F437908

General Info

Members Datasets Scaffolds Average Seq Length
412 280 394 216

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0017896|Ga0496107_0017896_1909_2697
Length 262
Sequence MEFEFAKVCYADKPDTERDRLQSRLVCLDSSPAPQPMIFAKRNFTMTITITAFEQSPDGGKGLARDTRVRWALEEVGQPYEVRLVSFRAMKEPAHLALHPFGQIPTYEDGDLALFETGSIVFHIAERHAGLLPDNADARARAITWMFAAVNTVEPAILELATARLLEGDKPWSKERLPLVEDRVRDRLKQLSARLGSADWLDGGFSAGDLMMVSVLLRLKSSGMLDEYPNLAAYLARGEARPAYKRAFEAQLAVNTGKPPTG

Samples

Sample ID Description Type Environment
1 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
2 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
3 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
4 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
5 2643221695 Lysobacter sp. Root494 Isolate Unclassified
6 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
7 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
8 2738543013 Variovorax sp. BT01 Isolate Unclassified
9 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
10 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
11 2904424332 Duganella sp. 1411 Isolate Rhizosphere
12 2922425934
13 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
14 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
15 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
267 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
275 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
276 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
277 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
278 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
279 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
280 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 0.73
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 1.46
Rhizoplane 5.34
Rhizosphere 68.2
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1001570 3300002774 Bacteria 6248
2 JGI25151J46595_10101495 3300003187 Bacteria 774
3 JGI25406J46586_10006765 3300003203 Bacteria 5267
4 JGI25153J46596_10000728 3300003215 Bacteria 20175
5 rootH2_10107503 3300003320 Bacteria 3820
6 rootL2_10016419 3300003322 Bacteria 4786
7 Ga0055540_1005659 3300003792 Bacteria 5183
8 Ga0065715_10319311 3300005293 Bacteria 1005
9 Ga0070658_10215174 3300005327 Bacteria 1624
10 Ga0070683_100017771 3300005329 Bacteria 6284
11 Ga0070683_100052387 3300005329 Bacteria 3780
12 Ga0068869_100159920 3300005334 Bacteria 1753
13 Ga0068869_100445519 3300005334 Bacteria 1072
14 Ga0070680_100151941 3300005336 Bacteria 1944
15 Ga0070660_100118161 3300005339 Bacteria 2115
16 Ga0070689_100043720 3300005340 Bacteria 3444
17 Ga0070669_100001636 3300005353 Bacteria 16220
18 Ga0070669_100478772 3300005353 Bacteria 1030
19 Ga0070674_100319145 3300005356 Bacteria 1245
20 Ga0070688_100092550 3300005365 Bacteria 1978
21 Ga0070667_100024710 3300005367 Bacteria 4992
22 Ga0070667_100382353 3300005367 Bacteria 1279
23 Ga0070667_100431831 3300005367 Bacteria 1202
24 Ga0070709_10330610 3300005434 Bacteria 1121
25 Ga0070714_100134176 3300005435 Bacteria 2215
26 Ga0070713_100015098 3300005436 Bacteria 5757
27 Ga0070700_100002244 3300005441 Bacteria 9835
28 Ga0070700_100028853 3300005441 Bacteria 3305
29 Ga0070663_100020535 3300005455 Bacteria 4374
30 Ga0070678_100087024 3300005456 Bacteria 2385
31 Ga0070678_100111789 3300005456 Bacteria 2138
32 Ga0070678_100312495 3300005456 Bacteria 1339
33 Ga0070681_10001605 3300005458 Bacteria 20118
34 Ga0068867_100369625 3300005459 Bacteria 1202
35 Ga0070685_10110125 3300005466 Bacteria 1695
36 Ga0070679_100001648 3300005530 Bacteria 20118
37 Ga0070684_100408150 3300005535 Bacteria 1253
38 Ga0070672_100173659 3300005543 Bacteria 1793
39 Ga0070672_100474436 3300005543 Bacteria 1080
40 Ga0070686_100041636 3300005544 Bacteria 2872
41 Ga0070665_100041144 3300005548 Bacteria 4645
42 Ga0070665_100056227 3300005548 Bacteria 3946
43 Ga0070665_100141759 3300005548 Bacteria 2406
44 Ga0068855_100056838 3300005563 Bacteria 4588
45 Ga0068855_100088995 3300005563 Bacteria 3565
46 Ga0068857_100055611 3300005577 Bacteria 3512
47 Ga0068857_100065773 3300005577 Bacteria 3225
48 Ga0070702_100063560 3300005615 Bacteria 2156
49 Ga0068852_100071672 3300005616 Bacteria 3043
50 Ga0068852_100198412 3300005616 Bacteria 1898
51 Ga0068859_100037364 3300005617 Bacteria 4874
52 Ga0068859_100860158 3300005617 Bacteria 992
53 Ga0068859_101007438 3300005617 Bacteria 915
54 Ga0068866_10006200 3300005718 Bacteria 4977
55 Ga0068861_100068450 3300005719 Bacteria 2743
56 Ga0068861_100069284 3300005719 Bacteria 2728
57 Ga0068861_100149581 3300005719 Bacteria 1914
58 Ga0068858_100116962 3300005842 Bacteria 2492
59 Ga0068858_100514254 3300005842 Bacteria 1157
60 Ga0068860_100050046 3300005843 Bacteria 3979
61 Ga0068860_100050163 3300005843 Bacteria 3973
62 Ga0068862_100504856 3300005844 Bacteria 1148
63 Ga0081455_10009004 3300005937 Bacteria 10307
64 Ga0081538_10003194 3300005981 Bacteria 15563
65 Ga0081538_10073638 3300005981 Bacteria 1864
66 Ga0081540_1004319 3300005983 Bacteria 10893
67 Ga0081539_10001127 3300005985 Bacteria 48442
68 Ga0070717_10131806 3300006028 Bacteria 2150
69 Ga0075365_10087961 3300006038 Bacteria 2113
70 Ga0075365_10164561 3300006038 Bacteria 1547
71 Ga0075365_10335854 3300006038 Bacteria 1065
72 Ga0075368_10002853 3300006042 Bacteria 5703
73 Ga0075368_10156121 3300006042 Bacteria 954
74 Ga0075368_10156608 3300006042 Bacteria 953
75 Ga0075363_100012758 3300006048 Bacteria 4056
76 Ga0075363_100040952 3300006048 Bacteria 2443
77 Ga0075363_100299996 3300006048 Bacteria 932
78 Ga0075364_10050339 3300006051 Bacteria 2719
79 Ga0075432_10012372 3300006058 Bacteria 2899
80 Ga0070715_10012299 3300006163 Bacteria 3111
81 Ga0075362_10017417 3300006177 Bacteria 2959
82 Ga0075367_10003679 3300006178 Bacteria 7363
83 Ga0075367_10048991 3300006178 Bacteria 2490
84 Ga0075367_10111672 3300006178 Bacteria 1678
85 Ga0075366_10154721 3300006195 Bacteria 1389
86 Ga0075370_10029614 3300006353 Bacteria 3050
87 Ga0075370_10121207 3300006353 Bacteria 1522
88 Ga0075370_10284172 3300006353 Bacteria 983
89 Ga0075428_100017633 3300006844 Bacteria 7888
90 Ga0075430_100066433 3300006846 Bacteria 3029
91 Ga0075434_100024755 3300006871 Bacteria 5870
92 Ga0075429_100021564 3300006880 Bacteria 5584
93 Ga0068865_100018757 3300006881 Bacteria 4469
94 Ga0097620_100037363 3300006931 Bacteria 4874
95 Ga0097620_100860183 3300006931 Bacteria 992
96 Ga0097620_101007278 3300006931 Bacteria 915
97 Ga0099795_10145204 3300007788 Bacteria 968
98 Ga0105240_10000189 3300009093 Bacteria 125396
99 Ga0105240_10053396 3300009093 Bacteria 5072
100 Ga0105240_10794842 3300009093 Bacteria 1025
101 Ga0105240_11433731 3300009093 Bacteria 725
102 Ga0111539_10043684 3300009094 Bacteria 5372
103 Ga0111539_10060918 3300009094 Bacteria 4472
104 Ga0105245_10129142 3300009098 Bacteria 2369
105 Ga0105245_10449387 3300009098 Bacteria 1297
106 Ga0105243_10273784 3300009148 Bacteria 1517
107 Ga0105242_10006248 3300009176 Bacteria 9176
108 Ga0105248_10339061 3300009177 Bacteria 1692
109 Ga0105248_10457803 3300009177 Bacteria 1438
110 Ga0105238_10060490 3300009551 Bacteria 3792
111 Ga0105249_10270143 3300009553 Bacteria 1694
112 Ga0105249_10291658 3300009553 Bacteria 1633
113 Ga0105249_10312481 3300009553 Bacteria 1580
114 Ga0105249_11122014 3300009553 Bacteria 857
115 Ga0105239_10042180 3300010375 Bacteria 5000
116 Ga0105239_10312421 3300010375 Bacteria 1771
117 Ga0105239_10736653 3300010375 Bacteria 1128
118 Ga0105239_11054897 3300010375 Bacteria 935
119 Ga0157373_10256686 3300013100 Bacteria 1237
120 Ga0157373_10577389 3300013100 Bacteria 817
121 Ga0157370_10522503 3300013104 Bacteria 1089
122 Ga0157369_10002780 3300013105 Bacteria 20900
123 Ga0157369_10772794 3300013105 Bacteria 988
124 Ga0157378_10278863 3300013297 Bacteria 1610
125 Ga0157378_10535071 3300013297 Bacteria 1175
126 Ga0157378_10832873 3300013297 Bacteria 950
127 Ga0182008_10064616 3300014497 Bacteria 1801
128 Ga0157377_10818274 3300014745 Bacteria 688
129 Ga0157376_10354932 3300014969 Bacteria 1404
130 Ga0182007_10039801 3300015262 Bacteria 1571
131 Ga0163161_10088319 3300017792 Bacteria 2292
132 Ga0163161_10726089 3300017792 Bacteria 829
133 Ga0206356_10314568 3300020070 Bacteria 3909
134 Ga0206354_10537741 3300020081 Bacteria 1110
135 Ga0213875_10048868 3300021388 Bacteria 1984
136 Ga0207425_1001146 3300025245 Bacteria 11926
137 Ga0207425_1038028 3300025245 Bacteria 926
138 Ga0209026_1000157 3300025250 Bacteria 106621
139 Ga0209759_1006641 3300025256 Bacteria 3854
140 Ga0209129_1001654 3300025258 Bacteria 12069
141 Ga0209129_1002673 3300025258 Bacteria 8431
142 Ga0209130_1004838 3300025284 Bacteria 4927
143 Ga0209025_1001496 3300025294 Bacteria 30216
144 Ga0209025_1002796 3300025294 Bacteria 17577
145 Ga0209758_1000223 3300025297 Bacteria 122584
146 Ga0209758_1001356 3300025297 Bacteria 29364
147 Ga0209758_1001818 3300025297 Bacteria 23544
148 Ga0207426_1005863 3300025302 Bacteria 5479
149 Ga0207426_1010626 3300025302 Bacteria 3560
150 Ga0209051_1008136 3300025303 Bacteria 5601
151 Ga0209051_1034043 3300025303 Bacteria 1915
152 Ga0207682_10002467 3300025893 Bacteria 8286
153 Ga0207680_10250211 3300025903 Bacteria 1224
154 Ga0207645_10001196 3300025907 Bacteria 21420
155 Ga0207645_10172357 3300025907 Bacteria 1418
156 Ga0207645_10371079 3300025907 Bacteria 959
157 Ga0207705_10287038 3300025909 Bacteria 1260
158 Ga0207654_10112006 3300025911 Bacteria 1700
159 Ga0207707_10001216 3300025912 Bacteria 24178
160 Ga0207695_10000003 3300025913 Bacteria 1368691
161 Ga0207695_10001655 3300025913 Bacteria 35911
162 Ga0207660_10009146 3300025917 Bacteria 6415
163 Ga0207657_10004196 3300025919 Bacteria 15264
164 Ga0207652_10001435 3300025921 Bacteria 21122
165 Ga0207681_10000585 3300025923 Bacteria 24828
166 Ga0207664_10022212 3300025929 Bacteria 4735
167 Ga0207664_10483622 3300025929 Bacteria 1108
168 Ga0207644_10213280 3300025931 Bacteria 1527
169 Ga0207686_10011994 3300025934 Bacteria 4757
170 Ga0207670_10040637 3300025936 Bacteria 3053
171 Ga0207669_10026213 3300025937 Bacteria 3166
172 Ga0207669_10065338 3300025937 Bacteria 2256
173 Ga0207669_10101438 3300025937 Bacteria 1904
174 Ga0207704_10011352 3300025938 Bacteria 4383
175 Ga0207691_10027193 3300025940 Bacteria 5366
176 Ga0207711_10217177 3300025941 Bacteria 1748
177 Ga0207689_10033275 3300025942 Bacteria 4284
178 Ga0207689_10046999 3300025942 Bacteria 3566
179 Ga0207661_10240440 3300025944 Bacteria 1606
180 Ga0207661_10346553 3300025944 Bacteria 1339
181 Ga0207667_10333208 3300025949 Bacteria 1549
182 Ga0207651_10325421 3300025960 Bacteria 1286
183 Ga0207712_10511673 3300025961 Bacteria 1028
184 Ga0207658_10047334 3300025986 Bacteria 3147
185 Ga0207658_10094686 3300025986 Bacteria 2325
186 Ga0207703_10049773 3300026035 Bacteria 3388
187 Ga0207703_10454630 3300026035 Bacteria 1197
188 Ga0207639_10012928 3300026041 Bacteria 5822
189 Ga0207678_10034067 3300026067 Bacteria 4435
190 Ga0207708_10000630 3300026075 Bacteria 27098
191 Ga0207708_10004448 3300026075 Bacteria 10334
192 Ga0207708_10072693 3300026075 Bacteria 2635
193 Ga0207648_10047931 3300026089 Bacteria 3743
194 Ga0207648_10369849 3300026089 Bacteria 1295
195 Ga0207674_10028822 3300026116 Bacteria 5854
196 Ga0207674_10055511 3300026116 Bacteria 4026
197 Ga0207675_100041335 3300026118 Bacteria 4306
198 Ga0207675_100267794 3300026118 Bacteria 1657
199 Ga0207683_10083006 3300026121 Bacteria 2847
200 Ga0207683_10996434 3300026121 Bacteria 778
201 Ga0209179_1025590 3300027512 Bacteria 1178
202 Ga0209588_1003570 3300027671 Bacteria 4320
203 Ga0209974_10036929 3300027876 Bacteria 1622
204 Ga0207428_10114710 3300027907 Bacteria 2070
205 Ga0265354_1003504 3300028016 Bacteria 1748
206 Ga0268266_10016053 3300028379 Bacteria 6401
207 Ga0268266_10065470 3300028379 Bacteria 3142
208 Ga0268266_10396120 3300028379 Bacteria 1305
209 Ga0268266_10414794 3300028379 Bacteria 1275
210 Ga0268266_10551950 3300028379 Bacteria 1104
211 Ga0268265_10018940 3300028380 Bacteria 4779
212 Ga0268265_10340964 3300028380 Bacteria 1364
213 Ga0268265_10680122 3300028380 Bacteria 992
214 Ga0265334_10000111 3300028573 Bacteria 53728
215 Ga0265318_10015109 3300028577 Bacteria 3222
216 Ga0307517_10000483 3300028786 Bacteria 68332
217 Ga0307517_10059299 3300028786 Bacteria 3668
218 Ga0265760_10009319 3300031090 Bacteria 2806
219 Ga0265325_10052062 3300031241 Bacteria 2103
220 Ga0265325_10062131 3300031241 Bacteria 1893
221 Ga0265325_10065645 3300031241 Bacteria 1832
222 Ga0265339_10037792 3300031249 Bacteria 2697
223 Ga0265331_10002641 3300031250 Bacteria 12013
224 Ga0265331_10093829 3300031250 Bacteria 1386
225 Ga0265327_10000176 3300031251 Bacteria 137002
226 Ga0265316_10270978 3300031344 Bacteria 1242
227 Ga0265313_10007535 3300031595 Bacteria 7405
228 Ga0265314_10012403 3300031711 Bacteria 6957
229 Ga0265342_10178778 3300031712 Bacteria 1163
230 Ga0307516_10254475 3300031730 Bacteria 1449
231 Ga0307405_10023123 3300031731 Bacteria 3527
232 Ga0307405_10112930 3300031731 Bacteria 1844
233 Ga0307410_10914685 3300031852 Bacteria 752
234 Ga0307407_10026030 3300031903 Bacteria 3093
235 Ga0307412_10005374 3300031911 Bacteria 7188
236 Ga0307414_10199563 3300032004 Bacteria 1626
237 Ga0307415_100055542 3300032126 Bacteria 2710
238 Ga0307510_10022868 3300033180 Bacteria 7251
239 Ga0373949_0033818 3300035090 Bacteria 1230
240 Ga0373932_0013182 3300035112 Bacteria 2050
241 Ga0373937_0283418 3300036401 Bacteria 1565
242 Ga0395898_0082310 3300037466 Bacteria 3102
243 Ga0395898_0162834 3300037466 Bacteria 2134
244 Ga0395905_0336283 3300037471 Bacteria 1401
245 Ga0436364_1076123 3300037853 Bacteria 3614
246 Ga0242420_028531 3300038996 Bacteria 1028
247 Ga0439436_0003230 3300041404 Bacteria 4947
248 Ga0439461_0052854 3300041410 Bacteria 905
249 Ga0451789_1082851 3300041443 Bacteria 834
250 Ga0451807_0675473 3300041486 Bacteria 1066
251 Ga0451843_1096734 3300041509 Bacteria 934
252 Ga0439459_0066608 3300042438 Bacteria 825
253 Ga0466965_0182009 3300044683 Bacteria 1109
254 Ga0466963_0024629 3300044694 Bacteria 3831
255 Ga0466970_0152609 3300044765 Bacteria 1276
256 Ga0466960_0086095 3300044901 Bacteria 1593
257 Ga0466958_0007468 3300045836 Bacteria 6018
258 Ga0466967_0086051 3300045976 Bacteria 2847
259 Ga0495638_0025591 3300046460 Bacteria 3833
260 Ga0495638_0317034 3300046460 Bacteria 834
261 Ga0495638_0353245 3300046460 Bacteria 776
262 Ga0495584_0364173 3300046491 Bacteria 734
263 Ga0495596_0046373 3300046500 Bacteria 1707
264 Ga0495608_0328867 3300046511 Bacteria 943
265 Ga0495616_0000059 3300046513 Bacteria 98345
266 Ga0495620_0042146 3300046515 Bacteria 1996
267 Ga0495620_0126899 3300046515 Bacteria 1003
268 Ga0495628_0026862 3300046516 Bacteria 4686
269 Ga0495628_0501759 3300046516 Bacteria 876
270 Ga0495644_0104219 3300046523 Bacteria 1074
271 Ga0495663_0009468 3300046525 Bacteria 2703
272 Ga0495663_0019926 3300046525 Bacteria 1923
273 Ga0495597_0039963 3300046542 Bacteria 2098
274 Ga0495645_0150111 3300046543 Bacteria 1620
275 Ga0495622_0046760 3300046557 Bacteria 2011
276 Ga0495633_0062934 3300046558 Bacteria 1737
277 Ga0495656_0002350 3300046615 Bacteria 6264
278 Ga0495668_0020247 3300046616 Bacteria 3828
279 Ga0495625_0000165 3300046660 Bacteria 102988
280 Ga0495625_0006752 3300046660 Bacteria 10162
281 Ga0495625_0044657 3300046660 Bacteria 3207
282 Ga0495625_0533435 3300046660 Bacteria 713
283 Ga0495661_0152773 3300046665 Bacteria 1246
284 Ga0495588_0038451 3300046674 Bacteria 2434
285 Ga0495588_0167462 3300046674 Bacteria 1162
286 Ga0495599_0151647 3300046678 Bacteria 1435
287 Ga0495623_0363496 3300046679 Bacteria 786
288 Ga0495669_0326795 3300046684 Bacteria 740
289 Ga0495670_0097995 3300046691 Bacteria 1507
290 Ga0495674_0622354 3300047319 Bacteria 853
291 Ga0495684_0014963 3300047471 Bacteria 5975
292 Ga0495686_0126413 3300047472 Bacteria 1520
293 Ga0495686_0251233 3300047472 Bacteria 994
294 Ga0495602_0042279 3300048088 Bacteria 4154
295 Ga0495615_0000471 3300048090 Bacteria 5846
296 Ga0496102_0023127 3300048905 Bacteria 5515
297 Ga0496102_0656455 3300048905 Bacteria 972
298 Ga0496104_0000211 3300048907 Bacteria 51798
299 Ga0496104_0363037 3300048907 Bacteria 1361
300 Ga0496106_0003154 3300048909 Bacteria 12306
301 Ga0496106_0006774 3300048909 Bacteria 8482
302 Ga0496106_0064754 3300048909 Bacteria 2782
303 Ga0496107_0017896 3300048910 Bacteria 4988
304 Ga0496108_0002580 3300048911 Bacteria 14517
305 Ga0496108_0192639 3300048911 Bacteria 1767
306 Ga0496109_0000691 3300048912 Bacteria 28096
307 Ga0496109_0781203 3300048912 Bacteria 893
308 Ga0496110_0045321 3300048913 Bacteria 3843
309 Ga0496110_0124896 3300048913 Bacteria 2321
310 Ga0496110_0127415 3300048913 Bacteria 2297
311 Ga0496111_0006672 3300048914 Bacteria 7507
312 Ga0496112_0011599 3300048915 Bacteria 8058
313 Ga0496112_0119632 3300048915 Bacteria 2604
314 Ga0496115_0004171 3300048918 Bacteria 10436
315 Ga0496115_0126270 3300048918 Bacteria 2107
316 Ga0496116_0125659 3300048919 Bacteria 1474
317 Ga0496117_0036888 3300048920 Bacteria 3650
318 Ga0496118_0001892 3300048921 Bacteria 29856
319 Ga0496118_0007637 3300048921 Bacteria 11388
320 Ga0496120_0079659 3300048923 Bacteria 1777
321 Ga0496121_0000041 3300048924 Bacteria 346686
322 Ga0496121_0020631 3300048924 Bacteria 6507
323 Ga0496121_0026324 3300048924 Bacteria 5484
324 Ga0496121_0428811 3300048924 Bacteria 858
325 Ga0496122_0043226 3300048925 Bacteria 3533
326 Ga0496125_0028941 3300048928 Bacteria 4990
327 Ga0496125_0043137 3300048928 Bacteria 3834
328 Ga0496125_0072946 3300048928 Bacteria 2672
329 Ga0496126_0002010 3300048929 Bacteria 28750
330 Ga0496126_0009183 3300048929 Bacteria 10548
331 Ga0496126_0094631 3300048929 Bacteria 2621
332 Ga0496126_0779604 3300048929 Bacteria 735
333 Ga0495682_0142627 3300049460 Bacteria 855
334 Ga0501034_0002023 3300049571 Bacteria 25520
335 Ga0501034_0281422 3300049571 Bacteria 1602
336 Ga0501036_0021330 3300049572 Bacteria 5444
337 Ga0501039_0374570 3300049575 Bacteria 1118
338 Ga0501040_0428101 3300049576 Bacteria 952
339 Ga0501046_0395744 3300049580 Bacteria 998
340 Ga0501047_0435522 3300049581 Bacteria 1141
341 Ga0501067_0043471 3300049583 Bacteria 2495
342 Ga0501067_0079420 3300049583 Bacteria 1818
343 Ga0501068_0014700 3300049584 Bacteria 4479
344 Ga0501070_0017070 3300049586 Bacteria 6091
345 Ga0501072_0052370 3300049588 Bacteria 3214
346 Ga0501072_0348770 3300049588 Bacteria 1175
347 Ga0501074_0232122 3300049590 Bacteria 1313
348 Ga0501075_0392662 3300049591 Bacteria 1058
349 Ga0501079_0366610 3300049741 Bacteria 1129
350 Ga0501080_0018515 3300049742 Bacteria 6442
351 Ga0501083_0021751 3300049744 Bacteria 4455
352 Ga0501045_0174730 3300049824 Bacteria 1600
353 nmdc:mga03n38_33697_c1 3300050490 Bacteria 2181
354 nmdc:mga03n38_35026_c1 3300050490 Bacteria 2148
355 nmdc:mga0yw44_173074_c1 3300050492 Bacteria 1418
356 nmdc:mga0yw44_25508_c1 3300050492 Bacteria 2592
357 nmdc:mga0yw44_2973_c1 3300050492 Bacteria 7389
358 nmdc:mga0yw44_314806_c1 3300050492 Bacteria 1050
359 nmdc:mga06z11_20013_c2 3300050494 Bacteria 2448
360 nmdc:mga06z11_253953_c1 3300050494 Bacteria 1036
361 nmdc:mga04h51_20493_c1 3300050495 Bacteria 1975
362 nmdc:mga07m45_210745_c1 3300050496 Bacteria 1130
363 nmdc:mga05p37_417024_c1 3300050507 Bacteria 1563
364 nmdc:mga09592_373059_c1 3300050508 Bacteria 1234
365 nmdc:mga09592_39871_c1 3300050508 Bacteria 3945
366 nmdc:mga0qj67_115871_c1 3300050509 Bacteria 2165
367 nmdc:mga08y16_53867_c1 3300050511 Bacteria 4205
368 nmdc:mga08y16_72590_c1 3300050511 Bacteria 3586
369 nmdc:mga0n895_125340_c1 3300050512 Bacteria 2592
370 nmdc:mga0sz30_212942_c1 3300050516 Bacteria 859
371 nmdc:mga0sz30_59722_c1 3300050516 Bacteria 1627
372 Ga0495601_0052878 3300053077 Bacteria 2566
373 Ga0500566_0013148 3300053094 Bacteria 4876
374 Ga0500566_0133241 3300053094 Bacteria 1327
375 Ga0500650_0096686 3300053098 Bacteria 1383
376 Ga0500650_0158211 3300053098 Bacteria 1045
377 Ga0500556_0000107 3300053104 Bacteria 74228
378 Ga0500556_0000503 3300053104 Bacteria 26921
379 Ga0500556_0012360 3300053104 Bacteria 2549
380 Ga0500571_212211 3300053110 Bacteria 758
381 Ga0500572_002012 3300053111 Bacteria 5066
382 Ga0500595_044023 3300053119 Bacteria 1417
383 Ga0500642_0000007 3300053130 Bacteria 294238
384 Ga0500568_0155776 3300053139 Bacteria 844
385 Ga0500589_083021 3300053147 Bacteria 1427
386 Ga0500589_181075 3300053147 Bacteria 828
387 Ga0500616_0009427 3300053153 Bacteria 5939
388 Ga0500616_0078672 3300053153 Bacteria 1662
389 Ga0500622_0000136 3300053156 Bacteria 78059
390 Ga0500627_0000942 3300053158 Bacteria 7853
391 Ga0500627_0103043 3300053158 Bacteria 1282
392 Ga0500611_075238 3300053727 Bacteria 832
393 Ga0500645_076970 3300053730 Bacteria 954
394 Ga0500656_019893 3300053732 Bacteria 824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10026030 Ga0307407_100260307 210
2 3300005329 Ga0070683_100052387 Ga0070683_1000523871 211
3 3300005535 Ga0070684_100408150 Ga0070684_1004081502 211
4 3300005548 Ga0070665_100041144 Ga0070665_1000411442 211
5 3300009093 Ga0105240_10000189 Ga0105240_1000018911 211
6 3300013105 Ga0157369_10002780 Ga0157369_100027803 211
7 3300013297 Ga0157378_10832873 Ga0157378_108328732 211
8 3300025913 Ga0207695_10000003 Ga0207695_10000003439 211
9 3300025944 Ga0207661_10240440 Ga0207661_102404402 211
10 3300025986 Ga0207658_10094686 Ga0207658_100946863 211
11 3300046660 Ga0495625_0533435 Ga0495625_0533435_45_683 211
12 3300048924 Ga0496121_0428811 Ga0496121_0428811_197_832 211
13 3300003187 JGI25151J46595_10101495 JGI25151J46595_101014951 212
14 3300005340 Ga0070689_100043720 Ga0070689_1000437203 212
15 3300005353 Ga0070669_100001636 Ga0070669_10000163613 212
16 3300005365 Ga0070688_100092550 Ga0070688_1000925502 212
17 3300005367 Ga0070667_100431831 Ga0070667_1004318311 212
18 3300005441 Ga0070700_100002244 Ga0070700_1000022444 212
19 3300005456 Ga0070678_100087024 Ga0070678_1000870242 212
20 3300005466 Ga0070685_10110125 Ga0070685_101101252 212
21 3300005543 Ga0070672_100173659 Ga0070672_1001736593 212
22 3300005544 Ga0070686_100041636 Ga0070686_1000416362 212
23 3300005563 Ga0068855_100056838 Ga0068855_1000568382 212
24 3300005616 Ga0068852_100071672 Ga0068852_1000716723 212
25 3300005616 Ga0068852_100198412 Ga0068852_1001984122 212
26 3300005719 Ga0068861_100068450 Ga0068861_1000684502 212
27 3300005842 Ga0068858_100514254 Ga0068858_1005142542 212
28 3300006881 Ga0068865_100018757 Ga0068865_1000187573 212
29 3300009553 Ga0105249_10312481 Ga0105249_103124812 212
30 3300013297 Ga0157378_10278863 Ga0157378_102788632 212
31 3300020070 Ga0206356_10314568 Ga0206356_103145684 212
32 3300025294 Ga0209025_1002796 Ga0209025_10027965 212
33 3300025907 Ga0207645_10001196 Ga0207645_1000119615 212
34 3300025923 Ga0207681_10000585 Ga0207681_1000058513 212
35 3300025936 Ga0207670_10040637 Ga0207670_100406372 212
36 3300025937 Ga0207669_10065338 Ga0207669_100653381 212
37 3300025938 Ga0207704_10011352 Ga0207704_100113523 212
38 3300025940 Ga0207691_10027193 Ga0207691_100271933 212
39 3300025960 Ga0207651_10325421 Ga0207651_103254212 212
40 3300026035 Ga0207703_10454630 Ga0207703_104546302 212
41 3300026075 Ga0207708_10000630 Ga0207708_1000063015 212
42 3300026089 Ga0207648_10047931 Ga0207648_100479314 212
43 3300026121 Ga0207683_10083006 Ga0207683_100830062 212
44 3300028380 Ga0268265_10680122 Ga0268265_106801222 212
45 3300028786 Ga0307517_10000483 Ga0307517_1000048376 212
46 3300031241 Ga0265325_10065645 Ga0265325_100656452 212
47 3300031250 Ga0265331_10002641 Ga0265331_100026418 212
48 3300031251 Ga0265327_10000176 Ga0265327_1000017639 212
49 3300049571 Ga0501034_0281422 Ga0501034_0281422_542_1180 212
50 3300049572 Ga0501036_0021330 Ga0501036_0021330_592_1230 212
51 3300049575 Ga0501039_0374570 Ga0501039_0374570_439_1077 212
52 3300049576 Ga0501040_0428101 Ga0501040_0428101_110_748 212
53 3300049580 Ga0501046_0395744 Ga0501046_0395744_42_680 212
54 3300049581 Ga0501047_0435522 Ga0501047_0435522_81_719 212
55 3300049583 Ga0501067_0043471 Ga0501067_0043471_41_679 212
56 3300049584 Ga0501068_0014700 Ga0501068_0014700_992_1630 212
57 3300049586 Ga0501070_0017070 Ga0501070_0017070_43_681 212
58 3300049588 Ga0501072_0052370 Ga0501072_0052370_353_991 212
59 3300049590 Ga0501074_0232122 Ga0501074_0232122_127_765 212
60 3300049741 Ga0501079_0366610 Ga0501079_0366610_340_978 212
61 3300049742 Ga0501080_0018515 Ga0501080_0018515_2652_3290 212
62 3300049744 Ga0501083_0021751 Ga0501083_0021751_1861_2499 212
63 3300049824 Ga0501045_0174730 Ga0501045_0174730_799_1437 212
64 3300050507 nmdc:mga05p37_417024_c1 nmdc:mga05p37_417024_c1_254_892 212
65 3300053119 Ga0500595_044023 Ga0500595_044023_760_1398 212
66 iso_pu_bacteria 2693429783 2694632475 212
67 iso_pu_bacteria 2693429784 2694638652 212
68 iso_pu_bacteria 2871474448 2871480445 212
69 iso_pu_bacteria 2878788777 2878795855 212
70 iso_pu_bacteria 2937836603 2937838308 212
71 iso_pu_bacteria 2958071322 2958073005 212
72 iso_pu_bacteria 8004633249 8004636662 212
73 3300005455 Ga0070663_100020535 Ga0070663_1000205352 213
74 3300005548 Ga0070665_100141759 Ga0070665_1001417593 213
75 3300005577 Ga0068857_100065773 Ga0068857_1000657732 213
76 3300005617 Ga0068859_100037364 Ga0068859_1000373646 213
77 3300006048 Ga0075363_100299996 Ga0075363_1002999962 213
78 3300006931 Ga0097620_100037363 Ga0097620_1000373636 213
79 3300009098 Ga0105245_10129142 Ga0105245_101291425 213
80 3300009098 Ga0105245_10449387 Ga0105245_104493871 213
81 3300009148 Ga0105243_10273784 Ga0105243_102737843 213
82 3300009176 Ga0105242_10006248 Ga0105242_1000624811 213
83 3300013104 Ga0157370_10522503 Ga0157370_105225031 213
84 3300013105 Ga0157369_10772794 Ga0157369_107727942 213
85 3300025934 Ga0207686_10011994 Ga0207686_100119947 213
86 3300026067 Ga0207678_10034067 Ga0207678_100340672 213
87 3300026116 Ga0207674_10028822 Ga0207674_100288226 213
88 3300028379 Ga0268266_10414794 Ga0268266_104147942 213
89 3300031241 Ga0265325_10062131 Ga0265325_100621313 213
90 3300044694 Ga0466963_0024629 Ga0466963_0024629_3054_3695 213
91 3300049588 Ga0501072_0348770 Ga0501072_0348770_447_1088 213
92 3300050516 nmdc:mga0sz30_59722_c1 nmdc:mga0sz30_59722_c1_57_698 213
93 3300053104 Ga0500556_0000503 Ga0500556_0000503_12639_13289 213
94 3300053730 Ga0500645_076970 Ga0500645_076970_270_920 213
95 iso_pu_bacteria 2643221551 2643775594 213
96 iso_pu_bacteria 2643221555 2643794041 213
97 iso_pu_bacteria 2738543013 2739251316 213
98 iso_pu_bacteria 2904424332 2904424568 213
99 iso_pu_bacteria 2922425934 2922430520 213
100 iso_pu_bacteria 3005474847 3005480431 213
101 iso_pu_bacteria 8057101203 8057102973 213
102 3300005563 Ga0068855_100088995 Ga0068855_1000889953 214
103 3300005577 Ga0068857_100055611 Ga0068857_1000556113 214
104 3300006844 Ga0075428_100017633 Ga0075428_1000176335 214
105 3300006846 Ga0075430_100066433 Ga0075430_1000664332 214
106 3300006880 Ga0075429_100021564 Ga0075429_1000215643 214
107 3300009094 Ga0111539_10043684 Ga0111539_100436844 214
108 3300010375 Ga0105239_10042180 Ga0105239_100421802 214
109 3300025303 Ga0209051_1034043 Ga0209051_10340432 214
110 3300025949 Ga0207667_10333208 Ga0207667_103332082 214
111 3300026041 Ga0207639_10012928 Ga0207639_100129282 214
112 3300026116 Ga0207674_10055511 Ga0207674_100555113 214
113 3300027876 Ga0209974_10036929 Ga0209974_100369292 214
114 3300027907 Ga0207428_10114710 Ga0207428_101147102 214
115 3300028577 Ga0265318_10015109 Ga0265318_100151091 214
116 3300031249 Ga0265339_10037792 Ga0265339_100377922 214
117 3300031250 Ga0265331_10093829 Ga0265331_100938291 214
118 3300031344 Ga0265316_10270978 Ga0265316_102709782 214
119 3300031595 Ga0265313_10007535 Ga0265313_100075356 214
120 3300031711 Ga0265314_10012403 Ga0265314_100124036 214
121 3300031712 Ga0265342_10178778 Ga0265342_101787781 214
122 3300031731 Ga0307405_10023123 Ga0307405_100231234 214
123 3300032126 Ga0307415_100055542 Ga0307415_1000555422 214
124 3300041443 Ga0451789_1082851 Ga0451789_1082851_154_798 214
125 3300041486 Ga0451807_0675473 Ga0451807_0675473_292_936 214
126 3300049571 Ga0501034_0002023 Ga0501034_0002023_7802_8446 214
127 3300050508 nmdc:mga09592_39871_c1 nmdc:mga09592_39871_c1_1846_2490 214
128 3300050509 nmdc:mga0qj67_115871_c1 nmdc:mga0qj67_115871_c1_661_1305 214
129 3300050511 nmdc:mga08y16_53867_c1 nmdc:mga08y16_53867_c1_2256_2900 214
130 3300053104 Ga0500556_0012360 Ga0500556_0012360_443_1087 214
131 3300053147 Ga0500589_083021 Ga0500589_083021_690_1334 214
132 iso_pu_bacteria 2582581298 2585226775 214
133 iso_pu_bacteria 2585427529 2585550190 214
134 iso_pu_bacteria 2643221695 2644529135 214
135 3300005356 Ga0070674_100319145 Ga0070674_1003191451 215
136 3300005367 Ga0070667_100382353 Ga0070667_1003823532 215
137 3300005434 Ga0070709_10330610 Ga0070709_103306101 215
138 3300005436 Ga0070713_100015098 Ga0070713_1000150985 215
139 3300005459 Ga0068867_100369625 Ga0068867_1003696252 215
140 3300005543 Ga0070672_100474436 Ga0070672_1004744361 215
141 3300005548 Ga0070665_100056227 Ga0070665_1000562273 215
142 3300005617 Ga0068859_100860158 Ga0068859_1008601582 215
143 3300005617 Ga0068859_101007438 Ga0068859_1010074381 215
144 3300005842 Ga0068858_100116962 Ga0068858_1001169622 215
145 3300006353 Ga0075370_10029614 Ga0075370_100296143 215
146 3300006931 Ga0097620_100860183 Ga0097620_1008601832 215
147 3300006931 Ga0097620_101007278 Ga0097620_1010072781 215
148 3300009093 Ga0105240_10794842 Ga0105240_107948422 215
149 3300009177 Ga0105248_10339061 Ga0105248_103390611 215
150 3300014969 Ga0157376_10354932 Ga0157376_103549321 215
151 3300025937 Ga0207669_10101438 Ga0207669_101014382 215
152 3300025941 Ga0207711_10217177 Ga0207711_102171771 215
153 3300026035 Ga0207703_10049773 Ga0207703_100497731 215
154 3300026089 Ga0207648_10369849 Ga0207648_103698492 215
155 3300026118 Ga0207675_100267794 Ga0207675_1002677941 215
156 3300028379 Ga0268266_10016053 Ga0268266_100160531 215
157 3300028379 Ga0268266_10065470 Ga0268266_100654704 215
158 3300028786 Ga0307517_10059299 Ga0307517_100592992 215
159 3300031241 Ga0265325_10052062 Ga0265325_100520621 215
160 3300031852 Ga0307410_10914685 Ga0307410_109146851 215
161 3300037466 Ga0395898_0082310 Ga0395898_0082310_1200_1847 215
162 3300045836 Ga0466958_0007468 Ga0466958_0007468_1453_2100 215
163 3300046460 Ga0495638_0317034 Ga0495638_0317034_89_736 215
164 3300046491 Ga0495584_0364173 Ga0495584_0364173_42_689 215
165 3300046511 Ga0495608_0328867 Ga0495608_0328867_226_873 215
166 3300046558 Ga0495633_0062934 Ga0495633_0062934_465_1112 215
167 3300046660 Ga0495625_0006752 Ga0495625_0006752_7910_8557 215
168 3300046665 Ga0495661_0152773 Ga0495661_0152773_21_668 215
169 3300047472 Ga0495686_0126413 Ga0495686_0126413_187_834 215
170 3300048905 Ga0496102_0656455 Ga0496102_0656455_162_809 215
171 3300048909 Ga0496106_0064754 Ga0496106_0064754_537_1184 215
172 3300048911 Ga0496108_0192639 Ga0496108_0192639_189_866 215
173 3300048912 Ga0496109_0781203 Ga0496109_0781203_124_801 215
174 3300048913 Ga0496110_0124896 Ga0496110_0124896_627_1304 215
175 3300048921 Ga0496118_0007637 Ga0496118_0007637_1686_2333 215
176 3300048923 Ga0496120_0079659 Ga0496120_0079659_775_1422 215
177 3300048924 Ga0496121_0020631 Ga0496121_0020631_4129_4776 215
178 3300048928 Ga0496125_0043137 Ga0496125_0043137_853_1500 215
179 3300053094 Ga0500566_0133241 Ga0500566_0133241_436_1083 215
180 3300053098 Ga0500650_0158211 Ga0500650_0158211_263_910 215
181 3300053104 Ga0500556_0000107 Ga0500556_0000107_26057_26704 215
182 3300053130 Ga0500642_0000007 Ga0500642_0000007_265168_265815 215
183 3300005435 Ga0070714_100134176 Ga0070714_1001341762 216
184 3300005937 Ga0081455_10009004 Ga0081455_100090047 216
185 3300006028 Ga0070717_10131806 Ga0070717_101318062 216
186 3300006038 Ga0075365_10164561 Ga0075365_101645613 216
187 3300006042 Ga0075368_10156121 Ga0075368_101561212 216
188 3300006163 Ga0070715_10012299 Ga0070715_100122992 216
189 3300006195 Ga0075366_10154721 Ga0075366_101547212 216
190 3300006353 Ga0075370_10121207 Ga0075370_101212073 216
191 3300010375 Ga0105239_10312421 Ga0105239_103124213 216
192 3300021388 Ga0213875_10048868 Ga0213875_100488682 216
193 3300025302 Ga0207426_1010626 Ga0207426_10106264 216
194 3300025911 Ga0207654_10112006 Ga0207654_101120061 216
195 3300025929 Ga0207664_10483622 Ga0207664_104836222 216
196 3300037466 Ga0395898_0162834 Ga0395898_0162834_1109_1759 216
197 3300037471 Ga0395905_0336283 Ga0395905_0336283_420_1070 216
198 3300037853 Ga0436364_1076123 Ga0436364_1076123_2272_2922 216
199 3300041404 Ga0439436_0003230 Ga0439436_0003230_3155_3805 216
200 3300042438 Ga0439459_0066608 Ga0439459_0066608_23_673 216
201 3300044683 Ga0466965_0182009 Ga0466965_0182009_239_889 216
202 3300044765 Ga0466970_0152609 Ga0466970_0152609_540_1190 216
203 3300044901 Ga0466960_0086095 Ga0466960_0086095_834_1484 216
204 3300050492 nmdc:mga0yw44_314806_c1 nmdc:mga0yw44_314806_c1_57_749 216
205 3300003203 JGI25406J46586_10006765 JGI25406J46586_100067654 217
206 3300003215 JGI25153J46596_10000728 JGI25153J46596_100007287 217
207 3300005293 Ga0065715_10319311 Ga0065715_103193111 217
208 3300005327 Ga0070658_10215174 Ga0070658_102151742 217
209 3300005329 Ga0070683_100017771 Ga0070683_1000177715 217
210 3300005334 Ga0068869_100159920 Ga0068869_1001599201 217
211 3300005334 Ga0068869_100445519 Ga0068869_1004455192 217
212 3300005336 Ga0070680_100151941 Ga0070680_1001519412 217
213 3300005339 Ga0070660_100118161 Ga0070660_1001181613 217
214 3300005441 Ga0070700_100028853 Ga0070700_1000288531 217
215 3300005456 Ga0070678_100111789 Ga0070678_1001117892 217
216 3300005456 Ga0070678_100312495 Ga0070678_1003124951 217
217 3300005458 Ga0070681_10001605 Ga0070681_100016054 217
218 3300005530 Ga0070679_100001648 Ga0070679_1000016484 217
219 3300005615 Ga0070702_100063560 Ga0070702_1000635602 217
220 3300005718 Ga0068866_10006200 Ga0068866_100062004 217
221 3300005719 Ga0068861_100069284 Ga0068861_1000692841 217
222 3300005719 Ga0068861_100149581 Ga0068861_1001495812 217
223 3300005843 Ga0068860_100050046 Ga0068860_1000500462 217
224 3300005844 Ga0068862_100504856 Ga0068862_1005048562 217
225 3300005981 Ga0081538_10003194 Ga0081538_1000319410 217
226 3300005981 Ga0081538_10073638 Ga0081538_100736382 217
227 3300005983 Ga0081540_1004319 Ga0081540_10043194 217
228 3300005985 Ga0081539_10001127 Ga0081539_1000112710 217
229 3300006038 Ga0075365_10335854 Ga0075365_103358542 217
230 3300006042 Ga0075368_10002853 Ga0075368_100028535 217
231 3300006042 Ga0075368_10156608 Ga0075368_101566081 217
232 3300006048 Ga0075363_100040952 Ga0075363_1000409522 217
233 3300006051 Ga0075364_10050339 Ga0075364_100503392 217
234 3300006058 Ga0075432_10012372 Ga0075432_100123722 217
235 3300006177 Ga0075362_10017417 Ga0075362_100174173 217
236 3300006178 Ga0075367_10003679 Ga0075367_100036797 217
237 3300006178 Ga0075367_10111672 Ga0075367_101116722 217
238 3300006353 Ga0075370_10284172 Ga0075370_102841722 217
239 3300006871 Ga0075434_100024755 Ga0075434_1000247555 217
240 3300007788 Ga0099795_10145204 Ga0099795_101452041 217
241 3300009093 Ga0105240_10053396 Ga0105240_100533964 217
242 3300009093 Ga0105240_11433731 Ga0105240_114337311 217
243 3300009094 Ga0111539_10060918 Ga0111539_100609183 217
244 3300009177 Ga0105248_10457803 Ga0105248_104578032 217
245 3300009551 Ga0105238_10060490 Ga0105238_100604902 217
246 3300009553 Ga0105249_10291658 Ga0105249_102916582 217
247 3300009553 Ga0105249_11122014 Ga0105249_111220141 217
248 3300010375 Ga0105239_10736653 Ga0105239_107366532 217
249 3300010375 Ga0105239_11054897 Ga0105239_110548971 217
250 3300013100 Ga0157373_10577389 Ga0157373_105773891 217
251 3300013297 Ga0157378_10535071 Ga0157378_105350712 217
252 3300014497 Ga0182008_10064616 Ga0182008_100646163 217
253 3300014745 Ga0157377_10818274 Ga0157377_108182741 217
254 3300015262 Ga0182007_10039801 Ga0182007_100398012 217
255 3300017792 Ga0163161_10088319 Ga0163161_100883192 217
256 3300017792 Ga0163161_10726089 Ga0163161_107260891 217
257 3300025250 Ga0209026_1000157 Ga0209026_100015789 217
258 3300025256 Ga0209759_1006641 Ga0209759_10066415 217
259 3300025297 Ga0209758_1000223 Ga0209758_100022375 217
260 3300025893 Ga0207682_10002467 Ga0207682_100024674 217
261 3300025903 Ga0207680_10250211 Ga0207680_102502111 217
262 3300025907 Ga0207645_10172357 Ga0207645_101723572 217
263 3300025907 Ga0207645_10371079 Ga0207645_103710792 217
264 3300025909 Ga0207705_10287038 Ga0207705_102870382 217
265 3300025912 Ga0207707_10001216 Ga0207707_100012167 217
266 3300025913 Ga0207695_10001655 Ga0207695_1000165522 217
267 3300025917 Ga0207660_10009146 Ga0207660_100091466 217
268 3300025921 Ga0207652_10001435 Ga0207652_100014356 217
269 3300025929 Ga0207664_10022212 Ga0207664_100222126 217
270 3300025931 Ga0207644_10213280 Ga0207644_102132801 217
271 3300025937 Ga0207669_10026213 Ga0207669_100262131 217
272 3300025942 Ga0207689_10033275 Ga0207689_100332754 217
273 3300025942 Ga0207689_10046999 Ga0207689_100469994 217
274 3300025944 Ga0207661_10346553 Ga0207661_103465532 217
275 3300025961 Ga0207712_10511673 Ga0207712_105116731 217
276 3300025986 Ga0207658_10047334 Ga0207658_100473342 217
277 3300026075 Ga0207708_10004448 Ga0207708_100044489 217
278 3300026075 Ga0207708_10072693 Ga0207708_100726932 217
279 3300026118 Ga0207675_100041335 Ga0207675_1000413354 217
280 3300027671 Ga0209588_1003570 Ga0209588_10035701 217
281 3300028016 Ga0265354_1003504 Ga0265354_10035042 217
282 3300028379 Ga0268266_10396120 Ga0268266_103961203 217
283 3300028379 Ga0268266_10551950 Ga0268266_105519501 217
284 3300028380 Ga0268265_10018940 Ga0268265_100189404 217
285 3300028380 Ga0268265_10340964 Ga0268265_103409641 217
286 3300028573 Ga0265334_10000111 Ga0265334_1000011132 217
287 3300031090 Ga0265760_10009319 Ga0265760_100093193 217
288 3300031731 Ga0307405_10112930 Ga0307405_101129304 217
289 3300032004 Ga0307414_10199563 Ga0307414_101995631 217
290 3300035090 Ga0373949_0033818 Ga0373949_0033818_63_716 217
291 3300035112 Ga0373932_0013182 Ga0373932_0013182_829_1482 217
292 3300036401 Ga0373937_0283418 Ga0373937_0283418_61_714 217
293 3300038996 Ga0242420_028531 Ga0242420_028531_254_907 217
294 3300041509 Ga0451843_1096734 Ga0451843_1096734_268_921 217
295 3300045976 Ga0466967_0086051 Ga0466967_0086051_990_1643 217
296 3300046460 Ga0495638_0025591 Ga0495638_0025591_2779_3432 217
297 3300046460 Ga0495638_0353245 Ga0495638_0353245_56_709 217
298 3300046500 Ga0495596_0046373 Ga0495596_0046373_774_1427 217
299 3300046513 Ga0495616_0000059 Ga0495616_0000059_88814_89467 217
300 3300046515 Ga0495620_0042146 Ga0495620_0042146_1094_1747 217
301 3300046515 Ga0495620_0126899 Ga0495620_0126899_302_955 217
302 3300046516 Ga0495628_0026862 Ga0495628_0026862_1232_1885 217
303 3300046523 Ga0495644_0104219 Ga0495644_0104219_269_922 217
304 3300046525 Ga0495663_0009468 Ga0495663_0009468_1640_2293 217
305 3300046525 Ga0495663_0019926 Ga0495663_0019926_750_1403 217
306 3300046542 Ga0495597_0039963 Ga0495597_0039963_589_1242 217
307 3300046543 Ga0495645_0150111 Ga0495645_0150111_30_683 217
308 3300046557 Ga0495622_0046760 Ga0495622_0046760_1029_1682 217
309 3300046615 Ga0495656_0002350 Ga0495656_0002350_1782_2435 217
310 3300046616 Ga0495668_0020247 Ga0495668_0020247_1351_2004 217
311 3300046660 Ga0495625_0000165 Ga0495625_0000165_79278_79931 217
312 3300046660 Ga0495625_0044657 Ga0495625_0044657_2468_3121 217
313 3300046674 Ga0495588_0038451 Ga0495588_0038451_1248_1901 217
314 3300046674 Ga0495588_0167462 Ga0495588_0167462_135_788 217
315 3300046678 Ga0495599_0151647 Ga0495599_0151647_624_1277 217
316 3300046679 Ga0495623_0363496 Ga0495623_0363496_117_770 217
317 3300046684 Ga0495669_0326795 Ga0495669_0326795_11_664 217
318 3300046691 Ga0495670_0097995 Ga0495670_0097995_75_728 217
319 3300047471 Ga0495684_0014963 Ga0495684_0014963_3607_4260 217
320 3300048090 Ga0495615_0000471 Ga0495615_0000471_1846_2499 217
321 3300048905 Ga0496102_0023127 Ga0496102_0023127_2218_2898 217
322 3300048907 Ga0496104_0000211 Ga0496104_0000211_20303_20956 217
323 3300048907 Ga0496104_0363037 Ga0496104_0363037_453_1106 217
324 3300048909 Ga0496106_0003154 Ga0496106_0003154_1748_2401 217
325 3300048909 Ga0496106_0006774 Ga0496106_0006774_1503_2183 217
326 3300048910 Ga0496107_0017896 Ga0496107_0017896_1909_2697 217
327 3300048911 Ga0496108_0002580 Ga0496108_0002580_7664_8344 217
328 3300048912 Ga0496109_0000691 Ga0496109_0000691_20244_20924 217
329 3300048913 Ga0496110_0045321 Ga0496110_0045321_507_1187 217
330 3300048913 Ga0496110_0127415 Ga0496110_0127415_1017_1670 217
331 3300048914 Ga0496111_0006672 Ga0496111_0006672_304_984 217
332 3300048915 Ga0496112_0011599 Ga0496112_0011599_4608_5288 217
333 3300048915 Ga0496112_0119632 Ga0496112_0119632_1934_2587 217
334 3300048918 Ga0496115_0004171 Ga0496115_0004171_6599_7282 217
335 3300048918 Ga0496115_0126270 Ga0496115_0126270_858_1511 217
336 3300048919 Ga0496116_0125659 Ga0496116_0125659_737_1390 217
337 3300048920 Ga0496117_0036888 Ga0496117_0036888_1404_2057 217
338 3300048921 Ga0496118_0001892 Ga0496118_0001892_24984_25637 217
339 3300048924 Ga0496121_0000041 Ga0496121_0000041_239830_240483 217
340 3300048924 Ga0496121_0026324 Ga0496121_0026324_828_1481 217
341 3300048928 Ga0496125_0028941 Ga0496125_0028941_1687_2340 217
342 3300048928 Ga0496125_0072946 Ga0496125_0072946_20_673 217
343 3300048929 Ga0496126_0002010 Ga0496126_0002010_21926_22579 217
344 3300048929 Ga0496126_0009183 Ga0496126_0009183_9244_9897 217
345 3300048929 Ga0496126_0094631 Ga0496126_0094631_1938_2591 217
346 3300048929 Ga0496126_0779604 Ga0496126_0779604_19_672 217
347 3300049460 Ga0495682_0142627 Ga0495682_0142627_102_755 217
348 3300049583 Ga0501067_0079420 Ga0501067_0079420_229_882 217
349 3300049591 Ga0501075_0392662 Ga0501075_0392662_34_693 217
350 3300050490 nmdc:mga03n38_33697_c1 nmdc:mga03n38_33697_c1_835_1488 217
351 3300050492 nmdc:mga0yw44_173074_c1 nmdc:mga0yw44_173074_c1_222_875 217
352 3300050492 nmdc:mga0yw44_2973_c1 nmdc:mga0yw44_2973_c1_5838_6491 217
353 3300050494 nmdc:mga06z11_253953_c1 nmdc:mga06z11_253953_c1_325_978 217
354 3300050495 nmdc:mga04h51_20493_c1 nmdc:mga04h51_20493_c1_1309_1962 217
355 3300050496 nmdc:mga07m45_210745_c1 nmdc:mga07m45_210745_c1_437_1090 217
356 3300050508 nmdc:mga09592_373059_c1 nmdc:mga09592_373059_c1_261_914 217
357 3300050511 nmdc:mga08y16_72590_c1 nmdc:mga08y16_72590_c1_270_923 217
358 3300050512 nmdc:mga0n895_125340_c1 nmdc:mga0n895_125340_c1_208_861 217
359 3300050516 nmdc:mga0sz30_212942_c1 nmdc:mga0sz30_212942_c1_135_788 217
360 3300053077 Ga0495601_0052878 Ga0495601_0052878_953_1606 217
361 3300053094 Ga0500566_0013148 Ga0500566_0013148_3083_3736 217
362 3300053098 Ga0500650_0096686 Ga0500650_0096686_200_853 217
363 3300053110 Ga0500571_212211 Ga0500571_212211_15_668 217
364 3300053111 Ga0500572_002012 Ga0500572_002012_3076_3729 217
365 3300053139 Ga0500568_0155776 Ga0500568_0155776_44_697 217
366 3300053147 Ga0500589_181075 Ga0500589_181075_161_814 217
367 3300053153 Ga0500616_0009427 Ga0500616_0009427_1049_1702 217
368 3300053153 Ga0500616_0078672 Ga0500616_0078672_379_1032 217
369 3300053156 Ga0500622_0000136 Ga0500622_0000136_54863_55516 217
370 3300053158 Ga0500627_0000942 Ga0500627_0000942_5104_5757 217
371 3300053158 Ga0500627_0103043 Ga0500627_0103043_537_1190 217
372 3300053727 Ga0500611_075238 Ga0500611_075238_137_790 217
373 3300053732 Ga0500656_019893 Ga0500656_019893_148_801 217
374 iso_pu_bacteria 8003014200 8003015593 217
375 3300002774 JGI25150J39212_1001570 JGI25150J39212_10015705 218
376 3300003320 rootH2_10107503 rootH2_101075035 218
377 3300003322 rootL2_10016419 rootL2_100164194 218
378 3300003792 Ga0055540_1005659 Ga0055540_10056594 218
379 3300005353 Ga0070669_100478772 Ga0070669_1004787722 218
380 3300005367 Ga0070667_100024710 Ga0070667_1000247101 218
381 3300005843 Ga0068860_100050163 Ga0068860_1000501633 218
382 3300006038 Ga0075365_10087961 Ga0075365_100879612 218
383 3300006048 Ga0075363_100012758 Ga0075363_1000127583 218
384 3300006178 Ga0075367_10048991 Ga0075367_100489913 218
385 3300009553 Ga0105249_10270143 Ga0105249_102701432 218
386 3300013100 Ga0157373_10256686 Ga0157373_102566862 218
387 3300020081 Ga0206354_10537741 Ga0206354_105377412 218
388 3300025245 Ga0207425_1001146 Ga0207425_100114612 218
389 3300025245 Ga0207425_1038028 Ga0207425_10380281 218
390 3300025258 Ga0209129_1001654 Ga0209129_100165417 218
391 3300025258 Ga0209129_1002673 Ga0209129_10026739 218
392 3300025284 Ga0209130_1004838 Ga0209130_10048381 218
393 3300025294 Ga0209025_1001496 Ga0209025_100149635 218
394 3300025297 Ga0209758_1001356 Ga0209758_100135636 218
395 3300025297 Ga0209758_1001818 Ga0209758_100181816 218
396 3300025302 Ga0207426_1005863 Ga0207426_10058636 218
397 3300025303 Ga0209051_1008136 Ga0209051_10081364 218
398 3300025919 Ga0207657_10004196 Ga0207657_100041969 218
399 3300026121 Ga0207683_10996434 Ga0207683_109964342 218
400 3300027512 Ga0209179_1025590 Ga0209179_10255902 218
401 3300031730 Ga0307516_10254475 Ga0307516_102544752 218
402 3300031911 Ga0307412_10005374 Ga0307412_100053746 218
403 3300033180 Ga0307510_10022868 Ga0307510_100228682 218
404 3300041410 Ga0439461_0052854 Ga0439461_0052854_65_721 218
405 3300046516 Ga0495628_0501759 Ga0495628_0501759_108_767 218
406 3300047319 Ga0495674_0622354 Ga0495674_0622354_25_684 218
407 3300047472 Ga0495686_0251233 Ga0495686_0251233_60_716 218
408 3300048088 Ga0495602_0042279 Ga0495602_0042279_3144_3803 218
409 3300048925 Ga0496122_0043226 Ga0496122_0043226_2295_2951 218
410 3300050490 nmdc:mga03n38_35026_c1 nmdc:mga03n38_35026_c1_269_925 218
411 3300050492 nmdc:mga0yw44_25508_c1 nmdc:mga0yw44_25508_c1_1046_1702 218
412 3300050494 nmdc:mga06z11_20013_c2 nmdc:mga06z11_20013_c2_1249_1905 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

67

131

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

60

126

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

67

127

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9862 2 211
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9801 1 212
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9787 1 212
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9706 1 212
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9679 2 211
ID Description Score Start End Superfamily
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9928 2 87 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9921 2 87 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9808 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9798 2 87 3.40.30.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.971 88 203 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A527A1T9-F1-model_v4 Glutathione S-transferase 1.001 1 78 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9999 1 107 GO:0016740
AF-A0A086P651-F1-model_v4 Glutathione S-transferase 0.9969 1 109 GO:0016740
AF-A0A1L3LKN7-F1-model_v4 Glutathione S-transferase I (EC 2.5.1.18) 0.9968 1 209 GO:0004364
AF-A0A5C5CUV7-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9952 2 214 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map