025_1000036 | 3300025294 | Bacteria | 404113 |
| 143 | Ga0209025_1001523 | 3300025294 | Bacteria | 29655 |
| 144 | Ga0209025_1002538 | 3300025294 | Bacteria | 19066 |
| 145 | Ga0209025_1104329 | 3300025294 | Bacteria | 888 |
| 146 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 147 | Ga0209564_1014685 | 3300025295 | Bacteria | 3237 |
| 148 | Ga0209564_1035113 | 3300025295 | Bacteria | 1457 |
| 149 | Ga0209758_1011761 | 3300025297 | Bacteria | 5013 |
| 150 | Ga0209050_1000974 | 3300025298 | Bacteria | 36653 |
| 151 | Ga0209050_1022821 | 3300025298 | Bacteria | 2228 |
| 152 | Ga0209050_1047017 | 3300025298 | Bacteria | 1128 |
| 153 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 154 | Ga0209256_1002619 | 3300025299 | Bacteria | 14223 |
| 155 | Ga0209256_1002852 | 3300025299 | Bacteria | 13174 |
| 156 | Ga0209256_1003535 | 3300025299 | Bacteria | 10864 |
| 157 | Ga0209256_1011716 | 3300025299 | Bacteria | 3462 |
| 158 | Ga0209051_1010323 | 3300025303 | Bacteria | 4733 |
| 159 | Ga0209257_1000133 | 3300025304 | Bacteria | 208808 |
| 160 | Ga0209257_1000278 | 3300025304 | Bacteria | 114707 |
| 161 | Ga0209257_1000302 | 3300025304 | Bacteria | 108038 |
| 162 | Ga0209257_1003685 | 3300025304 | Bacteria | 12780 |
| 163 | Ga0209257_1011892 | 3300025304 | Bacteria | 4112 |
| 164 | Ga0209257_1015025 | 3300025304 | Bacteria | 3263 |
| 165 | Ga0209257_1016054 | 3300025304 | Bacteria | 3058 |
| 166 | Ga0207713_1000452 | 3300025735 | Bacteria | 42991 |
| 167 | Ga0207647_10014594 | 3300025904 | Bacteria | 5411 |
| 168 | Ga0207705_10464243 | 3300025909 | Bacteria | 982 |
| 169 | Ga0207707_10183355 | 3300025912 | Bacteria | 1827 |
| 170 | Ga0207695_10085614 | 3300025913 | Bacteria | 3180 |
| 171 | Ga0207657_10020989 | 3300025919 | Bacteria | 6159 |
| 172 | Ga0207649_10156470 | 3300025920 | Bacteria | 1575 |
| 173 | Ga0207652_10232769 | 3300025921 | Bacteria | 1660 |
| 174 | Ga0207681_10068483 | 3300025923 | Bacteria | 2465 |
| 175 | Ga0207650_10050808 | 3300025925 | Bacteria | 3067 |
| 176 | Ga0207709_10002528 | 3300025935 | Bacteria | 11405 |
| 177 | Ga0207709_10017863 | 3300025935 | Bacteria | 3966 |
| 178 | Ga0207670_10005647 | 3300025936 | Bacteria | 6882 |
| 179 | Ga0207691_10022322 | 3300025940 | Bacteria | 5969 |
| 180 | Ga0207691_10408342 | 3300025940 | Bacteria | 1158 |
| 181 | Ga0207711_10039591 | 3300025941 | Bacteria | 4010 |
| 182 | Ga0207689_10009982 | 3300025942 | Bacteria | 8187 |
| 183 | Ga0207667_10769611 | 3300025949 | Bacteria | 961 |
| 184 | Ga0207668_10044347 | 3300025972 | Bacteria | 3024 |
| 185 | Ga0207668_10131371 | 3300025972 | Bacteria | 1912 |
| 186 | Ga0207668_10538528 | 3300025972 | Bacteria | 1010 |
| 187 | Ga0207658_10345864 | 3300025986 | Bacteria | 1294 |
| 188 | Ga0207639_10840711 | 3300026041 | Bacteria | 857 |
| 189 | Ga0207641_10282147 | 3300026088 | Bacteria | 1563 |
| 190 | Ga0207683_10207053 | 3300026121 | Bacteria | 1784 |
| 191 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 192 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 193 | Ga0209970_1014387 | 3300027614 | Bacteria | 1315 |
| 194 | Ga0209983_1000195 | 3300027665 | Bacteria | 11905 |
| 195 | Ga0209971_1000653 | 3300027682 | Bacteria | 9043 |
| 196 | Ga0209974_10002600 | 3300027876 | Bacteria | 6558 |
| 197 | Ga0268266_10166174 | 3300028379 | Bacteria | 1999 |
| 198 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 199 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 200 | Ga0316177_1125731 | 3300030731 | Bacteria | 1001 |
| 201 | Ga0316181_1081205 | 3300030744 | Bacteria | 1688 |
| 202 | Ga0307513_10024959 | 3300031456 | Bacteria | 6940 |
| 203 | Ga0307413_10098380 | 3300031824 | Bacteria | 1926 |
| 204 | Ga0307413_10547357 | 3300031824 | Bacteria | 938 |
| 205 | Ga0307406_10234135 | 3300031901 | Bacteria | 1373 |
| 206 | Ga0307412_10046965 | 3300031911 | Bacteria | 2832 |
| 207 | Ga0307412_10239118 | 3300031911 | Bacteria | 1403 |
| 208 | Ga0307412_10824206 | 3300031911 | Bacteria | 807 |
| 209 | Ga0307414_10001147 | 3300032004 | Bacteria | 13572 |
| 210 | Ga0307414_10005257 | 3300032004 | Bacteria | 7116 |
| 211 | Ga0307414_10026448 | 3300032004 | Bacteria | 3734 |
| 212 | Ga0307414_10048610 | 3300032004 | Bacteria | 2927 |
| 213 | Ga0307414_10107689 | 3300032004 | Bacteria | 2112 |
| 214 | Ga0307414_10112595 | 3300032004 | Bacteria | 2075 |
| 215 | Ga0307414_10126079 | 3300032004 | Bacteria | 1978 |
| 216 | Ga0307414_10239423 | 3300032004 | Bacteria | 1501 |
| 217 | Ga0307414_10292159 | 3300032004 | Bacteria | 1374 |
| 218 | Ga0307414_10335303 | 3300032004 | Bacteria | 1292 |
| 219 | Ga0307414_10425362 | 3300032004 | Bacteria | 1159 |
| 220 | Ga0307414_10499029 | 3300032004 | Bacteria | 1076 |
| 221 | Ga0307411_10850001 | 3300032005 | Bacteria | 807 |
| 222 | Ga0373952_0112148 | 3300035092 | Bacteria | 731 |
| 223 | Ga0237819_13891 | 3300038705 | Bacteria | 960 |
| 224 | Ga0237816_00097 | 3300039145 | Bacteria | 6479 |
| 225 | Ga0439436_0000552 | 3300041404 | Bacteria | 9870 |
| 226 | Ga0439436_0011926 | 3300041404 | Bacteria | 2638 |
| 227 | Ga0439436_0021349 | 3300041404 | Bacteria | 1925 |
| 228 | Ga0439439_0034869 | 3300041406 | Bacteria | 1291 |
| 229 | Ga0439447_019128 | 3300041407 | Bacteria | 1830 |
| 230 | Ga0439461_0019013 | 3300041410 | Bacteria | 1350 |
| 231 | Ga0439465_0000883 | 3300041413 | Bacteria | 9482 |
| 232 | Ga0439465_0002742 | 3300041413 | Bacteria | 5762 |
| 233 | Ga0439465_0052063 | 3300041413 | Bacteria | 1343 |
| 234 | Ga0451787_100068 | 3300041441 | Bacteria | 909 |
| 235 | Ga0451791_1688733 | 3300041451 | Bacteria | 1690 |
| 236 | Ga0451791_1699805 | 3300041451 | Bacteria | 2242 |
| 237 | Ga0451791_1771095 | 3300041451 | Bacteria | 2001 |
| 238 | Ga0451793_0286284 | 3300041452 | Bacteria | 1063 |
| 239 | Ga0451793_0353390 | 3300041452 | Bacteria | 3925 |
| 240 | Ga0451793_0610649 | 3300041452 | Bacteria | 1681 |
| 241 | Ga0451797_1064593 | 3300041453 | Bacteria | 1118 |
| 242 | Ga0451797_1567948 | 3300041453 | Bacteria | 1340 |
| 243 | Ga0451795_0381857 | 3300041456 | Bacteria | 760 |
| 244 | Ga0451800_0043135 | 3300041459 | Bacteria | 15391 |
| 245 | Ga0451806_227471 | 3300041462 | Bacteria | 9726 |
| 246 | Ga0451804_0422292 | 3300041463 | Bacteria | 4557 |
| 247 | Ga0451807_0245276 | 3300041486 | Bacteria | 759 |
| 248 | Ga0451807_0896054 | 3300041486 | Bacteria | 1092 |
| 249 | Ga0451807_1184572 | 3300041486 | Bacteria | 5477 |
| 250 | Ga0451807_1416860 | 3300041486 | Bacteria | 1452 |
| 251 | Ga0451837_0618110 | 3300041494 | Bacteria | 2452 |
| 252 | Ga0451843_1219447 | 3300041509 | Bacteria | 1301 |
| 253 | Ga0439431_0044072 | 3300041997 | Bacteria | 1143 |
| 254 | Ga0439431_0096265 | 3300041997 | Bacteria | 810 |
| 255 | Ga0439445_0060605 | 3300042004 | Bacteria | 1034 |
| 256 | Ga0439445_0067905 | 3300042004 | Bacteria | 983 |
| 257 | Ga0439449_0005232 | 3300042007 | Bacteria | 4977 |
| 258 | Ga0439449_0070659 | 3300042007 | Bacteria | 1286 |
| 259 | Ga0439462_0030393 | 3300042015 | Bacteria | 1429 |
| 260 | Ga0450911_004223 | 3300042115 | Bacteria | 2385 |
| 261 | Ga0451577_0002744 | 3300042876 | Bacteria | 20405 |
| 262 | Ga0466965_0467189 | 3300044683 | Bacteria | 704 |
| 263 | Ga0453684_0000615 | 3300044712 | Bacteria | 130336 |
| 264 | Ga0453684_0311166 | 3300044712 | Bacteria | 1787 |
| 265 | Ga0451576_0000201 | 3300045051 | Bacteria | 150175 |
| 266 | Ga0495627_012652 | 3300046453 | Bacteria | 2989 |
| 267 | Ga0495627_035203 | 3300046453 | Bacteria | 1561 |
| 268 | Ga0495638_0000065 | 3300046460 | Bacteria | 170849 |
| 269 | Ga0495638_0000094 | 3300046460 | Bacteria | 142168 |
| 270 | Ga0495638_0040130 | 3300046460 | Bacteria | 2967 |
| 271 | Ga0495650_0000078 | 3300046471 | Bacteria | 245487 |
| 272 | Ga0495607_0033369 | 3300046501 | Bacteria | 3132 |
| 273 | Ga0495606_0001012 | 3300046507 | Bacteria | 40883 |
| 274 | Ga0495606_0211974 | 3300046507 | Bacteria | 1096 |
| 275 | Ga0495610_0045291 | 3300046512 | Bacteria | 2177 |
| 276 | Ga0495610_0089893 | 3300046512 | Bacteria | 1394 |
| 277 | Ga0495631_0052761 | 3300046518 | Bacteria | 1775 |
| 278 | Ga0495632_0119423 | 3300046519 | Bacteria | 1233 |
| 279 | Ga0495663_0000180 | 3300046525 | Bacteria | 25223 |
| 280 | Ga0495663_0003893 | 3300046525 | Bacteria | 4253 |
| 281 | Ga0495663_0019137 | 3300046525 | Bacteria | 1956 |
| 282 | Ga0495663_0035709 | 3300046525 | Bacteria | 1493 |
| 283 | Ga0495654_0074838 | 3300046530 | Bacteria | 1599 |
| 284 | Ga0495597_0078707 | 3300046542 | Bacteria | 1412 |
| 285 | Ga0495622_0014098 | 3300046557 | Bacteria | 3710 |
| 286 | Ga0495633_0008677 | 3300046558 | Bacteria | 5704 |
| 287 | Ga0495633_0019234 | 3300046558 | Bacteria | 3454 |
| 288 | Ga0495633_0052540 | 3300046558 | Bacteria | 1919 |
| 289 | Ga0495633_0167610 | 3300046558 | Bacteria | 1013 |
| 290 | Ga0495668_0053702 | 3300046616 | Bacteria | 2227 |
| 291 | Ga0495625_0026251 | 3300046660 | Bacteria | 4404 |
| 292 | Ga0495625_0032476 | 3300046660 | Bacteria | 3869 |
| 293 | Ga0495671_0078254 | 3300046692 | Bacteria | 1621 |
| 294 | Ga0495672_0195505 | 3300047320 | Bacteria | 1014 |
| 295 | Ga0496113_0556161 | 3300048916 | Bacteria | 920 |
| 296 | Ga0496115_0005442 | 3300048918 | Bacteria | 9261 |
| 297 | Ga0496115_0178579 | 3300048918 | Bacteria | 1755 |
| 298 | Ga0496116_0003550 | 3300048919 | Bacteria | 15344 |
| 299 | Ga0496116_0182750 | 3300048919 | Bacteria | 1120 |
| 300 | Ga0496116_0272645 | 3300048919 | Bacteria | 825 |
| 301 | Ga0496117_0005370 | 3300048920 | Bacteria | 13499 |
| 302 | Ga0496117_0040021 | 3300048920 | Bacteria | 3453 |
| 303 | Ga0496117_0060661 | 3300048920 | Bacteria | 2604 |
| 304 | Ga0496117_0077460 | 3300048920 | Bacteria | 2200 |
| 305 | Ga0496117_0170456 | 3300048920 | Bacteria | 1264 |
| 306 | Ga0496118_0005917 | 3300048921 | Bacteria | 13681 |
| 307 | Ga0496118_0049783 | 3300048921 | Bacteria | 3222 |
| 308 | Ga0496118_0073270 | 3300048921 | Bacteria | 2454 |
| 309 | Ga0496118_0097927 | 3300048921 | Bacteria | 1993 |
| 310 | Ga0496118_0323532 | 3300048921 | Bacteria | 836 |
| 311 | Ga0496119_0000768 | 3300048922 | Bacteria | 43140 |
| 312 | Ga0496120_0000780 | 3300048923 | Bacteria | 46094 |
| 313 | Ga0496121_0006840 | 3300048924 | Bacteria | 13949 |
| 314 | Ga0496121_0078296 | 3300048924 | Bacteria | 2629 |
| 315 | Ga0496121_0112611 | 3300048924 | Bacteria | 2072 |
| 316 | Ga0496121_0510650 | 3300048924 | Bacteria | 761 |
| 317 | Ga0496122_0001130 | 3300048925 | Bacteria | 45920 |
| 318 | Ga0496122_0002422 | 3300048925 | Bacteria | 26530 |
| 319 | Ga0496122_0023754 | 3300048925 | Bacteria | 5388 |
| 320 | Ga0496122_0039098 | 3300048925 | Bacteria | 3788 |
| 321 | Ga0496122_0056901 | 3300048925 | Bacteria | 2910 |
| 322 | Ga0496122_0071321 | 3300048925 | Bacteria | 2476 |
| 323 | Ga0496123_0000852 | 3300048926 | Bacteria | 48678 |
| 324 | Ga0496123_0016719 | 3300048926 | Bacteria | 5939 |
| 325 | Ga0496123_0018783 | 3300048926 | Bacteria | 5479 |
| 326 | Ga0496123_0072773 | 3300048926 | Bacteria | 2136 |
| 327 | Ga0496123_0183109 | 3300048926 | Bacteria | 1092 |
| 328 | Ga0496123_0258544 | 3300048926 | Bacteria | 854 |
| 329 | Ga0496124_0002997 | 3300048927 | Bacteria | 21122 |
| 330 | Ga0496124_0025370 | 3300048927 | Bacteria | 5369 |
| 331 | Ga0496124_0051221 | 3300048927 | Bacteria | 3513 |
| 332 | Ga0496124_0114608 | 3300048927 | Bacteria | 2164 |
| 333 | Ga0496124_0484918 | 3300048927 | Bacteria | 833 |
| 334 | Ga0496125_0028259 | 3300048928 | Bacteria | 5071 |
| 335 | Ga0496125_0105210 | 3300048928 | Bacteria | 2063 |
| 336 | Ga0496125_0144235 | 3300048928 | Bacteria | 1649 |
| 337 | Ga0496125_0160678 | 3300048928 | Bacteria | 1526 |
| 338 | Ga0496125_0172729 | 3300048928 | Bacteria | 1450 |
| 339 | Ga0496126_0045844 | 3300048929 | Bacteria | 4015 |
| 340 | Ga0496126_0051371 | 3300048929 | Bacteria | 3753 |
| 341 | Ga0496126_0362095 | 3300048929 | Bacteria | 1184 |
| 342 | Ga0495682_0189958 | 3300049460 | Bacteria | 729 |
| 343 | Ga0501290_000701 | 3300049513 | Bacteria | 4981 |
| 344 | Ga0501031_0020474 | 3300049568 | Bacteria | 4313 |
| 345 | Ga0501032_0112219 | 3300049569 | Bacteria | 1803 |
| 346 | Ga0501033_0000492 | 3300049570 | Bacteria | 37245 |
| 347 | Ga0501034_0000221 | 3300049571 | Bacteria | 108958 |
| 348 | Ga0501034_0228813 | 3300049571 | Bacteria | 1809 |
| 349 | Ga0501034_0333964 | 3300049571 | Bacteria | 1447 |
| 350 | Ga0501036_0317230 | 3300049572 | Bacteria | 1303 |
| 351 | Ga0501037_0100998 | 3300049573 | Bacteria | 2082 |
| 352 | Ga0501038_0449875 | 3300049574 | Bacteria | 990 |
| 353 | Ga0501039_0021560 | 3300049575 | Bacteria | 4941 |
| 354 | Ga0501043_0000526 | 3300049579 | Bacteria | 34405 |
| 355 | Ga0501043_0161775 | 3300049579 | Bacteria | 1749 |
| 356 | Ga0501043_0278202 | 3300049579 | Bacteria | 1283 |
| 357 | Ga0501047_0327065 | 3300049581 | Bacteria | 1372 |
| 358 | Ga0501048_0106402 | 3300049582 | Bacteria | 1980 |
| 359 | Ga0501225_0050242 | 3300049705 | Bacteria | 1160 |
| 360 | Ga0501080_0922470 | 3300049742 | Bacteria | 760 |
| 361 | Ga0501265_030200 | 3300049762 | Bacteria | 776 |
| 362 | Ga0501275_000042 | 3300049772 | Bacteria | 12700 |
| 363 | Ga0501035_0065029 | 3300049822 | Bacteria | 3240 |
| 364 | nmdc:mga00v17_109967_c1 | 3300050491 | Bacteria | 1748 |
| 365 | nmdc:mga00v17_118_c1 | 3300050491 | Bacteria | 46536 |
| 366 | nmdc:mga00v17_179540_c1 | 3300050491 | Bacteria | 1366 |
| 367 | nmdc:mga00v17_98491_c1 | 3300050491 | Bacteria | 1844 |
| 368 | Ga0500634_0006480 | 3300053161 | Bacteria | 5672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10791903 | Ga0111539_107919032 | 185 |
| 2 | 3300005334 | Ga0068869_100011280 | Ga0068869_1000112803 | 186 |
| 3 | 3300013296 | Ga0157374_10078704 | Ga0157374_100787043 | 186 |
| 4 | 3300025942 | Ga0207689_10009982 | Ga0207689_100099823 | 186 |
| 5 | iso_pu_bacteria | 2547132130 | 2547501528 | 192 |
| 6 | iso_pu_bacteria | 2747842428 | 2747950073 | 192 |
| 7 | iso_pu_bacteria | 2765235840 | 2765578330 | 192 |
| 8 | iso_pu_bacteria | 2816332141 | 2816516348 | 192 |
| 9 | iso_pu_bacteria | 2842391507 | 2842392941 | 192 |
| 10 | iso_pu_bacteria | 2842757796 | 2842758717 | 192 |
| 11 | iso_pu_bacteria | 2884411467 | 2884413287 | 192 |
| 12 | iso_pu_bacteria | 2894414249 | 2894416309 | 192 |
| 13 | iso_pu_bacteria | 2895498888 | 2895499356 | 192 |
| 14 | iso_pu_bacteria | 2895511927 | 2895512376 | 192 |
| 15 | iso_pu_bacteria | 2895522137 | 2895522388 | 192 |
| 16 | iso_pu_bacteria | 2895525241 | 2895525842 | 192 |
| 17 | iso_pu_bacteria | 2919134579 | 2919136806 | 192 |
| 18 | iso_pu_bacteria | 2961064222 | 2961067056 | 192 |
| 19 | iso_pu_bacteria | 8002869464 | 8002869477 | 192 |
| 20 | iso_pu_bacteria | 2524614729 | 2525557021 | 193 |
| 21 | iso_pu_bacteria | 2627854209 | 2630648617 | 193 |
| 22 | iso_pu_bacteria | 2643221559 | 2643815769 | 193 |
| 23 | iso_pu_bacteria | 2643221573 | 2643878105 | 193 |
| 24 | iso_pu_bacteria | 2643221586 | 2643940725 | 193 |
| 25 | iso_pu_bacteria | 2643221593 | 2643975546 | 193 |
| 26 | iso_pu_bacteria | 2643221612 | 2644080227 | 193 |
| 27 | iso_pu_bacteria | 2643221720 | 2644659414 | 193 |
| 28 | iso_pu_bacteria | 2643221727 | 2644695824 | 193 |
| 29 | iso_pu_bacteria | 2643221728 | 2644700841 | 193 |
| 30 | iso_pu_bacteria | 2941489479 | 2941491655 | 193 |
| 31 | iso_pu_bacteria | 2995948881 | 2995952719 | 193 |
| 32 | iso_pu_bacteria | 8003014200 | 8003016516 | 193 |
| 33 | iso_pu_bacteria | 2874220319 | 2874220950 | 194 |
| 34 | iso_pu_bacteria | 2919089067 | 2919091159 | 194 |
| 35 | iso_pu_bacteria | 2928496128 | 2928497792 | 194 |
| 36 | iso_pu_bacteria | 2931380184 | 2931381405 | 194 |
| 37 | iso_pu_bacteria | 2937610967 | 2937611771 | 194 |
| 38 | iso_pu_bacteria | 2939626828 | 2939627710 | 194 |
| 39 | iso_pu_bacteria | 2961047084 | 2961047715 | 194 |
| 40 | iso_pu_bacteria | 2977247770 | 2977250220 | 194 |
| 41 | iso_pu_bacteria | 2987605356 | 2987608266 | 194 |
| 42 | 3300038705 | Ga0237819_13891 | Ga0237819_13891_45_632 | 195 |
| 43 | 3300041413 | Ga0439465_0002742 | Ga0439465_0002742_1013_1600 | 195 |
| 44 | 3300042007 | Ga0439449_0005232 | Ga0439449_0005232_4143_4730 | 195 |
| 45 | iso_pu_bacteria | 2928963466 | 2928964376 | 195 |
| 46 | 3300003320 | rootH2_10017930 | rootH2_100179306 | 196 |
| 47 | 3300003323 | rootH1_10167707 | rootH1_101677071 | 196 |
| 48 | 3300003781 | Ga0055536_1000574 | Ga0055536_10005744 | 196 |
| 49 | 3300003794 | Ga0055531_10009651 | Ga0055531_100096514 | 196 |
| 50 | 3300005347 | Ga0070668_100013066 | Ga0070668_1000130662 | 196 |
| 51 | 3300005353 | Ga0070669_100026442 | Ga0070669_1000264423 | 196 |
| 52 | 3300005547 | Ga0070693_100141065 | Ga0070693_1001410652 | 196 |
| 53 | 3300006038 | Ga0075365_10104844 | Ga0075365_101048442 | 196 |
| 54 | 3300006051 | Ga0075364_10000206 | Ga0075364_100002065 | 196 |
| 55 | 3300006186 | Ga0075369_10005753 | Ga0075369_100057536 | 196 |
| 56 | 3300009036 | Ga0105244_10134560 | Ga0105244_101345602 | 196 |
| 57 | 3300009148 | Ga0105243_10033621 | Ga0105243_100336212 | 196 |
| 58 | 3300013104 | Ga0157370_10486168 | Ga0157370_104861681 | 196 |
| 59 | 3300025206 | Ga0209435_107577 | Ga0209435_1075772 | 196 |
| 60 | 3300025233 | Ga0209437_107776 | Ga0209437_1077762 | 196 |
| 61 | 3300025256 | Ga0209759_1005468 | Ga0209759_10054684 | 196 |
| 62 | 3300025261 | Ga0209233_1015435 | Ga0209233_10154352 | 196 |
| 63 | 3300025292 | Ga0209676_1000047 | Ga0209676_1000047355 | 196 |
| 64 | 3300025298 | Ga0209050_1022821 | Ga0209050_10228212 | 196 |
| 65 | 3300025298 | Ga0209050_1047017 | Ga0209050_10470172 | 196 |
| 66 | 3300025304 | Ga0209257_1000278 | Ga0209257_100027880 | 196 |
| 67 | 3300025923 | Ga0207681_10068483 | Ga0207681_100684833 | 196 |
| 68 | 3300025935 | Ga0207709_10017863 | Ga0207709_100178632 | 196 |
| 69 | 3300025940 | Ga0207691_10408342 | Ga0207691_104083422 | 196 |
| 70 | 3300025972 | Ga0207668_10044347 | Ga0207668_100443473 | 196 |
| 71 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004586 | 196 |
| 72 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005460 | 196 |
| 73 | 3300032004 | Ga0307414_10001147 | Ga0307414_1000114715 | 196 |
| 74 | 3300032004 | Ga0307414_10026448 | Ga0307414_100264484 | 196 |
| 75 | 3300032004 | Ga0307414_10292159 | Ga0307414_102921592 | 196 |
| 76 | 3300041404 | Ga0439436_0021349 | Ga0439436_0021349_232_822 | 196 |
| 77 | 3300041451 | Ga0451791_1688733 | Ga0451791_1688733_854_1444 | 196 |
| 78 | 3300041453 | Ga0451797_1567948 | Ga0451797_1567948_565_1155 | 196 |
| 79 | 3300041494 | Ga0451837_0618110 | Ga0451837_0618110_1761_2351 | 196 |
| 80 | 3300044712 | Ga0453684_0000615 | Ga0453684_0000615_6187_6777 | 196 |
| 81 | 3300045051 | Ga0451576_0000201 | Ga0451576_0000201_6187_6777 | 196 |
| 82 | 3300046453 | Ga0495627_035203 | Ga0495627_035203_561_1151 | 196 |
| 83 | 3300046471 | Ga0495650_0000078 | Ga0495650_0000078_3537_4133 | 196 |
| 84 | 3300046519 | Ga0495632_0119423 | Ga0495632_0119423_160_750 | 196 |
| 85 | 3300046525 | Ga0495663_0003893 | Ga0495663_0003893_3217_3807 | 196 |
| 86 | 3300046558 | Ga0495633_0008677 | Ga0495633_0008677_4170_4760 | 196 |
| 87 | 3300046558 | Ga0495633_0019234 | Ga0495633_0019234_471_1061 | 196 |
| 88 | 3300047320 | Ga0495672_0195505 | Ga0495672_0195505_165_800 | 196 |
| 89 | 3300048921 | Ga0496118_0323532 | Ga0496118_0323532_62_712 | 196 |
| 90 | 3300048925 | Ga0496122_0002422 | Ga0496122_0002422_25227_25817 | 196 |
| 91 | 3300048926 | Ga0496123_0016719 | Ga0496123_0016719_2056_2646 | 196 |
| 92 | 3300049571 | Ga0501034_0000221 | Ga0501034_0000221_18352_18942 | 196 |
| 93 | 3300049571 | Ga0501034_0333964 | Ga0501034_0333964_597_1187 | 196 |
| 94 | 3300049705 | Ga0501225_0050242 | Ga0501225_0050242_159_749 | 196 |
| 95 | 3300050491 | nmdc:mga00v17_118_c1 | nmdc:mga00v17_118_c1_39216_39809 | 196 |
| 96 | 3300050491 | nmdc:mga00v17_98491_c1 | nmdc:mga00v17_98491_c1_919_1509 | 196 |
| 97 | 3300053161 | Ga0500634_0006480 | Ga0500634_0006480_4362_4952 | 196 |
| 98 | iso_pu_bacteria | 2739367700 | 2739730559 | 196 |
| 99 | iso_pu_bacteria | 2747842501 | 2748015962 | 196 |
| 100 | 3300003187 | JGI25151J46595_10027857 | JGI25151J46595_100278572 | 197 |
| 101 | 3300003320 | rootH2_10041321 | rootH2_100413213 | 197 |
| 102 | 3300003773 | Ga0055537_1000007 | Ga0055537_1000007111 | 197 |
| 103 | 3300003775 | Ga0055524_1000034 | Ga0055524_100003465 | 197 |
| 104 | 3300003775 | Ga0055524_1010699 | Ga0055524_10106995 | 197 |
| 105 | 3300003775 | Ga0055524_1042936 | Ga0055524_10429361 | 197 |
| 106 | 3300003781 | Ga0055536_1013863 | Ga0055536_10138633 | 197 |
| 107 | 3300003784 | Ga0055534_1000013 | Ga0055534_100001336 | 197 |
| 108 | 3300003790 | Ga0055528_1000005 | Ga0055528_1000005111 | 197 |
| 109 | 3300003790 | Ga0055528_1059521 | Ga0055528_10595211 | 197 |
| 110 | 3300003792 | Ga0055540_1047305 | Ga0055540_10473052 | 197 |
| 111 | 3300003794 | Ga0055531_10003850 | Ga0055531_100038503 | 197 |
| 112 | 3300003794 | Ga0055531_10028574 | Ga0055531_100285743 | 197 |
| 113 | 3300003794 | Ga0055531_10043779 | Ga0055531_100437792 | 197 |
| 114 | 3300003794 | Ga0055531_10067946 | Ga0055531_100679461 | 197 |
| 115 | 3300005293 | Ga0065715_10097858 | Ga0065715_100978582 | 197 |
| 116 | 3300005339 | Ga0070660_100408419 | Ga0070660_1004084192 | 197 |
| 117 | 3300005457 | Ga0070662_100853017 | Ga0070662_1008530171 | 197 |
| 118 | 3300005458 | Ga0070681_10456033 | Ga0070681_104560331 | 197 |
| 119 | 3300005530 | Ga0070679_100033075 | Ga0070679_1000330753 | 197 |
| 120 | 3300005539 | Ga0068853_100456546 | Ga0068853_1004565461 | 197 |
| 121 | 3300005543 | Ga0070672_100038786 | Ga0070672_1000387865 | 197 |
| 122 | 3300005547 | Ga0070693_100490099 | Ga0070693_1004900992 | 197 |
| 123 | 3300005548 | Ga0070665_101043014 | Ga0070665_1010430141 | 197 |
| 124 | 3300005563 | Ga0068855_101000094 | Ga0068855_1010000941 | 197 |
| 125 | 3300005564 | Ga0070664_100511850 | Ga0070664_1005118502 | 197 |
| 126 | 3300005617 | Ga0068859_100220955 | Ga0068859_1002209553 | 197 |
| 127 | 3300005841 | Ga0068863_100494432 | Ga0068863_1004944322 | 197 |
| 128 | 3300006931 | Ga0097620_100220965 | Ga0097620_1002209653 | 197 |
| 129 | 3300013102 | Ga0157371_10023740 | Ga0157371_100237405 | 197 |
| 130 | 3300013104 | Ga0157370_10200647 | Ga0157370_102006472 | 197 |
| 131 | 3300013105 | Ga0157369_10052643 | Ga0157369_100526431 | 197 |
| 132 | 3300014326 | Ga0157380_10062398 | Ga0157380_100623983 | 197 |
| 133 | 3300015689 | Ga0183360_10001 | Ga0183360_10001487 | 197 |
| 134 | 3300025245 | Ga0207425_1018507 | Ga0207425_10185071 | 197 |
| 135 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005620 | 197 |
| 136 | 3300025263 | Ga0209565_1007783 | Ga0209565_10077831 | 197 |
| 137 | 3300025273 | Ga0209673_1000011 | Ga0209673_1000011275 | 197 |
| 138 | 3300025273 | Ga0209673_1012256 | Ga0209673_10122564 | 197 |
| 139 | 3300025284 | Ga0209130_1013916 | Ga0209130_10139161 | 197 |
| 140 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004620 | 197 |
| 141 | 3300025291 | Ga0209675_1006738 | Ga0209675_10067386 | 197 |
| 142 | 3300025291 | Ga0209675_1010433 | Ga0209675_10104332 | 197 |
| 143 | 3300025292 | Ga0209676_1000299 | Ga0209676_100029910 | 197 |
| 144 | 3300025292 | Ga0209676_1004106 | Ga0209676_10041066 | 197 |
| 145 | 3300025292 | Ga0209676_1006043 | Ga0209676_10060435 | 197 |
| 146 | 3300025292 | Ga0209676_1006724 | Ga0209676_10067242 | 197 |
| 147 | 3300025292 | Ga0209676_1039556 | Ga0209676_10395562 | 197 |
| 148 | 3300025294 | Ga0209025_1000036 | Ga0209025_1000036168 | 197 |
| 149 | 3300025294 | Ga0209025_1001523 | Ga0209025_100152311 | 197 |
| 150 | 3300025294 | Ga0209025_1002538 | Ga0209025_100253811 | 197 |
| 151 | 3300025294 | Ga0209025_1104329 | Ga0209025_11043292 | 197 |
| 152 | 3300025295 | Ga0209564_1000018 | Ga0209564_1000018275 | 197 |
| 153 | 3300025295 | Ga0209564_1014685 | Ga0209564_10146856 | 197 |
| 154 | 3300025295 | Ga0209564_1035113 | Ga0209564_10351132 | 197 |
| 155 | 3300025297 | Ga0209758_1011761 | Ga0209758_10117615 | 197 |
| 156 | 3300025298 | Ga0209050_1000974 | Ga0209050_100097413 | 197 |
| 157 | 3300025299 | Ga0209256_1000021 | Ga0209256_1000021223 | 197 |
| 158 | 3300025299 | Ga0209256_1002619 | Ga0209256_10026193 | 197 |
| 159 | 3300025299 | Ga0209256_1002852 | Ga0209256_100285210 | 197 |
| 160 | 3300025299 | Ga0209256_1003535 | Ga0209256_10035353 | 197 |
| 161 | 3300025299 | Ga0209256_1011716 | Ga0209256_10117162 | 197 |
| 162 | 3300025303 | Ga0209051_1010323 | Ga0209051_10103233 | 197 |
| 163 | 3300025304 | Ga0209257_1000133 | Ga0209257_1000133195 | 197 |
| 164 | 3300025304 | Ga0209257_1000302 | Ga0209257_100030251 | 197 |
| 165 | 3300025304 | Ga0209257_1003685 | Ga0209257_100368511 | 197 |
| 166 | 3300025304 | Ga0209257_1011892 | Ga0209257_10118923 | 197 |
| 167 | 3300025304 | Ga0209257_1015025 | Ga0209257_10150254 | 197 |
| 168 | 3300025304 | Ga0209257_1016054 | Ga0209257_10160545 | 197 |
| 169 | 3300025909 | Ga0207705_10464243 | Ga0207705_104642432 | 197 |
| 170 | 3300025912 | Ga0207707_10183355 | Ga0207707_101833554 | 197 |
| 171 | 3300025919 | Ga0207657_10020989 | Ga0207657_100209897 | 197 |
| 172 | 3300025921 | Ga0207652_10232769 | Ga0207652_102327691 | 197 |
| 173 | 3300025940 | Ga0207691_10022322 | Ga0207691_100223228 | 197 |
| 174 | 3300025949 | Ga0207667_10769611 | Ga0207667_107696111 | 197 |
| 175 | 3300025986 | Ga0207658_10345864 | Ga0207658_103458642 | 197 |
| 176 | 3300026041 | Ga0207639_10840711 | Ga0207639_108407111 | 197 |
| 177 | 3300026088 | Ga0207641_10282147 | Ga0207641_102821472 | 197 |
| 178 | 3300026121 | Ga0207683_10207053 | Ga0207683_102070532 | 197 |
| 179 | 3300027614 | Ga0209970_1014387 | Ga0209970_10143872 | 197 |
| 180 | 3300027665 | Ga0209983_1000195 | Ga0209983_10001957 | 197 |
| 181 | 3300027682 | Ga0209971_1000653 | Ga0209971_10006532 | 197 |
| 182 | 3300027876 | Ga0209974_10002600 | Ga0209974_100026006 | 197 |
| 183 | 3300031456 | Ga0307513_10024959 | Ga0307513_100249594 | 197 |
| 184 | 3300031824 | Ga0307413_10098380 | Ga0307413_100983803 | 197 |
| 185 | 3300031824 | Ga0307413_10547357 | Ga0307413_105473572 | 197 |
| 186 | 3300031901 | Ga0307406_10234135 | Ga0307406_102341352 | 197 |
| 187 | 3300031911 | Ga0307412_10239118 | Ga0307412_102391182 | 197 |
| 188 | 3300031911 | Ga0307412_10824206 | Ga0307412_108242061 | 197 |
| 189 | 3300032004 | Ga0307414_10005257 | Ga0307414_100052574 | 197 |
| 190 | 3300032004 | Ga0307414_10048610 | Ga0307414_100486102 | 197 |
| 191 | 3300032004 | Ga0307414_10112595 | Ga0307414_101125952 | 197 |
| 192 | 3300032004 | Ga0307414_10126079 | Ga0307414_101260792 | 197 |
| 193 | 3300032004 | Ga0307414_10239423 | Ga0307414_102394232 | 197 |
| 194 | 3300032004 | Ga0307414_10335303 | Ga0307414_103353031 | 197 |
| 195 | 3300032004 | Ga0307414_10425362 | Ga0307414_104253621 | 197 |
| 196 | 3300032004 | Ga0307414_10499029 | Ga0307414_104990292 | 197 |
| 197 | 3300032005 | Ga0307411_10850001 | Ga0307411_108500011 | 197 |
| 198 | 3300035092 | Ga0373952_0112148 | Ga0373952_0112148_80_673 | 197 |
| 199 | 3300039145 | Ga0237816_00097 | Ga0237816_00097_5507_6109 | 197 |
| 200 | 3300041404 | Ga0439436_0000552 | Ga0439436_0000552_5921_6526 | 197 |
| 201 | 3300041404 | Ga0439436_0011926 | Ga0439436_0011926_409_1017 | 197 |
| 202 | 3300041406 | Ga0439439_0034869 | Ga0439439_0034869_484_1089 | 197 |
| 203 | 3300041407 | Ga0439447_019128 | Ga0439447_019128_501_1109 | 197 |
| 204 | 3300041410 | Ga0439461_0019013 | Ga0439461_0019013_533_1126 | 197 |
| 205 | 3300041413 | Ga0439465_0000883 | Ga0439465_0000883_3445_4038 | 197 |
| 206 | 3300041413 | Ga0439465_0052063 | Ga0439465_0052063_383_988 | 197 |
| 207 | 3300041441 | Ga0451787_100068 | Ga0451787_100068_56_649 | 197 |
| 208 | 3300041451 | Ga0451791_1771095 | Ga0451791_1771095_740_1333 | 197 |
| 209 | 3300041452 | Ga0451793_0286284 | Ga0451793_0286284_372_965 | 197 |
| 210 | 3300041452 | Ga0451793_0610649 | Ga0451793_0610649_79_672 | 197 |
| 211 | 3300041456 | Ga0451795_0381857 | Ga0451795_0381857_47_697 | 197 |
| 212 | 3300041486 | Ga0451807_0245276 | Ga0451807_0245276_71_721 | 197 |
| 213 | 3300041486 | Ga0451807_0896054 | Ga0451807_0896054_351_944 | 197 |
| 214 | 3300041486 | Ga0451807_1416860 | Ga0451807_1416860_140_733 | 197 |
| 215 | 3300041509 | Ga0451843_1219447 | Ga0451843_1219447_331_981 | 197 |
| 216 | 3300041997 | Ga0439431_0044072 | Ga0439431_0044072_345_938 | 197 |
| 217 | 3300041997 | Ga0439431_0096265 | Ga0439431_0096265_174_767 | 197 |
| 218 | 3300042004 | Ga0439445_0060605 | Ga0439445_0060605_196_801 | 197 |
| 219 | 3300042004 | Ga0439445_0067905 | Ga0439445_0067905_257_850 | 197 |
| 220 | 3300042007 | Ga0439449_0070659 | Ga0439449_0070659_586_1179 | 197 |
| 221 | 3300042015 | Ga0439462_0030393 | Ga0439462_0030393_584_1189 | 197 |
| 222 | 3300042876 | Ga0451577_0002744 | Ga0451577_0002744_14146_14745 | 197 |
| 223 | 3300044683 | Ga0466965_0467189 | Ga0466965_0467189_20_613 | 197 |
| 224 | 3300044712 | Ga0453684_0311166 | Ga0453684_0311166_832_1431 | 197 |
| 225 | 3300046460 | Ga0495638_0040130 | Ga0495638_0040130_943_1551 | 197 |
| 226 | 3300046501 | Ga0495607_0033369 | Ga0495607_0033369_2164_2757 | 197 |
| 227 | 3300046507 | Ga0495606_0211974 | Ga0495606_0211974_459_1052 | 197 |
| 228 | 3300046512 | Ga0495610_0089893 | Ga0495610_0089893_719_1312 | 197 |
| 229 | 3300046525 | Ga0495663_0000180 | Ga0495663_0000180_1449_2042 | 197 |
| 230 | 3300046525 | Ga0495663_0035709 | Ga0495663_0035709_390_986 | 197 |
| 231 | 3300046530 | Ga0495654_0074838 | Ga0495654_0074838_239_832 | 197 |
| 232 | 3300046558 | Ga0495633_0167610 | Ga0495633_0167610_409_1002 | 197 |
| 233 | 3300046616 | Ga0495668_0053702 | Ga0495668_0053702_1264_1872 | 197 |
| 234 | 3300046692 | Ga0495671_0078254 | Ga0495671_0078254_987_1580 | 197 |
| 235 | 3300048916 | Ga0496113_0556161 | Ga0496113_0556161_148_744 | 197 |
| 236 | 3300048924 | Ga0496121_0006840 | Ga0496121_0006840_1924_2532 | 197 |
| 237 | 3300048925 | Ga0496122_0023754 | Ga0496122_0023754_905_1501 | 197 |
| 238 | 3300048925 | Ga0496122_0056901 | Ga0496122_0056901_494_1087 | 197 |
| 239 | 3300048926 | Ga0496123_0018783 | Ga0496123_0018783_3935_4531 | 197 |
| 240 | 3300048926 | Ga0496123_0183109 | Ga0496123_0183109_22_615 | 197 |
| 241 | 3300048928 | Ga0496125_0160678 | Ga0496125_0160678_337_933 | 197 |
| 242 | 3300049513 | Ga0501290_000701 | Ga0501290_000701_126_728 | 197 |
| 243 | 3300049568 | Ga0501031_0020474 | Ga0501031_0020474_1730_2335 | 197 |
| 244 | 3300049569 | Ga0501032_0112219 | Ga0501032_0112219_37_642 | 197 |
| 245 | 3300049570 | Ga0501033_0000492 | Ga0501033_0000492_34992_35741 | 197 |
| 246 | 3300049571 | Ga0501034_0228813 | Ga0501034_0228813_1098_1700 | 197 |
| 247 | 3300049572 | Ga0501036_0317230 | Ga0501036_0317230_498_1103 | 197 |
| 248 | 3300049574 | Ga0501038_0449875 | Ga0501038_0449875_150_755 | 197 |
| 249 | 3300049579 | Ga0501043_0000526 | Ga0501043_0000526_28933_29541 | 197 |
| 250 | 3300049579 | Ga0501043_0161775 | Ga0501043_0161775_1076_1681 | 197 |
| 251 | 3300049581 | Ga0501047_0327065 | Ga0501047_0327065_69_674 | 197 |
| 252 | 3300049742 | Ga0501080_0922470 | Ga0501080_0922470_51_656 | 197 |
| 253 | 3300049762 | Ga0501265_030200 | Ga0501265_030200_42_644 | 197 |
| 254 | 3300049772 | Ga0501275_000042 | Ga0501275_000042_5080_5682 | 197 |
| 255 | 3300049822 | Ga0501035_0065029 | Ga0501035_0065029_2062_2667 | 197 |
| 256 | 3300050491 | nmdc:mga00v17_109967_c1 | nmdc:mga00v17_109967_c1_182_805 | 197 |
| 257 | iso_pu_bacteria | 2818991457 | 2819663665 | 197 |
| 258 | iso_pu_bacteria | 2852684882 | 2852686360 | 197 |
| 259 | iso_pu_bacteria | 2919130084 | 2919132477 | 197 |
| 260 | iso_pu_bacteria | 2929195423 | 2929197055 | 197 |
| 261 | iso_pu_bacteria | 8021622325 | 8021625921 | 197 |
| 262 | iso_pu_bacteria | 8021648035 | 8021648553 | 197 |
| 263 | 3300005347 | Ga0070668_100281981 | Ga0070668_1002819812 | 198 |
| 264 | 3300005548 | Ga0070665_100218154 | Ga0070665_1002181542 | 198 |
| 265 | 3300009036 | Ga0105244_10122571 | Ga0105244_101225712 | 198 |
| 266 | 3300009984 | Ga0105029_100728 | Ga0105029_1007284 | 198 |
| 267 | 3300013100 | Ga0157373_10440348 | Ga0157373_104403481 | 198 |
| 268 | 3300013102 | Ga0157371_10100863 | Ga0157371_101008631 | 198 |
| 269 | 3300013102 | Ga0157371_10126679 | Ga0157371_101266791 | 198 |
| 270 | 3300013104 | Ga0157370_10070903 | Ga0157370_100709031 | 198 |
| 271 | 3300013104 | Ga0157370_10961242 | Ga0157370_109612421 | 198 |
| 272 | 3300017792 | Ga0163161_10603042 | Ga0163161_106030422 | 198 |
| 273 | 3300025972 | Ga0207668_10131371 | Ga0207668_101313712 | 198 |
| 274 | 3300028379 | Ga0268266_10166174 | Ga0268266_101661742 | 198 |
| 275 | 3300030744 | Ga0316181_1081205 | Ga0316181_10812052 | 198 |
| 276 | 3300031911 | Ga0307412_10046965 | Ga0307412_100469652 | 198 |
| 277 | 3300032004 | Ga0307414_10107689 | Ga0307414_101076893 | 198 |
| 278 | 3300042115 | Ga0450911_004223 | Ga0450911_004223_1443_2039 | 198 |
| 279 | 3300046453 | Ga0495627_012652 | Ga0495627_012652_428_1033 | 198 |
| 280 | 3300046512 | Ga0495610_0045291 | Ga0495610_0045291_867_1463 | 198 |
| 281 | 3300046518 | Ga0495631_0052761 | Ga0495631_0052761_806_1402 | 198 |
| 282 | 3300046525 | Ga0495663_0019137 | Ga0495663_0019137_1226_1822 | 198 |
| 283 | 3300046558 | Ga0495633_0052540 | Ga0495633_0052540_1153_1749 | 198 |
| 284 | 3300048919 | Ga0496116_0003550 | Ga0496116_0003550_4436_5032 | 198 |
| 285 | 3300048919 | Ga0496116_0182750 | Ga0496116_0182750_138_743 | 198 |
| 286 | 3300048919 | Ga0496116_0272645 | Ga0496116_0272645_97_705 | 198 |
| 287 | 3300048920 | Ga0496117_0005370 | Ga0496117_0005370_3921_4517 | 198 |
| 288 | 3300048920 | Ga0496117_0040021 | Ga0496117_0040021_2427_3032 | 198 |
| 289 | 3300048920 | Ga0496117_0077460 | Ga0496117_0077460_352_948 | 198 |
| 290 | 3300048920 | Ga0496117_0170456 | Ga0496117_0170456_359_955 | 198 |
| 291 | 3300048921 | Ga0496118_0005917 | Ga0496118_0005917_9066_9662 | 198 |
| 292 | 3300048921 | Ga0496118_0049783 | Ga0496118_0049783_362_967 | 198 |
| 293 | 3300048921 | Ga0496118_0097927 | Ga0496118_0097927_1384_1980 | 198 |
| 294 | 3300048924 | Ga0496121_0078296 | Ga0496121_0078296_1165_1761 | 198 |
| 295 | 3300048924 | Ga0496121_0112611 | Ga0496121_0112611_129_725 | 198 |
| 296 | 3300048925 | Ga0496122_0039098 | Ga0496122_0039098_1749_2357 | 198 |
| 297 | 3300048925 | Ga0496122_0071321 | Ga0496122_0071321_1539_2135 | 198 |
| 298 | 3300048926 | Ga0496123_0072773 | Ga0496123_0072773_1197_1805 | 198 |
| 299 | 3300048926 | Ga0496123_0258544 | Ga0496123_0258544_113_709 | 198 |
| 300 | 3300048927 | Ga0496124_0025370 | Ga0496124_0025370_176_781 | 198 |
| 301 | 3300048927 | Ga0496124_0051221 | Ga0496124_0051221_1477_2073 | 198 |
| 302 | 3300048927 | Ga0496124_0114608 | Ga0496124_0114608_1344_1940 | 198 |
| 303 | 3300048927 | Ga0496124_0484918 | Ga0496124_0484918_164_760 | 198 |
| 304 | 3300048928 | Ga0496125_0105210 | Ga0496125_0105210_1251_1847 | 198 |
| 305 | 3300048928 | Ga0496125_0144235 | Ga0496125_0144235_167_763 | 198 |
| 306 | 3300048928 | Ga0496125_0172729 | Ga0496125_0172729_390_986 | 198 |
| 307 | 3300048929 | Ga0496126_0362095 | Ga0496126_0362095_295_900 | 198 |
| 308 | 3300050491 | nmdc:mga00v17_179540_c1 | nmdc:mga00v17_179540_c1_692_1288 | 198 |
| 309 | 3300002705 | JGI25156J39149_1008673 | JGI25156J39149_10086732 | 199 |
| 310 | 3300002737 | JGI25162J39368_1000260 | JGI25162J39368_100026053 | 199 |
| 311 | 3300002737 | JGI25162J39368_1003520 | JGI25162J39368_10035205 | 199 |
| 312 | 3300002741 | JGI25157J39369_1000867 | JGI25157J39369_10008678 | 199 |
| 313 | 3300002771 | JGI25163J39215_1002529 | JGI25163J39215_10025292 | 199 |
| 314 | 3300002772 | JGI25164J39214_1000133 | JGI25164J39214_100013321 | 199 |
| 315 | 3300003214 | JGI25165J46597_1000255 | JGI25165J46597_100025521 | 199 |
| 316 | 3300003322 | rootL2_10291567 | rootL2_102915673 | 199 |
| 317 | 3300003751 | Ga0055538_1000340 | Ga0055538_100034021 | 199 |
| 318 | 3300003761 | Ga0055535_1001910 | Ga0055535_10019105 | 199 |
| 319 | 3300003761 | Ga0055535_1001965 | Ga0055535_10019655 | 199 |
| 320 | 3300003762 | Ga0055542_1000082 | Ga0055542_1000082129 | 199 |
| 321 | 3300003762 | Ga0055542_1000327 | Ga0055542_100032753 | 199 |
| 322 | 3300003763 | Ga0055529_1000228 | Ga0055529_100022821 | 199 |
| 323 | 3300005365 | Ga0070688_100020859 | Ga0070688_1000208592 | 199 |
| 324 | 3300005466 | Ga0070685_10410080 | Ga0070685_104100802 | 199 |
| 325 | 3300009993 | Ga0105028_102719 | Ga0105028_1027192 | 199 |
| 326 | 3300014969 | Ga0157376_10025383 | Ga0157376_100253833 | 199 |
| 327 | 3300025207 | Ga0209760_100357 | Ga0209760_1003578 | 199 |
| 328 | 3300025224 | Ga0209784_100133 | Ga0209784_10013353 | 199 |
| 329 | 3300025228 | Ga0209672_105542 | Ga0209672_1055423 | 199 |
| 330 | 3300025231 | Ga0207427_100013 | Ga0207427_100013230 | 199 |
| 331 | 3300025231 | Ga0207427_109343 | Ga0207427_1093431 | 199 |
| 332 | 3300025233 | Ga0209437_100015 | Ga0209437_100015307 | 199 |
| 333 | 3300025233 | Ga0209437_100106 | Ga0209437_100106198 | 199 |
| 334 | 3300025242 | Ga0209258_100413 | Ga0209258_1004135 | 199 |
| 335 | 3300025242 | Ga0209258_103362 | Ga0209258_1033623 | 199 |
| 336 | 3300025246 | Ga0209646_1001735 | Ga0209646_10017353 | 199 |
| 337 | 3300025250 | Ga0209026_1000092 | Ga0209026_100009253 | 199 |
| 338 | 3300025250 | Ga0209026_1006858 | Ga0209026_10068582 | 199 |
| 339 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021732 | 199 |
| 340 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010607 | 199 |
| 341 | 3300025256 | Ga0209759_1000278 | Ga0209759_100027821 | 199 |
| 342 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009564 | 199 |
| 343 | 3300025261 | Ga0209233_1010724 | Ga0209233_10107243 | 199 |
| 344 | 3300025272 | Ga0209455_1000120 | Ga0209455_10001206 | 199 |
| 345 | 3300049582 | Ga0501048_0106402 | Ga0501048_0106402_1260_1874 | 199 |
| 346 | 3300003756 | Ga0055533_1001312 | Ga0055533_10013128 | 200 |
| 347 | 3300005340 | Ga0070689_100004531 | Ga0070689_1000045312 | 200 |
| 348 | 3300005347 | Ga0070668_100658954 | Ga0070668_1006589542 | 200 |
| 349 | 3300005843 | Ga0068860_100304993 | Ga0068860_1003049932 | 200 |
| 350 | 3300005844 | Ga0068862_100308318 | Ga0068862_1003083181 | 200 |
| 351 | 3300009093 | Ga0105240_10040273 | Ga0105240_100402735 | 200 |
| 352 | 3300009545 | Ga0105237_11550522 | Ga0105237_115505221 | 200 |
| 353 | 3300013102 | Ga0157371_10046717 | Ga0157371_100467173 | 200 |
| 354 | 3300013104 | Ga0157370_10553244 | Ga0157370_105532442 | 200 |
| 355 | 3300013104 | Ga0157370_10554162 | Ga0157370_105541621 | 200 |
| 356 | 3300013306 | Ga0163162_10416403 | Ga0163162_104164031 | 200 |
| 357 | 3300013307 | Ga0157372_10193970 | Ga0157372_101939703 | 200 |
| 358 | 3300025226 | Ga0209674_100269 | Ga0209674_10026919 | 200 |
| 359 | 3300025228 | Ga0209672_106011 | Ga0209672_1060112 | 200 |
| 360 | 3300025242 | Ga0209258_100991 | Ga0209258_1009913 | 200 |
| 361 | 3300025272 | Ga0209455_1029715 | Ga0209455_10297151 | 200 |
| 362 | 3300025913 | Ga0207695_10085614 | Ga0207695_100856141 | 200 |
| 363 | 3300025920 | Ga0207649_10156470 | Ga0207649_101564702 | 200 |
| 364 | 3300025936 | Ga0207670_10005647 | Ga0207670_100056476 | 200 |
| 365 | 3300025972 | Ga0207668_10538528 | Ga0207668_105385282 | 200 |
| 366 | 3300046460 | Ga0495638_0000065 | Ga0495638_0000065_1926_2534 | 200 |
| 367 | 3300046460 | Ga0495638_0000094 | Ga0495638_0000094_141114_141722 | 200 |
| 368 | 3300046507 | Ga0495606_0001012 | Ga0495606_0001012_11496_12104 | 200 |
| 369 | 3300046542 | Ga0495597_0078707 | Ga0495597_0078707_38_646 | 200 |
| 370 | 3300046557 | Ga0495622_0014098 | Ga0495622_0014098_3034_3642 | 200 |
| 371 | 3300046660 | Ga0495625_0026251 | Ga0495625_0026251_3487_4095 | 200 |
| 372 | 3300046660 | Ga0495625_0032476 | Ga0495625_0032476_3214_3822 | 200 |
| 373 | 3300048918 | Ga0496115_0005442 | Ga0496115_0005442_8127_8735 | 200 |
| 374 | 3300048918 | Ga0496115_0178579 | Ga0496115_0178579_81_689 | 200 |
| 375 | 3300048924 | Ga0496121_0510650 | Ga0496121_0510650_22_708 | 200 |
| 376 | 3300048929 | Ga0496126_0045844 | Ga0496126_0045844_500_1108 | 200 |
| 377 | 3300049460 | Ga0495682_0189958 | Ga0495682_0189958_98_706 | 200 |
| 378 | 3300049573 | Ga0501037_0100998 | Ga0501037_0100998_1244_1852 | 200 |
| 379 | 3300049575 | Ga0501039_0021560 | Ga0501039_0021560_2424_3032 | 200 |
| 380 | 2162886007 | SwRhRL2b_contig_2389512 | SwRhRL2b_0502.00012670 | 201 |
| 381 | 3300002067 | JGI24735J21928_10001248 | JGI24735J21928_100012484 | 201 |
| 382 | 3300003856 | Ga0058692_1000020 | Ga0058692_1000020128 | 201 |
| 383 | 3300005289 | Ga0065704_10071577 | Ga0065704_100715778 | 201 |
| 384 | 3300005331 | Ga0070670_100016085 | Ga0070670_1000160852 | 201 |
| 385 | 3300009011 | Ga0105251_10000010 | Ga0105251_1000001089 | 201 |
| 386 | 3300009148 | Ga0105243_10009736 | Ga0105243_100097364 | 201 |
| 387 | 3300009177 | Ga0105248_10012500 | Ga0105248_100125003 | 201 |
| 388 | 3300015265 | Ga0182005_1003607 | Ga0182005_10036075 | 201 |
| 389 | 3300015687 | Ga0183368_1004 | Ga0183368_100413 | 201 |
| 390 | 3300025735 | Ga0207713_1000452 | Ga0207713_100045210 | 201 |
| 391 | 3300025904 | Ga0207647_10014594 | Ga0207647_100145944 | 201 |
| 392 | 3300025925 | Ga0207650_10050808 | Ga0207650_100508082 | 201 |
| 393 | 3300025935 | Ga0207709_10002528 | Ga0207709_100025285 | 201 |
| 394 | 3300025941 | Ga0207711_10039591 | Ga0207711_100395912 | 201 |
| 395 | 3300027312 | Ga0209371_1000011 | Ga0209371_1000011393 | 201 |
| 396 | 3300030500 | Ga0268256_1000011 | Ga0268256_1000011393 | 201 |
| 397 | 3300030731 | Ga0316177_1125731 | Ga0316177_11257312 | 201 |
| 398 | 3300041451 | Ga0451791_1699805 | Ga0451791_1699805_239_844 | 201 |
| 399 | 3300041452 | Ga0451793_0353390 | Ga0451793_0353390_2052_2657 | 201 |
| 400 | 3300041453 | Ga0451797_1064593 | Ga0451797_1064593_467_1072 | 201 |
| 401 | 3300041459 | Ga0451800_0043135 | Ga0451800_0043135_6410_7015 | 201 |
| 402 | 3300041462 | Ga0451806_227471 | Ga0451806_227471_2739_3344 | 201 |
| 403 | 3300041463 | Ga0451804_0422292 | Ga0451804_0422292_1349_1954 | 201 |
| 404 | 3300041486 | Ga0451807_1184572 | Ga0451807_1184572_4272_4877 | 201 |
| 405 | 3300048920 | Ga0496117_0060661 | Ga0496117_0060661_543_1148 | 201 |
| 406 | 3300048921 | Ga0496118_0073270 | Ga0496118_0073270_1228_1833 | 201 |
| 407 | 3300048922 | Ga0496119_0000768 | Ga0496119_0000768_4185_4790 | 201 |
| 408 | 3300048923 | Ga0496120_0000780 | Ga0496120_0000780_41430_42035 | 201 |
| 409 | 3300048925 | Ga0496122_0001130 | Ga0496122_0001130_4137_4742 | 201 |
| 410 | 3300048926 | Ga0496123_0000852 | Ga0496123_0000852_41311_41916 | 201 |
| 411 | 3300048927 | Ga0496124_0002997 | Ga0496124_0002997_4121_4726 | 201 |
| 412 | 3300048928 | Ga0496125_0028259 | Ga0496125_0028259_4418_5041 | 201 |
| 413 | 3300048929 | Ga0496126_0051371 | Ga0496126_0051371_2510_3115 | 201 |
| 414 | 3300049579 | Ga0501043_0278202 | Ga0501043_0278202_527_1147 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m83-assembly1.cif.gz_A-2 | crystal structure of tylm1 s120a bound to sah and dtdp-phenol | 0.7793 | 4 | 182 |
| 6m82-assembly1.cif.gz_A | crystal structure of tylm1 y14paf bound to sah and dtdp-phenol | 0.7773 | 6 | 184 |
| 3h2b-assembly1.cif.gz_A | crystal structure of the sam-dependent methyltransferase cg3271 from corynebacterium glutamicum in complex with s-adenosyl-l-homocysteine and pyrophosphate. northeast structural genomics consortium target cgr113a | 0.77 | 46 | 182 |
| 6ecv-assembly1.cif.gz_B | stid o-mt residues 976-1266 | 0.7671 | 44 | 176 |
| 4oqe-assembly1.cif.gz_A | crystal structure of the tylm1 n,n-dimethyltransferase in complex with sah and tdp-fuc3nme | 0.7644 | 4 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6MP53_133_292_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8097 | 19 | 143 | 3.40.50.150 |
| af_P9WLW9_47_240_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7961 | 45 | 172 | 3.40.50.150 |
| af_A0A1D6I0D9_80_215_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7858 | 32 | 147 | 3.40.50.150 |
| af_O53979_54_244_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7751 | 15 | 147 | 3.40.50.150 |
| af_Q33AG7_179_362_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7657 | 32 | 138 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5BIL9-F1-model_v4 | deleted | 0.9936 | 1 | 162 |
|
| AF-A0A3D4TRG4-F1-model_v4 | Methyltransferase | 0.9936 | 45 | 196 |
GO:0008168
GO:0032259 |
| AF-A0A6C8X398-F1-model_v4 | deleted | 0.993 | 1 | 182 |
|
| AF-A0A6L5BIL9-F1-model_v4 | deleted | 0.9875 | 1 | 162 |
|
| AF-A0A3D4TRG4-F1-model_v4 | Methyltransferase | 0.9871 | 45 | 196 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar