F438205

General Info

Members Datasets Scaffolds Average Seq Length
414 289 400 292

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1000938|JGI24741J21665_100093811
Length 348
Sequence MTASIIDGKAFAQGLRERVAQQVANFRAAAGRAPGLAVVLVGEDPASAVYVRNKHKATIGAGMESFEHKLPADTSQADLIALVDTLNADXAVDGILVQXPLPGHIDERAVITRIDPDKDVDGFHPVNAGRLATGLYGFVPCTPLGCLMLLKDQLGDLAGLDAVVIGRSNIVGKPMAQLLIKESCTVTVAHSKTRDLSSVVKRADIVVAAVGRAEMVKGEWIKPGATVIDVGINRTEQGLVGDVDFAGALSVADAVTPVPGGVGPMTIAVLLRNTLVSAHRRARAWRTTRTRCDPVAADAGGSRCAGEDAGRGRTRFRGGRQDDRPMDRVSQMVDRRRGDVRATADQGA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
4 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
5 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
223 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
224 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
225 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
243 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
244 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
252 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
253 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
254 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
274 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
280 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
281 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
284 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
289 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 1.21
Bulb 0
Endosphere 20.53
Nodule 0.24
Rhizoplane 3.38
Rhizosphere 64.49
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1673102 2162886007 Bacteria 13823
2 JGI24741J21665_1000938 3300001915 Bacteria 8798
3 JGI24740J21852_10011005 3300001979 Bacteria 3459
4 JGI24739J22299_10003277 3300001989 Bacteria 6175
5 JGI24739J22299_10010024 3300001989 Bacteria 3522
6 JGI24737J22298_10023941 3300001990 Bacteria 1934
7 JGI24737J22298_10023978 3300001990 Bacteria 1933
8 JGI24735J21928_10006140 3300002067 Bacteria 3966
9 JGI25151J46595_10021425 3300003187 Bacteria 2704
10 JGI25165J46597_1000071 3300003214 Bacteria 193222
11 JGI25153J46596_10000007 3300003215 Bacteria 377573
12 JGI25153J46596_10000032 3300003215 Bacteria 196732
13 JGI25153J46596_10020426 3300003215 Bacteria 2505
14 Ga0055525_1000127 3300003759 Bacteria 113683
15 Ga0055542_1000038 3300003762 Bacteria 224625
16 Ga0055529_1000002 3300003763 Bacteria 537914
17 Ga0055529_1000021 3300003763 Bacteria 321484
18 Ga0055537_1001678 3300003773 Bacteria 8218
19 Ga0055524_1000449 3300003775 Bacteria 34096
20 Ga0055530_10000114 3300003791 Bacteria 70700
21 Ga0055531_10000095 3300003794 Bacteria 96056
22 Ga0055531_10002305 3300003794 Bacteria 12892
23 Ga0055531_10025151 3300003794 Bacteria 2173
24 Ga0065165_1003183 3300005262 Bacteria 12013
25 Ga0065165_1003788 3300005262 Bacteria 10119
26 Ga0065704_10070193 3300005289 Bacteria 98570
27 Ga0070658_10004008 3300005327 Bacteria 12067
28 Ga0070658_10034682 3300005327 Bacteria 4060
29 Ga0070658_10085273 3300005327 Bacteria 2597
30 Ga0070683_100211431 3300005329 Bacteria 1843
31 Ga0070660_100005512 3300005339 Bacteria 8765
32 Ga0070660_100016614 3300005339 Bacteria 5346
33 Ga0070660_100064071 3300005339 Bacteria 2859
34 Ga0070660_100453096 3300005339 Bacteria 1064
35 Ga0070661_100006527 3300005344 Bacteria 8049
36 Ga0070668_100016101 3300005347 Bacteria 5596
37 Ga0070674_100000209 3300005356 Bacteria 28138
38 Ga0070674_100036448 3300005356 Bacteria 3302
39 Ga0070673_100303139 3300005364 Bacteria 1407
40 Ga0070659_100110128 3300005366 Bacteria 2223
41 Ga0070667_100027401 3300005367 Bacteria 4740
42 Ga0070667_100226822 3300005367 Bacteria 1664
43 Ga0070663_100093271 3300005455 Bacteria 2234
44 Ga0070678_100001063 3300005456 Bacteria 14344
45 Ga0070662_100026436 3300005457 Bacteria 4020
46 Ga0070662_100078053 3300005457 Bacteria 2459
47 Ga0070679_100019156 3300005530 Bacteria 6649
48 Ga0070679_100080732 3300005530 Bacteria 3242
49 Ga0070684_100712740 3300005535 Bacteria 936
50 Ga0068853_100166127 3300005539 Bacteria 1994
51 Ga0070665_100000084 3300005548 Bacteria 180481
52 Ga0070665_100000563 3300005548 Bacteria 51697
53 Ga0070665_100034424 3300005548 Bacteria 5094
54 Ga0068855_100377383 3300005563 Bacteria 1557
55 Ga0070664_100016865 3300005564 Bacteria 5993
56 Ga0070664_100088706 3300005564 Bacteria 2674
57 Ga0068854_100005843 3300005578 Bacteria 7791
58 Ga0068856_100323893 3300005614 Bacteria 1558
59 Ga0068852_100045745 3300005616 Bacteria 3725
60 Ga0068859_100004238 3300005617 Bacteria 14643
61 Ga0068861_100000369 3300005719 Bacteria 25884
62 Ga0068858_100000673 3300005842 Bacteria 35672
63 Ga0068858_100000848 3300005842 Bacteria 31661
64 Ga0068862_100004531 3300005844 Bacteria 11717
65 Ga0075365_10043208 3300006038 Bacteria 2950
66 Ga0075368_10000304 3300006042 Bacteria 14246
67 Ga0075363_100044118 3300006048 Bacteria 2361
68 Ga0075364_10175702 3300006051 Bacteria 1448
69 Ga0075362_10001064 3300006177 Bacteria 8483
70 Ga0075367_10022925 3300006178 Bacteria 3508
71 Ga0075369_10005423 3300006186 Bacteria 4766
72 Ga0075366_10001558 3300006195 Bacteria 11460
73 Ga0075366_10075705 3300006195 Bacteria 2008
74 Ga0075366_10083762 3300006195 Bacteria 1906
75 Ga0097621_100081758 3300006237 Bacteria 2689
76 Ga0075370_10188619 3300006353 Bacteria 1214
77 Ga0068865_100105960 3300006881 Bacteria 2066
78 Ga0097620_100004238 3300006931 Bacteria 14643
79 Ga0105243_10005193 3300009148 Bacteria 10193
80 Ga0105241_10022861 3300009174 Bacteria 4634
81 Ga0105248_10003802 3300009177 Bacteria 16733
82 Ga0105248_10179174 3300009177 Bacteria 2388
83 Ga0105237_10235292 3300009545 Bacteria 1833
84 Ga0157326_1000005 3300012513 Bacteria 18291
85 Ga0157371_10000011 3300013102 Bacteria 377608
86 Ga0157370_10167170 3300013104 Bacteria 2045
87 Ga0157369_10153643 3300013105 Bacteria 2432
88 Ga0157378_10022711 3300013297 Bacteria 5522
89 Ga0163162_10015197 3300013306 Bacteria 7520
90 Ga0163163_10030854 3300014325 Bacteria 5169
91 Ga0157379_10016508 3300014968 Bacteria 6494
92 Ga0163161_10044190 3300017792 Bacteria 3209
93 Ga0213875_10017527 3300021388 Bacteria 3458
94 Ga0209563_100125 3300025230 Bacteria 113854
95 Ga0207425_1000025 3300025245 Bacteria 321872
96 Ga0207425_1008802 3300025245 Bacteria 2554
97 Ga0209677_106269 3300025253 Bacteria 2859
98 Ga0209148_1000008 3300025254 Bacteria 1504371
99 Ga0209129_1004271 3300025258 Bacteria 5703
100 Ga0209233_1000140 3300025261 Bacteria 193274
101 Ga0209565_1000011 3300025263 Bacteria 637062
102 Ga0209455_1000002 3300025272 Bacteria 1505459
103 Ga0209673_1001510 3300025273 Bacteria 21442
104 Ga0209675_1006612 3300025291 Bacteria 4614
105 Ga0209676_1026320 3300025292 Bacteria 1849
106 Ga0209025_1000176 3300025294 Bacteria 158186
107 Ga0209758_1000002 3300025297 Bacteria 1400310
108 Ga0209758_1000017 3300025297 Bacteria 754393
109 Ga0209758_1010311 3300025297 Bacteria 5613
110 Ga0209050_1000051 3300025298 Bacteria 353153
111 Ga0209050_1009509 3300025298 Bacteria 4959
112 Ga0209050_1017959 3300025298 Bacteria 2782
113 Ga0209256_1000016 3300025299 Bacteria 599092
114 Ga0209257_1000028 3300025304 Bacteria 699493
115 Ga0209257_1001470 3300025304 Bacteria 27730
116 Ga0209257_1003635 3300025304 Bacteria 12968
117 Ga0207697_10007117 3300025315 Bacteria 5007
118 Ga0207680_10007605 3300025903 Bacteria 5290
119 Ga0207647_10019227 3300025904 Bacteria 4597
120 Ga0207705_10003597 3300025909 Bacteria 11806
121 Ga0207705_10004771 3300025909 Bacteria 10210
122 Ga0207705_10007727 3300025909 Bacteria 7904
123 Ga0207705_10131333 3300025909 Bacteria 1864
124 Ga0207705_10180650 3300025909 Bacteria 1592
125 Ga0207654_10000246 3300025911 Bacteria 32849
126 Ga0207695_10091108 3300025913 Bacteria 3064
127 Ga0207671_10066063 3300025914 Bacteria 2692
128 Ga0207671_10235206 3300025914 Bacteria 1438
129 Ga0207657_10002813 3300025919 Bacteria 18715
130 Ga0207657_10008183 3300025919 Bacteria 10654
131 Ga0207657_10098456 3300025919 Bacteria 2430
132 Ga0207649_10002323 3300025920 Bacteria 10680
133 Ga0207652_10027113 3300025921 Bacteria 4774
134 Ga0207681_10221870 3300025923 Bacteria 1463
135 Ga0207687_10000892 3300025927 Bacteria 20277
136 Ga0207644_10236912 3300025931 Bacteria 1452
137 Ga0207690_10000630 3300025932 Bacteria 22732
138 Ga0207690_10049022 3300025932 Bacteria 2813
139 Ga0207706_10021968 3300025933 Bacteria 5728
140 Ga0207709_10000116 3300025935 Bacteria 123061
141 Ga0207709_10018879 3300025935 Bacteria 3867
142 Ga0207709_10075718 3300025935 Bacteria 2152
143 Ga0207669_10000022 3300025937 Bacteria 100002
144 Ga0207669_10017084 3300025937 Bacteria 3710
145 Ga0207704_10051288 3300025938 Bacteria 2494
146 Ga0207711_10121206 3300025941 Bacteria 2335
147 Ga0207711_10244639 3300025941 Bacteria 1645
148 Ga0207661_10224509 3300025944 Bacteria 1661
149 Ga0207679_10201768 3300025945 Bacteria 1662
150 Ga0207667_10000001 3300025949 Bacteria 1178522
151 Ga0207667_10017604 3300025949 Bacteria 8036
152 Ga0207651_10333292 3300025960 Bacteria 1272
153 Ga0207668_10025165 3300025972 Bacteria 3849
154 Ga0207668_10097755 3300025972 Bacteria 2173
155 Ga0207640_10003242 3300025981 Bacteria 8767
156 Ga0207640_10004847 3300025981 Bacteria 7305
157 Ga0207658_10037395 3300025986 Bacteria 3488
158 Ga0207703_10000167 3300026035 Bacteria 76517
159 Ga0207703_10000302 3300026035 Bacteria 54142
160 Ga0207639_10044491 3300026041 Bacteria 3339
161 Ga0207678_10002526 3300026067 Bacteria 16670
162 Ga0207678_10006831 3300026067 Bacteria 10119
163 Ga0207678_10129505 3300026067 Bacteria 2152
164 Ga0207702_10093196 3300026078 Bacteria 2641
165 Ga0207641_10476079 3300026088 Bacteria 1210
166 Ga0207674_10006741 3300026116 Bacteria 13483
167 Ga0207674_10038792 3300026116 Bacteria 4941
168 Ga0207675_100002178 3300026118 Bacteria 19460
169 Ga0207683_10058649 3300026121 Bacteria 3380
170 Ga0207698_10006957 3300026142 Bacteria 7077
171 Ga0209371_1011317 3300027312 Bacteria 2658
172 Ga0209813_10000279 3300027866 Bacteria 14382
173 Ga0268266_10000002 3300028379 Bacteria 3059047
174 Ga0268266_10000336 3300028379 Bacteria 73612
175 Ga0268266_10025965 3300028379 Bacteria 4983
176 Ga0268266_10248081 3300028379 Bacteria 1646
177 Ga0307517_10136467 3300028786 Bacteria 1742
178 Ga0268256_1013168 3300030500 Bacteria 2522
179 Ga0307513_10126196 3300031456 Bacteria 2514
180 Ga0307513_10352859 3300031456 Bacteria 1218
181 Ga0307513_10364443 3300031456 Bacteria 1189
182 Ga0307509_10099955 3300031507 Bacteria 2941
183 Ga0307408_100040343 3300031548 Bacteria 3305
184 Ga0307408_100278266 3300031548 Bacteria 1392
185 Ga0307508_10013978 3300031616 Bacteria 7324
186 Ga0307413_10042524 3300031824 Bacteria 2671
187 Ga0307410_10190679 3300031852 Bacteria 1558
188 Ga0307406_10009088 3300031901 Bacteria 5560
189 Ga0307406_10043181 3300031901 Bacteria 2818
190 Ga0307412_10063834 3300031911 Bacteria 2486
191 Ga0307412_10071792 3300031911 Bacteria 2364
192 Ga0307412_10195291 3300031911 Bacteria 1533
193 Ga0307409_100028687 3300031995 Bacteria 3970
194 Ga0307416_100007660 3300032002 Bacteria 6891
195 Ga0307414_10024487 3300032004 Bacteria 3850
196 Ga0307414_10108608 3300032004 Bacteria 2105
197 Ga0307411_10127685 3300032005 Bacteria 1852
198 Ga0307415_100014984 3300032126 Bacteria 4576
199 Ga0307415_100094767 3300032126 Bacteria 2171
200 Ga0307415_100179481 3300032126 Bacteria 1660
201 Ga0307510_10056146 3300033180 Bacteria 4104
202 Ga0436364_0342998 3300037853 Bacteria 4004
203 Ga0436364_1222979 3300037853 Bacteria 5848
204 Ga0436365_0496544 3300039437 Bacteria 35992
205 Ga0436365_0929932 3300039437 Bacteria 1315
206 Ga0436365_1468289 3300039437 Bacteria 6799
207 Ga0436365_1701385 3300039437 Bacteria 991
208 Ga0436363_0993985 3300039450 Bacteria 3359
209 Ga0439436_0024666 3300041404 Bacteria 1773
210 Ga0439447_042156 3300041407 Bacteria 1109
211 Ga0439465_0007579 3300041413 Bacteria 3445
212 Ga0439457_008236 3300042014 Bacteria 2464
213 Ga0450920_020723 3300042122 Bacteria 1268
214 Ga0439446_0046062 3300042156 Bacteria 1294
215 Ga0439434_0052253 3300042435 Bacteria 1268
216 Ga0451577_0100234 3300042876 Bacteria 2587
217 Ga0466961_0107513 3300044693 Unclassified 1756
218 Ga0466963_0002237 3300044694 Bacteria 10729
219 Ga0466963_0005313 3300044694 Bacteria 7529
220 Ga0466971_0159953 3300044719 Bacteria 1054
221 Ga0466968_0041314 3300044735 Unclassified 1946
222 Ga0466957_0000426 3300044842 Bacteria 20782
223 Ga0466957_0004800 3300044842 Bacteria 7566
224 Ga0466959_0010720 3300045049 Bacteria 6564
225 Ga0466958_0000869 3300045836 Bacteria 13481
226 Ga0466958_0006675 3300045836 Bacteria 6297
227 Ga0466967_0002800 3300045976 Bacteria 11059
228 Ga0466967_0017915 3300045976 Bacteria 5643
229 Ga0495627_034034 3300046453 Bacteria 1594
230 Ga0495638_0001960 3300046460 Bacteria 17620
231 Ga0495638_0070982 3300046460 Bacteria 2131
232 Ga0495650_0000967 3300046471 Bacteria 32924
233 Ga0495650_0048776 3300046471 Bacteria 1762
234 Ga0495584_0106252 3300046491 Bacteria 1419
235 Ga0495584_0186688 3300046491 Bacteria 1053
236 Ga0495585_0005695 3300046492 Bacteria 7819
237 Ga0495585_0040991 3300046492 Bacteria 2598
238 Ga0495596_0002823 3300046500 Bacteria 9077
239 Ga0495583_0001392 3300046506 Bacteria 24725
240 Ga0495583_0002688 3300046506 Bacteria 14780
241 Ga0495583_0005396 3300046506 Bacteria 8696
242 Ga0495583_0063584 3300046506 Bacteria 1639
243 Ga0495583_0090876 3300046506 Bacteria 1314
244 Ga0495606_0000178 3300046507 Bacteria 112329
245 Ga0495606_0027882 3300046507 Bacteria 3995
246 Ga0495606_0057837 3300046507 Bacteria 2495
247 Ga0495610_0000081 3300046512 Bacteria 113513
248 Ga0495631_0026871 3300046518 Bacteria 2638
249 Ga0495631_0030794 3300046518 Bacteria 2432
250 Ga0495631_0045021 3300046518 Bacteria 1943
251 Ga0495632_0000306 3300046519 Bacteria 47401
252 Ga0495643_0000042 3300046522 Bacteria 229665
253 Ga0495643_0002744 3300046522 Bacteria 13525
254 Ga0495643_0012066 3300046522 Bacteria 5226
255 Ga0495643_0156774 3300046522 Bacteria 1123
256 Ga0495648_0004587 3300046524 Bacteria 11770
257 Ga0495648_0010397 3300046524 Bacteria 7091
258 Ga0495663_0000758 3300046525 Bacteria 11077
259 Ga0495666_0040644 3300046526 Bacteria 2254
260 Ga0495654_0035724 3300046530 Bacteria 2500
261 Ga0495597_0019323 3300046542 Bacteria 3189
262 Ga0495597_0021634 3300046542 Bacteria 2989
263 Ga0495622_0002170 3300046557 Bacteria 9561
264 Ga0495633_0000308 3300046558 Bacteria 55659
265 Ga0495633_0009196 3300046558 Bacteria 5479
266 Ga0495668_0000013 3300046616 Bacteria 452938
267 Ga0495668_0026502 3300046616 Bacteria 3289
268 Ga0495611_0014367 3300046648 Bacteria 3381
269 Ga0495625_0000321 3300046660 Bacteria 72983
270 Ga0495625_0000397 3300046660 Bacteria 66539
271 Ga0495625_0037607 3300046660 Bacteria 3549
272 Ga0495625_0042735 3300046660 Bacteria 3290
273 Ga0495625_0043217 3300046660 Bacteria 3269
274 Ga0495625_0109855 3300046660 Bacteria 1886
275 Ga0495625_0251383 3300046660 Bacteria 1147
276 Ga0495669_0002087 3300046684 Bacteria 8185
277 Ga0495670_0000031 3300046691 Bacteria 85620
278 Ga0495670_0002185 3300046691 Bacteria 9674
279 Ga0495649_0031039 3300046694 Bacteria 2948
280 Ga0495649_0038474 3300046694 Bacteria 2624
281 Ga0495683_0004942 3300047323 Bacteria 7459
282 Ga0495683_0006805 3300047323 Bacteria 6213
283 Ga0495687_000250 3300047443 Bacteria 72797
284 Ga0495687_000614 3300047443 Bacteria 41339
285 Ga0495677_0001865 3300047445 Bacteria 8422
286 Ga0495681_0019635 3300047470 Bacteria 3683
287 Ga0495686_0000262 3300047472 Bacteria 94462
288 Ga0495626_0000139 3300048091 Bacteria 92719
289 Ga0496101_0124243 3300048904 Bacteria 1954
290 Ga0496102_0001391 3300048905 Bacteria 21494
291 Ga0496102_0003322 3300048905 Bacteria 13637
292 Ga0496103_0000055 3300048906 Bacteria 143870
293 Ga0496103_0014271 3300048906 Bacteria 4717
294 Ga0496104_0026298 3300048907 Bacteria 5371
295 Ga0496104_0044157 3300048907 Bacteria 4188
296 Ga0496105_0000358 3300048908 Bacteria 30167
297 Ga0496105_0002298 3300048908 Bacteria 13866
298 Ga0496110_0009627 3300048913 Bacteria 7823
299 Ga0496111_0021635 3300048914 Bacteria 4495
300 Ga0496111_0418930 3300048914 Bacteria 989
301 Ga0496114_0010092 3300048917 Bacteria 7512
302 Ga0496115_0000267 3300048918 Bacteria 46248
303 Ga0496116_0012457 3300048919 Bacteria 6950
304 Ga0496117_0000549 3300048920 Bacteria 61657
305 Ga0496117_0015106 3300048920 Bacteria 6610
306 Ga0496117_0017345 3300048920 Bacteria 6016
307 Ga0496118_0000552 3300048921 Bacteria 61677
308 Ga0496118_0000811 3300048921 Bacteria 49879
309 Ga0496118_0007317 3300048921 Bacteria 11742
310 Ga0496119_0073049 3300048922 Bacteria 2002
311 Ga0496120_0013820 3300048923 Bacteria 5411
312 Ga0496121_0001191 3300048924 Bacteria 45526
313 Ga0496121_0020427 3300048924 Bacteria 6557
314 Ga0496121_0031916 3300048924 Bacteria 4802
315 Ga0496122_0011792 3300048925 Bacteria 8795
316 Ga0496122_0089396 3300048925 Bacteria 2106
317 Ga0496123_0011531 3300048926 Bacteria 7650
318 Ga0496123_0021724 3300048926 Bacteria 4976
319 Ga0496124_0000585 3300048927 Bacteria 61469
320 Ga0496124_0001159 3300048927 Bacteria 41313
321 Ga0496124_0134357 3300048927 Bacteria 1961
322 Ga0496124_0145665 3300048927 Bacteria 1864
323 Ga0496125_0001142 3300048928 Bacteria 40357
324 Ga0496125_0195131 3300048928 Bacteria 1332
325 Ga0496126_0001094 3300048929 Bacteria 45520
326 Ga0496126_0081387 3300048929 Bacteria 2863
327 Ga0501290_000045 3300049513 Bacteria 16278
328 Ga0501292_000012 3300049515 Bacteria 69398
329 Ga0501294_000148 3300049517 Bacteria 8357
330 Ga0501300_000292 3300049523 Bacteria 7568
331 Ga0501031_0025598 3300049568 Bacteria 3848
332 Ga0501033_0062313 3300049570 Bacteria 2746
333 Ga0501036_0001027 3300049572 Bacteria 21086
334 Ga0501039_0003842 3300049575 Bacteria 11283
335 Ga0501040_0004258 3300049576 Bacteria 9313
336 Ga0501041_0002253 3300049577 Bacteria 10906
337 Ga0501042_0027550 3300049578 Bacteria 3996
338 Ga0501046_0025711 3300049580 Bacteria 4815
339 Ga0501047_0132378 3300049581 Bacteria 2374
340 Ga0501048_0004782 3300049582 Bacteria 10323
341 Ga0501069_0267690 3300049585 Bacteria 998
342 Ga0501071_0000212 3300049587 Bacteria 26493
343 Ga0501075_0003017 3300049591 Bacteria 11245
344 Ga0501076_0001235 3300049592 Bacteria 17016
345 Ga0501222_000269 3300049662 Bacteria 8580
346 Ga0501223_000887 3300049663 Bacteria 7099
347 Ga0501224_000191 3300049664 Bacteria 6988
348 Ga0501227_001581 3300049665 Bacteria 5074
349 Ga0501233_000369 3300049668 Bacteria 7091
350 Ga0501235_000778 3300049669 Bacteria 6500
351 Ga0501249_001325 3300049679 Bacteria 5149
352 Ga0501261_000031 3300049690 Bacteria 31241
353 Ga0501225_0005698 3300049705 Bacteria 3650
354 Ga0501079_0028425 3300049741 Bacteria 4290
355 Ga0501081_0003798 3300049743 Bacteria 9677
356 Ga0501264_006020 3300049761 Bacteria 1113
357 Ga0501279_000004 3300049775 Bacteria 175612
358 Ga0501280_000052 3300049776 Bacteria 33642
359 Ga0501282_000194 3300049778 Bacteria 7492
360 Ga0501283_000169 3300049779 Bacteria 8442
361 Ga0501035_0236819 3300049822 Bacteria 1554
362 Ga0501045_0000105 3300049824 Bacteria 41717
363 Ga0501045_0298554 3300049824 Bacteria 1199
364 nmdc:mga03683_276_c1 3300050489 Bacteria 15419
365 nmdc:mga03n38_33733_c1 3300050490 Bacteria 2181
366 nmdc:mga00v17_63676_c1 3300050491 Bacteria 2272
367 nmdc:mga0yw44_65764_c1 3300050492 Bacteria 2236
368 nmdc:mga0k408_184690_c1 3300050493 Bacteria 1244
369 nmdc:mga0k408_46493_c1 3300050493 Bacteria 2506
370 nmdc:mga06z11_134_c1 3300050494 Bacteria 29598
371 nmdc:mga04h51_2518_c1 3300050495 Bacteria 4362
372 nmdc:mga07m45_12_c1 3300050496 Bacteria 158130
373 nmdc:mga0sz30_3536_c1 3300050516 Bacteria 5636
374 Ga0495612_0112983 3300053078 Bacteria 1164
375 Ga0500610_0000092 3300053079 Bacteria 27411
376 Ga0500643_001742 3300053087 Bacteria 12055
377 Ga0500643_002965 3300053087 Bacteria 8405
378 Ga0500643_004433 3300053087 Bacteria 6350
379 Ga0500651_0009774 3300053093 Bacteria 5721
380 Ga0500651_0151952 3300053093 Bacteria 1390
381 Ga0500641_0062298 3300053096 Bacteria 1556
382 Ga0500562_011837 3300053108 Bacteria 2217
383 Ga0500594_0009825 3300053118 Bacteria 2210
384 Ga0500607_001489 3300053121 Bacteria 21049
385 Ga0500642_0002784 3300053130 Bacteria 5187
386 Ga0500655_000107 3300053133 Bacteria 21512
387 Ga0500658_0005575 3300053134 Bacteria 4685
388 Ga0500658_0012656 3300053134 Bacteria 3114
389 Ga0500559_0023648 3300053136 Bacteria 2609
390 Ga0500559_0032910 3300053136 Bacteria 2230
391 Ga0500590_018788 3300053148 Bacteria 3579
392 Ga0500604_0012625 3300053151 Bacteria 2283
393 Ga0500639_030725 3300053163 Bacteria 2840
394 Ga0500636_0005106 3300053177 Bacteria 7457
395 Ga0500636_0095497 3300053177 Bacteria 1697
396 Ga0500645_000024 3300053730 Bacteria 126024
397 Ga0500596_000659 3300053735 Bacteria 6672
398 Ga0501084_0000349 3300054114 Bacteria 35168
399 Ga0501082_0001724 3300060353 Bacteria 19288
400 Ga0466962_0008993 3300061719 Bacteria 4784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100028687 Ga0307409_1000286873 279
2 3300032126 Ga0307415_100014984 Ga0307415_1000149844 279
3 3300049568 Ga0501031_0025598 Ga0501031_0025598_2531_3373 279
4 3300049570 Ga0501033_0062313 Ga0501033_0062313_1587_2429 279
5 3300049572 Ga0501036_0001027 Ga0501036_0001027_3188_4030 279
6 3300049575 Ga0501039_0003842 Ga0501039_0003842_9535_10377 279
7 3300049576 Ga0501040_0004258 Ga0501040_0004258_125_967 279
8 3300049577 Ga0501041_0002253 Ga0501041_0002253_5919_6761 279
9 3300049578 Ga0501042_0027550 Ga0501042_0027550_604_1446 279
10 3300049580 Ga0501046_0025711 Ga0501046_0025711_396_1238 279
11 3300049582 Ga0501048_0004782 Ga0501048_0004782_4116_4958 279
12 3300049585 Ga0501069_0267690 Ga0501069_0267690_57_899 279
13 3300049587 Ga0501071_0000212 Ga0501071_0000212_25473_26315 279
14 3300049591 Ga0501075_0003017 Ga0501075_0003017_7999_8841 279
15 3300049592 Ga0501076_0001235 Ga0501076_0001235_15865_16707 279
16 3300049741 Ga0501079_0028425 Ga0501079_0028425_302_1144 279
17 3300049743 Ga0501081_0003798 Ga0501081_0003798_6450_7292 279
18 3300049824 Ga0501045_0000105 Ga0501045_0000105_5928_6770 279
19 3300054114 Ga0501084_0000349 Ga0501084_0000349_8387_9229 279
20 3300060353 Ga0501082_0001724 Ga0501082_0001724_7932_8774 279
21 3300039437 Ga0436365_0929932 Ga0436365_0929932_210_1058 280
22 3300039437 Ga0436365_1701385 Ga0436365_1701385_25_873 280
23 3300049824 Ga0501045_0298554 Ga0501045_0298554_236_1084 281
24 3300021388 Ga0213875_10017527 Ga0213875_100175274 282
25 3300037853 Ga0436364_0342998 Ga0436364_0342998_2214_3062 282
26 3300039437 Ga0436365_1468289 Ga0436365_1468289_1250_2098 282
27 3300037853 Ga0436364_1222979 Ga0436364_1222979_1061_1918 283
28 3300039437 Ga0436365_0496544 Ga0436365_0496544_28141_28998 283
29 3300039450 Ga0436363_0993985 Ga0436363_0993985_1715_2590 283
30 3300044693 Ga0466961_0107513 Ga0466961_0107513_806_1663 283
31 3300044694 Ga0466963_0002237 Ga0466963_0002237_6062_6919 283
32 3300044719 Ga0466971_0159953 Ga0466971_0159953_38_895 283
33 3300044735 Ga0466968_0041314 Ga0466968_0041314_810_1667 283
34 3300044842 Ga0466957_0000426 Ga0466957_0000426_934_1791 283
35 3300045049 Ga0466959_0010720 Ga0466959_0010720_2357_3214 283
36 3300045836 Ga0466958_0000869 Ga0466958_0000869_9624_10481 283
37 3300045836 Ga0466958_0006675 Ga0466958_0006675_3530_4381 283
38 3300045976 Ga0466967_0017915 Ga0466967_0017915_983_1840 283
39 3300061719 Ga0466962_0008993 Ga0466962_0008993_1506_2363 283
40 iso_pu_bacteria 8057101203 8057101584 283
41 3300053087 Ga0500643_004433 Ga0500643_004433_2465_3355 284
42 iso_pu_bacteria 2990265787 2990265953 284
43 iso_pu_bacteria 2993693658 2993696256 284
44 3300005367 Ga0070667_100027401 Ga0070667_1000274014 285
45 3300005548 Ga0070665_100000563 Ga0070665_1000005636 285
46 3300014325 Ga0163163_10030854 Ga0163163_100308544 285
47 3300025903 Ga0207680_10007605 Ga0207680_100076054 285
48 3300026088 Ga0207641_10476079 Ga0207641_104760792 285
49 3300028379 Ga0268266_10000336 Ga0268266_100003366 285
50 3300042122 Ga0450920_020723 Ga0450920_020723_188_1081 285
51 3300048905 Ga0496102_0003322 Ga0496102_0003322_7808_8710 285
52 3300048906 Ga0496103_0014271 Ga0496103_0014271_2900_3802 285
53 3300048907 Ga0496104_0044157 Ga0496104_0044157_31_933 285
54 3300048908 Ga0496105_0002298 Ga0496105_0002298_4919_5821 285
55 3300048914 Ga0496111_0418930 Ga0496111_0418930_19_879 285
56 3300048920 Ga0496117_0015106 Ga0496117_0015106_2679_3581 285
57 3300048921 Ga0496118_0007317 Ga0496118_0007317_5585_6487 285
58 3300048922 Ga0496119_0073049 Ga0496119_0073049_830_1732 285
59 3300048924 Ga0496121_0020427 Ga0496121_0020427_4924_5826 285
60 3300048928 Ga0496125_0195131 Ga0496125_0195131_302_1204 285
61 3300048929 Ga0496126_0081387 Ga0496126_0081387_1472_2374 285
62 3300005535 Ga0070684_100712740 Ga0070684_1007127401 286
63 iso_pu_bacteria 2899275550 2899276155 286
64 iso_pu_bacteria 8057132660 8057135327 286
65 3300042435 Ga0439434_0052253 Ga0439434_0052253_395_1258 287
66 iso_pu_bacteria 2643221622 2644125328 287
67 iso_pu_bacteria 2713897090 2715501051 287
68 iso_pu_bacteria 2879163058 2879165342 287
69 iso_pu_bacteria 2885429604 2885432553 287
70 iso_pu_bacteria 2984564862 2984565219 288
71 3300002067 JGI24735J21928_10006140 JGI24735J21928_100061402 290
72 3300005327 Ga0070658_10085273 Ga0070658_100852733 290
73 3300005329 Ga0070683_100211431 Ga0070683_1002114312 290
74 3300005339 Ga0070660_100064071 Ga0070660_1000640714 290
75 3300005339 Ga0070660_100453096 Ga0070660_1004530962 290
76 3300005366 Ga0070659_100110128 Ga0070659_1001101283 290
77 3300005455 Ga0070663_100093271 Ga0070663_1000932713 290
78 3300005457 Ga0070662_100078053 Ga0070662_1000780532 290
79 3300005530 Ga0070679_100019156 Ga0070679_1000191564 290
80 3300005563 Ga0068855_100377383 Ga0068855_1003773833 290
81 3300005564 Ga0070664_100088706 Ga0070664_1000887063 290
82 3300005614 Ga0068856_100323893 Ga0068856_1003238933 290
83 3300013104 Ga0157370_10167170 Ga0157370_101671702 290
84 3300013105 Ga0157369_10153643 Ga0157369_101536432 290
85 3300025909 Ga0207705_10004771 Ga0207705_1000477114 290
86 3300025909 Ga0207705_10131333 Ga0207705_101313333 290
87 3300025909 Ga0207705_10180650 Ga0207705_101806501 290
88 3300025919 Ga0207657_10098456 Ga0207657_100984563 290
89 3300025944 Ga0207661_10224509 Ga0207661_102245092 290
90 3300026067 Ga0207678_10129505 Ga0207678_101295053 290
91 3300026116 Ga0207674_10006741 Ga0207674_100067419 290
92 3300031548 Ga0307408_100040343 Ga0307408_1000403434 290
93 3300031824 Ga0307413_10042524 Ga0307413_100425243 290
94 3300031852 Ga0307410_10190679 Ga0307410_101906792 290
95 3300031901 Ga0307406_10043181 Ga0307406_100431813 290
96 3300031911 Ga0307412_10063834 Ga0307412_100638343 290
97 3300031911 Ga0307412_10195291 Ga0307412_101952912 290
98 3300032004 Ga0307414_10024487 Ga0307414_100244872 290
99 3300032004 Ga0307414_10108608 Ga0307414_101086084 290
100 3300032005 Ga0307411_10127685 Ga0307411_101276852 290
101 3300032126 Ga0307415_100094767 Ga0307415_1000947672 290
102 3300032126 Ga0307415_100179481 Ga0307415_1001794811 290
103 3300001915 JGI24741J21665_1000938 JGI24741J21665_100093811 291
104 3300001979 JGI24740J21852_10011005 JGI24740J21852_100110054 291
105 3300001989 JGI24739J22299_10003277 JGI24739J22299_100032777 291
106 3300001989 JGI24739J22299_10010024 JGI24739J22299_100100244 291
107 3300001990 JGI24737J22298_10023941 JGI24737J22298_100239412 291
108 3300001990 JGI24737J22298_10023978 JGI24737J22298_100239782 291
109 3300003214 JGI25165J46597_1000071 JGI25165J46597_1000071179 291
110 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007313 291
111 3300003215 JGI25153J46596_10020426 JGI25153J46596_100204264 291
112 3300003773 Ga0055537_1001678 Ga0055537_100167810 291
113 3300003775 Ga0055524_1000449 Ga0055524_10004498 291
114 3300003791 Ga0055530_10000114 Ga0055530_1000011416 291
115 3300003794 Ga0055531_10000095 Ga0055531_1000009558 291
116 3300003794 Ga0055531_10002305 Ga0055531_100023055 291
117 3300005262 Ga0065165_1003183 Ga0065165_10031834 291
118 3300005262 Ga0065165_1003788 Ga0065165_10037887 291
119 3300005327 Ga0070658_10004008 Ga0070658_100040081 291
120 3300005327 Ga0070658_10034682 Ga0070658_100346824 291
121 3300005339 Ga0070660_100005512 Ga0070660_1000055129 291
122 3300005339 Ga0070660_100016614 Ga0070660_1000166143 291
123 3300005344 Ga0070661_100006527 Ga0070661_10000652711 291
124 3300005356 Ga0070674_100000209 Ga0070674_10000020915 291
125 3300005356 Ga0070674_100036448 Ga0070674_1000364484 291
126 3300005364 Ga0070673_100303139 Ga0070673_1003031392 291
127 3300005367 Ga0070667_100226822 Ga0070667_1002268221 291
128 3300005456 Ga0070678_100001063 Ga0070678_1000010634 291
129 3300005457 Ga0070662_100026436 Ga0070662_1000264363 291
130 3300005530 Ga0070679_100080732 Ga0070679_1000807324 291
131 3300005539 Ga0068853_100166127 Ga0068853_1001661273 291
132 3300005548 Ga0070665_100000084 Ga0070665_10000008478 291
133 3300005564 Ga0070664_100016865 Ga0070664_1000168657 291
134 3300005578 Ga0068854_100005843 Ga0068854_1000058435 291
135 3300005616 Ga0068852_100045745 Ga0068852_1000457453 291
136 3300005617 Ga0068859_100004238 Ga0068859_10000423810 291
137 3300005719 Ga0068861_100000369 Ga0068861_10000036916 291
138 3300005842 Ga0068858_100000673 Ga0068858_10000067327 291
139 3300005842 Ga0068858_100000848 Ga0068858_10000084814 291
140 3300006237 Ga0097621_100081758 Ga0097621_1000817583 291
141 3300006931 Ga0097620_100004238 Ga0097620_10000423810 291
142 3300009148 Ga0105243_10005193 Ga0105243_100051936 291
143 3300009174 Ga0105241_10022861 Ga0105241_100228617 291
144 3300009177 Ga0105248_10003802 Ga0105248_1000380212 291
145 3300009177 Ga0105248_10179174 Ga0105248_101791741 291
146 3300013102 Ga0157371_10000011 Ga0157371_1000001180 291
147 3300013297 Ga0157378_10022711 Ga0157378_100227113 291
148 3300013306 Ga0163162_10015197 Ga0163162_100151976 291
149 3300014968 Ga0157379_10016508 Ga0157379_100165083 291
150 3300017792 Ga0163161_10044190 Ga0163161_100441902 291
151 3300025245 Ga0207425_1008802 Ga0207425_10088024 291
152 3300025253 Ga0209677_106269 Ga0209677_1062694 291
153 3300025261 Ga0209233_1000140 Ga0209233_10001408 291
154 3300025263 Ga0209565_1000011 Ga0209565_1000011180 291
155 3300025273 Ga0209673_1001510 Ga0209673_100151016 291
156 3300025291 Ga0209675_1006612 Ga0209675_10066122 291
157 3300025297 Ga0209758_1000017 Ga0209758_1000017309 291
158 3300025297 Ga0209758_1010311 Ga0209758_10103113 291
159 3300025298 Ga0209050_1000051 Ga0209050_100005159 291
160 3300025298 Ga0209050_1009509 Ga0209050_10095094 291
161 3300025299 Ga0209256_1000016 Ga0209256_1000016419 291
162 3300025304 Ga0209257_1000028 Ga0209257_1000028309 291
163 3300025304 Ga0209257_1001470 Ga0209257_100147016 291
164 3300025315 Ga0207697_10007117 Ga0207697_100071172 291
165 3300025904 Ga0207647_10019227 Ga0207647_100192273 291
166 3300025909 Ga0207705_10003597 Ga0207705_100035979 291
167 3300025909 Ga0207705_10007727 Ga0207705_100077274 291
168 3300025911 Ga0207654_10000246 Ga0207654_1000024617 291
169 3300025913 Ga0207695_10091108 Ga0207695_100911084 291
170 3300025914 Ga0207671_10066063 Ga0207671_100660634 291
171 3300025919 Ga0207657_10002813 Ga0207657_1000281312 291
172 3300025919 Ga0207657_10008183 Ga0207657_1000818313 291
173 3300025920 Ga0207649_10002323 Ga0207649_100023236 291
174 3300025921 Ga0207652_10027113 Ga0207652_100271133 291
175 3300025927 Ga0207687_10000892 Ga0207687_100008927 291
176 3300025931 Ga0207644_10236912 Ga0207644_102369122 291
177 3300025932 Ga0207690_10000630 Ga0207690_1000063013 291
178 3300025932 Ga0207690_10049022 Ga0207690_100490223 291
179 3300025933 Ga0207706_10021968 Ga0207706_100219683 291
180 3300025935 Ga0207709_10000116 Ga0207709_1000011638 291
181 3300025935 Ga0207709_10018879 Ga0207709_100188794 291
182 3300025937 Ga0207669_10000022 Ga0207669_1000002220 291
183 3300025937 Ga0207669_10017084 Ga0207669_100170843 291
184 3300025941 Ga0207711_10121206 Ga0207711_101212063 291
185 3300025945 Ga0207679_10201768 Ga0207679_102017682 291
186 3300025949 Ga0207667_10000001 Ga0207667_10000001557 291
187 3300025949 Ga0207667_10017604 Ga0207667_100176043 291
188 3300025960 Ga0207651_10333292 Ga0207651_103332922 291
189 3300025972 Ga0207668_10025165 Ga0207668_100251652 291
190 3300025981 Ga0207640_10003242 Ga0207640_100032427 291
191 3300025981 Ga0207640_10004847 Ga0207640_100048473 291
192 3300025986 Ga0207658_10037395 Ga0207658_100373953 291
193 3300026035 Ga0207703_10000167 Ga0207703_1000016743 291
194 3300026035 Ga0207703_10000302 Ga0207703_1000030245 291
195 3300026041 Ga0207639_10044491 Ga0207639_100444914 291
196 3300026067 Ga0207678_10002526 Ga0207678_1000252613 291
197 3300026067 Ga0207678_10006831 Ga0207678_100068314 291
198 3300026078 Ga0207702_10093196 Ga0207702_100931964 291
199 3300026116 Ga0207674_10038792 Ga0207674_100387923 291
200 3300026118 Ga0207675_100002178 Ga0207675_1000021783 291
201 3300026121 Ga0207683_10058649 Ga0207683_100586493 291
202 3300026142 Ga0207698_10006957 Ga0207698_100069578 291
203 3300028379 Ga0268266_10000002 Ga0268266_10000002804 291
204 3300028786 Ga0307517_10136467 Ga0307517_101364672 291
205 3300031456 Ga0307513_10126196 Ga0307513_101261963 291
206 3300031456 Ga0307513_10352859 Ga0307513_103528591 291
207 3300031456 Ga0307513_10364443 Ga0307513_103644432 291
208 3300031507 Ga0307509_10099955 Ga0307509_100999555 291
209 3300031616 Ga0307508_10013978 Ga0307508_100139787 291
210 3300033180 Ga0307510_10056146 Ga0307510_100561464 291
211 3300041404 Ga0439436_0024666 Ga0439436_0024666_192_1067 291
212 3300041407 Ga0439447_042156 Ga0439447_042156_139_1014 291
213 3300041413 Ga0439465_0007579 Ga0439465_0007579_1927_2802 291
214 3300042014 Ga0439457_008236 Ga0439457_008236_1135_2010 291
215 3300042156 Ga0439446_0046062 Ga0439446_0046062_313_1188 291
216 3300042876 Ga0451577_0100234 Ga0451577_0100234_1677_2573 291
217 3300046453 Ga0495627_034034 Ga0495627_034034_312_1187 291
218 3300046460 Ga0495638_0001960 Ga0495638_0001960_10909_11784 291
219 3300046460 Ga0495638_0070982 Ga0495638_0070982_97_972 291
220 3300046471 Ga0495650_0000967 Ga0495650_0000967_18990_19865 291
221 3300046471 Ga0495650_0048776 Ga0495650_0048776_611_1486 291
222 3300046491 Ga0495584_0106252 Ga0495584_0106252_121_996 291
223 3300046491 Ga0495584_0186688 Ga0495584_0186688_131_1006 291
224 3300046492 Ga0495585_0005695 Ga0495585_0005695_4861_5736 291
225 3300046492 Ga0495585_0040991 Ga0495585_0040991_1344_2219 291
226 3300046506 Ga0495583_0001392 Ga0495583_0001392_12638_13513 291
227 3300046506 Ga0495583_0002688 Ga0495583_0002688_7396_8271 291
228 3300046506 Ga0495583_0005396 Ga0495583_0005396_4165_5040 291
229 3300046506 Ga0495583_0063584 Ga0495583_0063584_585_1460 291
230 3300046506 Ga0495583_0090876 Ga0495583_0090876_106_981 291
231 3300046507 Ga0495606_0000178 Ga0495606_0000178_82473_83348 291
232 3300046507 Ga0495606_0057837 Ga0495606_0057837_1524_2399 291
233 3300046518 Ga0495631_0026871 Ga0495631_0026871_406_1281 291
234 3300046518 Ga0495631_0030794 Ga0495631_0030794_330_1205 291
235 3300046518 Ga0495631_0045021 Ga0495631_0045021_613_1488 291
236 3300046522 Ga0495643_0002744 Ga0495643_0002744_12550_13425 291
237 3300046522 Ga0495643_0012066 Ga0495643_0012066_3204_4079 291
238 3300046522 Ga0495643_0156774 Ga0495643_0156774_60_935 291
239 3300046524 Ga0495648_0004587 Ga0495648_0004587_7869_8744 291
240 3300046524 Ga0495648_0010397 Ga0495648_0010397_5099_5974 291
241 3300046525 Ga0495663_0000758 Ga0495663_0000758_1877_2752 291
242 3300046526 Ga0495666_0040644 Ga0495666_0040644_541_1416 291
243 3300046542 Ga0495597_0019323 Ga0495597_0019323_2030_2905 291
244 3300046557 Ga0495622_0002170 Ga0495622_0002170_2005_2880 291
245 3300046558 Ga0495633_0000308 Ga0495633_0000308_36157_37032 291
246 3300046558 Ga0495633_0009196 Ga0495633_0009196_1528_2403 291
247 3300046616 Ga0495668_0000013 Ga0495668_0000013_259205_260080 291
248 3300046616 Ga0495668_0026502 Ga0495668_0026502_828_1703 291
249 3300046648 Ga0495611_0014367 Ga0495611_0014367_14_889 291
250 3300046660 Ga0495625_0000321 Ga0495625_0000321_761_1636 291
251 3300046660 Ga0495625_0000397 Ga0495625_0000397_26286_27161 291
252 3300046660 Ga0495625_0037607 Ga0495625_0037607_574_1449 291
253 3300046660 Ga0495625_0042735 Ga0495625_0042735_562_1437 291
254 3300046660 Ga0495625_0043217 Ga0495625_0043217_1323_2198 291
255 3300046660 Ga0495625_0109855 Ga0495625_0109855_351_1226 291
256 3300046660 Ga0495625_0251383 Ga0495625_0251383_56_931 291
257 3300046684 Ga0495669_0002087 Ga0495669_0002087_1976_2851 291
258 3300046691 Ga0495670_0002185 Ga0495670_0002185_7303_8178 291
259 3300046694 Ga0495649_0031039 Ga0495649_0031039_1474_2349 291
260 3300046694 Ga0495649_0038474 Ga0495649_0038474_430_1305 291
261 3300047323 Ga0495683_0004942 Ga0495683_0004942_5744_6619 291
262 3300047323 Ga0495683_0006805 Ga0495683_0006805_1979_2854 291
263 3300047443 Ga0495687_000250 Ga0495687_000250_45634_46509 291
264 3300047443 Ga0495687_000614 Ga0495687_000614_15570_16445 291
265 3300047445 Ga0495677_0001865 Ga0495677_0001865_7346_8221 291
266 3300047470 Ga0495681_0019635 Ga0495681_0019635_967_1842 291
267 3300047472 Ga0495686_0000262 Ga0495686_0000262_17261_18136 291
268 3300048904 Ga0496101_0124243 Ga0496101_0124243_592_1467 291
269 3300048905 Ga0496102_0001391 Ga0496102_0001391_4421_5296 291
270 3300048906 Ga0496103_0000055 Ga0496103_0000055_111257_112132 291
271 3300048907 Ga0496104_0026298 Ga0496104_0026298_176_1051 291
272 3300048908 Ga0496105_0000358 Ga0496105_0000358_13706_14581 291
273 3300048913 Ga0496110_0009627 Ga0496110_0009627_4428_5303 291
274 3300048914 Ga0496111_0021635 Ga0496111_0021635_2617_3492 291
275 3300048917 Ga0496114_0010092 Ga0496114_0010092_4390_5265 291
276 3300048918 Ga0496115_0000267 Ga0496115_0000267_29067_29942 291
277 3300048919 Ga0496116_0012457 Ga0496116_0012457_5238_6113 291
278 3300048920 Ga0496117_0000549 Ga0496117_0000549_31911_32786 291
279 3300048921 Ga0496118_0000552 Ga0496118_0000552_31793_32668 291
280 3300048923 Ga0496120_0013820 Ga0496120_0013820_2686_3561 291
281 3300048924 Ga0496121_0001191 Ga0496121_0001191_15587_16462 291
282 3300048924 Ga0496121_0031916 Ga0496121_0031916_813_1688 291
283 3300048925 Ga0496122_0011792 Ga0496122_0011792_3506_4381 291
284 3300048925 Ga0496122_0089396 Ga0496122_0089396_628_1503 291
285 3300048926 Ga0496123_0011531 Ga0496123_0011531_4448_5323 291
286 3300048926 Ga0496123_0021724 Ga0496123_0021724_1648_2523 291
287 3300048927 Ga0496124_0000585 Ga0496124_0000585_31664_32539 291
288 3300048927 Ga0496124_0001159 Ga0496124_0001159_7981_8856 291
289 3300048928 Ga0496125_0001142 Ga0496125_0001142_23370_24245 291
290 3300048929 Ga0496126_0001094 Ga0496126_0001094_15595_16470 291
291 3300049581 Ga0501047_0132378 Ga0501047_0132378_124_999 291
292 3300049822 Ga0501035_0236819 Ga0501035_0236819_261_1136 291
293 3300050493 nmdc:mga0k408_46493_c1 nmdc:mga0k408_46493_c1_34_909 291
294 3300053079 Ga0500610_0000092 Ga0500610_0000092_13978_14853 291
295 3300053093 Ga0500651_0151952 Ga0500651_0151952_370_1245 291
296 3300053108 Ga0500562_011837 Ga0500562_011837_1268_2143 291
297 3300053134 Ga0500658_0005575 Ga0500658_0005575_3130_4005 291
298 3300053134 Ga0500658_0012656 Ga0500658_0012656_839_1714 291
299 3300053136 Ga0500559_0023648 Ga0500559_0023648_1345_2220 291
300 3300053136 Ga0500559_0032910 Ga0500559_0032910_798_1673 291
301 3300053151 Ga0500604_0012625 Ga0500604_0012625_419_1294 291
302 3300053177 Ga0500636_0005106 Ga0500636_0005106_4261_5136 291
303 3300053730 Ga0500645_000024 Ga0500645_000024_27622_28497 291
304 3300053735 Ga0500596_000659 Ga0500596_000659_4510_5385 291
305 3300003187 JGI25151J46595_10021425 JGI25151J46595_100214254 292
306 3300003215 JGI25153J46596_10000032 JGI25153J46596_1000003250 292
307 3300003794 Ga0055531_10025151 Ga0055531_100251513 292
308 3300006881 Ga0068865_100105960 Ga0068865_1001059604 292
309 3300025245 Ga0207425_1000025 Ga0207425_1000025134 292
310 3300025258 Ga0209129_1004271 Ga0209129_10042714 292
311 3300025292 Ga0209676_1026320 Ga0209676_10263202 292
312 3300025294 Ga0209025_1000176 Ga0209025_1000176109 292
313 3300025297 Ga0209758_1000002 Ga0209758_1000002218 292
314 3300025298 Ga0209050_1017959 Ga0209050_10179594 292
315 3300025304 Ga0209257_1003635 Ga0209257_10036354 292
316 3300025923 Ga0207681_10221870 Ga0207681_102218703 292
317 3300025935 Ga0207709_10075718 Ga0207709_100757184 292
318 3300025938 Ga0207704_10051288 Ga0207704_100512884 292
319 3300046691 Ga0495670_0000031 Ga0495670_0000031_10033_10920 292
320 3300048927 Ga0496124_0134357 Ga0496124_0134357_715_1611 292
321 3300053078 Ga0495612_0112983 Ga0495612_0112983_126_1004 292
322 3300053087 Ga0500643_001742 Ga0500643_001742_8886_9797 292
323 iso_pu_bacteria 2928027323 2928029411 292
324 iso_pu_bacteria 2984555340 2984556608 292
325 iso_pu_bacteria 2993356040 2993356295 292
326 3300003759 Ga0055525_1000127 Ga0055525_100012773 294
327 3300003762 Ga0055542_1000038 Ga0055542_100003839 294
328 3300003763 Ga0055529_1000002 Ga0055529_1000002315 294
329 3300003763 Ga0055529_1000021 Ga0055529_1000021165 294
330 3300025230 Ga0209563_100125 Ga0209563_10012542 294
331 3300025254 Ga0209148_1000008 Ga0209148_10000081032 294
332 3300025272 Ga0209455_1000002 Ga0209455_1000002393 294
333 iso_pu_bacteria 2818991438 2819551414 294
334 3300009545 Ga0105237_10235292 Ga0105237_102352922 295
335 3300031548 Ga0307408_100278266 Ga0307408_1002782662 295
336 3300031901 Ga0307406_10009088 Ga0307406_100090885 295
337 3300031911 Ga0307412_10071792 Ga0307412_100717924 295
338 3300032002 Ga0307416_100007660 Ga0307416_10000766010 295
339 3300044694 Ga0466963_0005313 Ga0466963_0005313_3416_4303 295
340 3300044842 Ga0466957_0004800 Ga0466957_0004800_1220_2107 295
341 3300045976 Ga0466967_0002800 Ga0466967_0002800_2557_3444 295
342 3300005548 Ga0070665_100034424 Ga0070665_1000344243 296
343 3300025914 Ga0207671_10235206 Ga0207671_102352061 296
344 3300028379 Ga0268266_10025965 Ga0268266_100259654 296
345 3300046512 Ga0495610_0000081 Ga0495610_0000081_91767_92657 296
346 3300046519 Ga0495632_0000306 Ga0495632_0000306_23151_24041 296
347 3300046522 Ga0495643_0000042 Ga0495643_0000042_18289_19179 296
348 3300046530 Ga0495654_0035724 Ga0495654_0035724_924_1814 296
349 3300049513 Ga0501290_000045 Ga0501290_000045_14445_15335 296
350 3300049515 Ga0501292_000012 Ga0501292_000012_42015_42905 296
351 3300049517 Ga0501294_000148 Ga0501294_000148_5318_6208 296
352 3300049523 Ga0501300_000292 Ga0501300_000292_5077_5967 296
353 3300049662 Ga0501222_000269 Ga0501222_000269_4987_5877 296
354 3300049663 Ga0501223_000887 Ga0501223_000887_5549_6439 296
355 3300049664 Ga0501224_000191 Ga0501224_000191_385_1275 296
356 3300049665 Ga0501227_001581 Ga0501227_001581_385_1275 296
357 3300049668 Ga0501233_000369 Ga0501233_000369_6157_7047 296
358 3300049669 Ga0501235_000778 Ga0501235_000778_661_1551 296
359 3300049690 Ga0501261_000031 Ga0501261_000031_20926_21816 296
360 3300049705 Ga0501225_0005698 Ga0501225_0005698_405_1295 296
361 3300049761 Ga0501264_006020 Ga0501264_006020_127_1017 296
362 3300049775 Ga0501279_000004 Ga0501279_000004_16017_16907 296
363 3300049776 Ga0501280_000052 Ga0501280_000052_23154_24044 296
364 3300049778 Ga0501282_000194 Ga0501282_000194_6298_7188 296
365 3300049779 Ga0501283_000169 Ga0501283_000169_868_1758 296
366 3300053087 Ga0500643_002965 Ga0500643_002965_1049_1939 296
367 3300053118 Ga0500594_0009825 Ga0500594_0009825_796_1686 296
368 3300006195 Ga0075366_10001558 Ga0075366_1000155814 297
369 3300006195 Ga0075366_10075705 Ga0075366_100757051 297
370 3300012513 Ga0157326_1000005 Ga0157326_10000057 297
371 3300025941 Ga0207711_10244639 Ga0207711_102446392 297
372 3300046542 Ga0495597_0021634 Ga0495597_0021634_1725_2618 297
373 3300049679 Ga0501249_001325 Ga0501249_001325_185_1078 297
374 3300053093 Ga0500651_0009774 Ga0500651_0009774_2018_2911 297
375 3300053096 Ga0500641_0062298 Ga0500641_0062298_459_1352 297
376 3300053130 Ga0500642_0002784 Ga0500642_0002784_510_1403 297
377 3300053133 Ga0500655_000107 Ga0500655_000107_14296_15189 297
378 3300053148 Ga0500590_018788 Ga0500590_018788_141_1034 297
379 3300053163 Ga0500639_030725 Ga0500639_030725_1447_2340 297
380 3300053177 Ga0500636_0095497 Ga0500636_0095497_319_1212 297
381 2162886007 SwRhRL2b_contig_1673102 SwRhRL2b_0191.00004640 298
382 3300005289 Ga0065704_10070193 Ga0065704_1007019321 298
383 3300005347 Ga0070668_100016101 Ga0070668_1000161014 298
384 3300005844 Ga0068862_100004531 Ga0068862_1000045318 298
385 3300006038 Ga0075365_10043208 Ga0075365_100432083 298
386 3300006042 Ga0075368_10000304 Ga0075368_100003044 298
387 3300006048 Ga0075363_100044118 Ga0075363_1000441183 298
388 3300006051 Ga0075364_10175702 Ga0075364_101757023 298
389 3300006177 Ga0075362_10001064 Ga0075362_100010644 298
390 3300006178 Ga0075367_10022925 Ga0075367_100229253 298
391 3300006186 Ga0075369_10005423 Ga0075369_100054233 298
392 3300006195 Ga0075366_10083762 Ga0075366_100837623 298
393 3300006353 Ga0075370_10188619 Ga0075370_101886192 298
394 3300025972 Ga0207668_10097755 Ga0207668_100977552 298
395 3300027312 Ga0209371_1011317 Ga0209371_10113172 298
396 3300027866 Ga0209813_10000279 Ga0209813_1000027919 298
397 3300028379 Ga0268266_10248081 Ga0268266_102480812 298
398 3300030500 Ga0268256_1013168 Ga0268256_10131682 298
399 3300046500 Ga0495596_0002823 Ga0495596_0002823_3722_4633 298
400 3300046507 Ga0495606_0027882 Ga0495606_0027882_380_1291 298
401 3300048091 Ga0495626_0000139 Ga0495626_0000139_50687_51598 298
402 3300048920 Ga0496117_0017345 Ga0496117_0017345_830_1726 298
403 3300048921 Ga0496118_0000811 Ga0496118_0000811_45806_46702 298
404 3300048927 Ga0496124_0145665 Ga0496124_0145665_746_1642 298
405 3300050489 nmdc:mga03683_276_c1 nmdc:mga03683_276_c1_4547_5455 298
406 3300050490 nmdc:mga03n38_33733_c1 nmdc:mga03n38_33733_c1_520_1428 298
407 3300050491 nmdc:mga00v17_63676_c1 nmdc:mga00v17_63676_c1_1344_2252 298
408 3300050492 nmdc:mga0yw44_65764_c1 nmdc:mga0yw44_65764_c1_1030_1938 298
409 3300050493 nmdc:mga0k408_184690_c1 nmdc:mga0k408_184690_c1_221_1129 298
410 3300050494 nmdc:mga06z11_134_c1 nmdc:mga06z11_134_c1_16832_17740 298
411 3300050495 nmdc:mga04h51_2518_c1 nmdc:mga04h51_2518_c1_2572_3480 298
412 3300050496 nmdc:mga07m45_12_c1 nmdc:mga07m45_12_c1_9546_10454 298
413 3300050516 nmdc:mga0sz30_3536_c1 nmdc:mga0sz30_3536_c1_21_929 298
414 3300053121 Ga0500607_001489 Ga0500607_001489_11397_12293 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

6

121

0.98

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

124

282

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9765 2 285
6s4f-assembly1.cif.gz_B structure of human mthfd2 in complex with th9619 0.9752 4 287
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.975 4 285
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9741 4 288
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9709 4 287
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 1.002 36 115 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9967 33 116 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9888 14 125 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9838 36 116 3.40.50.10860
af_A0A1D6EP44_100_195_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9829 10 103 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A3B8YXV1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9988 51 180 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2S8LSJ0-F1-model_v4 deleted 0.9966 41 123
AF-A0A3B9UJA7-F1-model_v4 deleted 0.9963 1 175
AF-A0A1B7W3A1-F1-model_v4 Methenyltetrahydrofolate cyclohydrolase 0.9954 57 207 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A3C1LSI1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9933 9 105 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Feature Viewer

pLDDT pTM Quality
95.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map