F437701

General Info

Members Datasets Scaffolds Average Seq Length
412 193 824 115

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10096324|rootL2_100963242
Length 128
Sequence LHCDREGEAKYMALASRIMIACGVLIVLNGCGAPPTNKQSAPTPSGPAAAVQTNTYHGAGVVKAVFTNPKAPAIEIDHGDIDGLMPAMQMEFPVTDPNLLKGVAVNDQIDFTIEAAAGQMKVSAIKKK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
162 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
165 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
166 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
167 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
168 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
169 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
170 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
181 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
182 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
183 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
184 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.4
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 40.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10096324 3300003322 Bacteria 1316
2 CNBas_1001205 3300000531 Bacteria 1331
3 CNAas_1000643 3300000532 Bacteria 3364
4 JGI25406J46586_10046397 3300003203 Unclassified 1489
5 rootH2_10000422 3300003320 Bacteria 2662
6 Ga0065704_10003201 3300005289 Bacteria 7580
7 Ga0065712_10000591 3300005290 Bacteria 13026
8 Ga0065715_10152306 3300005293 Unclassified 1694
9 Ga0065715_10176294 3300005293 Bacteria 1509
10 Ga0065707_10010285 3300005295 Bacteria 2570
11 Ga0065707_10496452 3300005295 Unclassified 758
12 Ga0070676_10364865 3300005328 Bacteria 996
13 Ga0070690_100184235 3300005330 Unclassified 1444
14 Ga0070670_100000331 3300005331 Bacteria 39667
15 Ga0070670_100164572 3300005331 Unclassified 1923
16 Ga0070670_100198157 3300005331 Bacteria 1744
17 Ga0070670_101523891 3300005331 Unclassified 614
18 Ga0068869_100300087 3300005334 Unclassified 1297
19 Ga0068869_100676675 3300005334 Unclassified 878
20 Ga0068869_101932570 3300005334 Bacteria 529
21 Ga0070680_100581099 3300005336 Bacteria 961
22 Ga0070680_100781401 3300005336 Bacteria 823
23 Ga0070689_100000147 3300005340 Bacteria 40915
24 Ga0070689_100566159 3300005340 Bacteria 980
25 Ga0070661_100448002 3300005344 Unclassified 1027
26 Ga0070661_100713412 3300005344 Bacteria 818
27 Ga0070661_101063126 3300005344 Bacteria 673
28 Ga0070692_10422646 3300005345 Unclassified 847
29 Ga0070692_10452787 3300005345 Bacteria 822
30 Ga0070669_100023839 3300005353 Bacteria 4385
31 Ga0070675_100984631 3300005354 Bacteria 774
32 Ga0070675_101223659 3300005354 Bacteria 691
33 Ga0070671_101215198 3300005355 Unclassified 664
34 Ga0070673_100432977 3300005364 Unclassified 1181
35 Ga0070673_101289788 3300005364 Unclassified 686
36 Ga0070673_101291897 3300005364 Bacteria 685
37 Ga0070673_101606576 3300005364 Unclassified 614
38 Ga0070673_102001338 3300005364 Bacteria 550
39 Ga0070659_100001121 3300005366 Bacteria 19545
40 Ga0070659_101726204 3300005366 Unclassified 560
41 Ga0070667_101824012 3300005367 Bacteria 572
42 Ga0070703_10040687 3300005406 Unclassified 1446
43 Ga0070709_10386810 3300005434 Unclassified 1041
44 Ga0070701_10043787 3300005438 Unclassified 2292
45 Ga0070705_100011933 3300005440 Bacteria 4401
46 Ga0070705_100269212 3300005440 Bacteria 1206
47 Ga0070705_100284653 3300005440 Bacteria 1177
48 Ga0070705_100364529 3300005440 Bacteria 1058
49 Ga0070705_101329242 3300005440 Unclassified 597
50 Ga0070700_100879551 3300005441 Bacteria 728
51 Ga0070694_100013533 3300005444 Bacteria 5096
52 Ga0070694_100061716 3300005444 Bacteria 2559
53 Ga0070694_100279493 3300005444 Bacteria 1272
54 Ga0070694_100634029 3300005444 Unclassified 864
55 Ga0070694_100948370 3300005444 Bacteria 712
56 Ga0070708_100163693 3300005445 Bacteria 2074
57 Ga0070708_101028821 3300005445 Unclassified 772
58 Ga0070681_10006445 3300005458 Bacteria 11423
59 Ga0070681_10182816 3300005458 Unclassified 2018
60 Ga0070681_10417750 3300005458 Unclassified 1253
61 Ga0070681_10990740 3300005458 Unclassified 760
62 Ga0070681_11768861 3300005458 Bacteria 545
63 Ga0068867_100149615 3300005459 Unclassified 1832
64 Ga0068867_101000915 3300005459 Unclassified 758
65 Ga0070706_100000661 3300005467 Bacteria 39338
66 Ga0070706_100277977 3300005467 Bacteria 1562
67 Ga0070699_100096160 3300005518 Bacteria 2594
68 Ga0070679_100046977 3300005530 Unclassified 4304
69 Ga0070679_100594607 3300005530 Bacteria 1050
70 Ga0070679_101948862 3300005530 Unclassified 536
71 Ga0070684_100173255 3300005535 Bacteria 1960
72 Ga0070697_101106639 3300005536 Unclassified 705
73 Ga0068853_100007439 3300005539 Bacteria 8763
74 Ga0068853_100071193 3300005539 Bacteria 3027
75 Ga0068853_100774317 3300005539 Bacteria 918
76 Ga0070695_100014223 3300005545 Bacteria 4796
77 Ga0070695_100016319 3300005545 Bacteria 4493
78 Ga0070695_101587285 3300005545 Unclassified 546
79 Ga0070696_100924551 3300005546 Bacteria 725
80 Ga0070696_101382685 3300005546 Unclassified 600
81 Ga0070693_100025727 3300005547 Bacteria 3169
82 Ga0070693_100033999 3300005547 Bacteria 2818
83 Ga0070693_100169574 3300005547 Bacteria 1397
84 Ga0070693_100170601 3300005547 Unclassified 1393
85 Ga0070704_100115645 3300005549 Unclassified 2050
86 Ga0070704_100405843 3300005549 Bacteria 1164
87 Ga0070704_100582924 3300005549 Bacteria 981
88 Ga0068855_100173275 3300005563 Unclassified 2443
89 Ga0068855_100947853 3300005563 Bacteria 907
90 Ga0070664_100000728 3300005564 Bacteria 25309
91 Ga0070664_101464169 3300005564 Unclassified 646
92 Ga0070664_101473154 3300005564 Unclassified 644
93 Ga0068857_100005650 3300005577 Bacteria 10694
94 Ga0068857_100186872 3300005577 Unclassified 1887
95 Ga0068857_100333266 3300005577 Bacteria 1403
96 Ga0068857_100379985 3300005577 Unclassified 1311
97 Ga0068857_100388549 3300005577 Unclassified 1297
98 Ga0068857_100726743 3300005577 Bacteria 945
99 Ga0068857_101885074 3300005577 Unclassified 586
100 Ga0068854_100139350 3300005578 Bacteria 1860
101 Ga0070702_100245132 3300005615 Unclassified 1211
102 Ga0070702_100297999 3300005615 Bacteria 1114
103 Ga0068852_100147062 3300005616 Unclassified 2187
104 Ga0068859_100075533 3300005617 Bacteria 3410
105 Ga0068859_100172796 3300005617 Unclassified 2242
106 Ga0068859_100202399 3300005617 Bacteria 2070
107 Ga0068859_100312449 3300005617 Bacteria 1665
108 Ga0068859_100440326 3300005617 Unclassified 1399
109 Ga0068859_101088719 3300005617 Unclassified 879
110 Ga0068859_101740249 3300005617 Unclassified 689
111 Ga0068864_100007629 3300005618 Bacteria 8910
112 Ga0068864_100009435 3300005618 Bacteria 8052
113 Ga0068864_100023582 3300005618 Bacteria 5169
114 Ga0068864_100429649 3300005618 Unclassified 1260
115 Ga0068864_100638227 3300005618 Bacteria 1036
116 Ga0068864_101648860 3300005618 Bacteria 646
117 Ga0068861_100285532 3300005719 Unclassified 1423
118 Ga0068861_100293488 3300005719 Bacteria 1405
119 Ga0068861_100811170 3300005719 Unclassified 879
120 Ga0068851_10395464 3300005834 Bacteria 812
121 Ga0068851_10713536 3300005834 Bacteria 618
122 Ga0068863_100086209 3300005841 Bacteria 2975
123 Ga0068863_101580959 3300005841 Bacteria 665
124 Ga0068863_101784871 3300005841 Bacteria 625
125 Ga0068858_100147313 3300005842 Bacteria 2211
126 Ga0068858_100178425 3300005842 Bacteria 2005
127 Ga0068858_101636622 3300005842 Bacteria 635
128 Ga0068860_100008464 3300005843 Bacteria 10250
129 Ga0068860_100065761 3300005843 Unclassified 3443
130 Ga0068860_100108081 3300005843 Bacteria 2658
131 Ga0068860_100156255 3300005843 Bacteria 2198
132 Ga0068860_100498167 3300005843 Bacteria 1216
133 Ga0068860_100516796 3300005843 Bacteria 1194
134 Ga0068860_101139706 3300005843 Unclassified 800
135 Ga0068862_100434406 3300005844 Bacteria 1235
136 Ga0068862_100641177 3300005844 Bacteria 1024
137 Ga0068862_100918323 3300005844 Bacteria 861
138 Ga0068862_102162549 3300005844 Unclassified 568
139 Ga0081539_10001231 3300005985 Bacteria 45721
140 Ga0081539_10001477 3300005985 Bacteria 39895
141 Ga0070715_10436035 3300006163 Unclassified 736
142 Ga0070716_100054996 3300006173 Bacteria 2276
143 Ga0097621_100175468 3300006237 Bacteria 1850
144 Ga0068871_100231804 3300006358 Bacteria 1603
145 Ga0068871_101158419 3300006358 Bacteria 724
146 Ga0075430_100076657 3300006846 Bacteria 2802
147 Ga0075430_100652341 3300006846 Unclassified 868
148 Ga0075433_10890129 3300006852 Unclassified 777
149 Ga0075433_10945851 3300006852 Bacteria 751
150 Ga0075434_100509871 3300006871 Bacteria 1223
151 Ga0075434_101330608 3300006871 Unclassified 729
152 Ga0075429_100248922 3300006880 Bacteria 1556
153 Ga0068865_101155015 3300006881 Unclassified 684
154 Ga0097620_100075533 3300006931 Bacteria 3410
155 Ga0097620_100172782 3300006931 Unclassified 2242
156 Ga0097620_100202424 3300006931 Bacteria 2070
157 Ga0097620_100312454 3300006931 Bacteria 1665
158 Ga0097620_100440357 3300006931 Unclassified 1399
159 Ga0097620_100960627 3300006931 Unclassified 937
160 Ga0097620_101088701 3300006931 Unclassified 879
161 Ga0097620_101740204 3300006931 Unclassified 689
162 Ga0105251_10643312 3300009011 Unclassified 506
163 Ga0105250_10390305 3300009092 Unclassified 616
164 Ga0105240_10663437 3300009093 Bacteria 1142
165 Ga0105240_11083234 3300009093 Unclassified 853
166 Ga0111539_10007086 3300009094 Bacteria 14369
167 Ga0111539_10797453 3300009094 Unclassified 1099
168 Ga0105245_12723555 3300009098 Bacteria 547
169 Ga0105247_10000669 3300009101 Bacteria 27007
170 Ga0105247_10195150 3300009101 Unclassified 1357
171 Ga0105247_11662930 3300009101 Bacteria 526
172 Ga0114129_10528985 3300009147 Bacteria 1536
173 Ga0105243_10214367 3300009148 Unclassified 1697
174 Ga0105243_10822574 3300009148 Unclassified 917
175 Ga0105243_11050228 3300009148 Bacteria 820
176 Ga0105243_11380179 3300009148 Unclassified 724
177 Ga0105243_11651969 3300009148 Unclassified 668
178 Ga0105241_10006550 3300009174 Bacteria 8584
179 Ga0105241_10048787 3300009174 Bacteria 3223
180 Ga0105241_10105964 3300009174 Unclassified 2243
181 Ga0105241_11655973 3300009174 Unclassified 620
182 Ga0105241_12352943 3300009174 Bacteria 531
183 Ga0105242_10408255 3300009176 Unclassified 1269
184 Ga0105242_10729544 3300009176 Unclassified 973
185 Ga0105248_10310905 3300009177 Bacteria 1775
186 Ga0105248_10672883 3300009177 Unclassified 1168
187 Ga0105248_10848063 3300009177 Unclassified 1031
188 Ga0105248_10848779 3300009177 Bacteria 1031
189 Ga0105248_11100397 3300009177 Bacteria 898
190 Ga0105248_11108003 3300009177 Bacteria 895
191 Ga0105248_11350698 3300009177 Unclassified 806
192 Ga0105248_11819324 3300009177 Bacteria 691
193 Ga0105237_11062933 3300009545 Unclassified 816
194 Ga0105237_11133660 3300009545 Unclassified 789
195 Ga0105237_11378503 3300009545 Bacteria 711
196 Ga0105238_10007482 3300009551 Bacteria 10943
197 Ga0105238_10699388 3300009551 Unclassified 1026
198 Ga0105249_10025884 3300009553 Bacteria 5285
199 Ga0105249_12009849 3300009553 Bacteria 651
200 Ga0105246_11599041 3300011119 Unclassified 616
201 Ga0105246_12415558 3300011119 Unclassified 516
202 Ga0157373_10002615 3300013100 Bacteria 13674
203 Ga0157373_10052957 3300013100 Unclassified 2886
204 Ga0157373_10170413 3300013100 Unclassified 1532
205 Ga0157373_10774263 3300013100 Unclassified 706
206 Ga0157373_11302144 3300013100 Unclassified 550
207 Ga0157378_10347285 3300013297 Bacteria 1448
208 Ga0157378_10980516 3300013297 Unclassified 879
209 Ga0163162_13057518 3300013306 Unclassified 537
210 Ga0157372_10482638 3300013307 Bacteria 1445
211 Ga0157372_10933082 3300013307 Bacteria 1006
212 Ga0157372_11333092 3300013307 Bacteria 828
213 Ga0157372_11699436 3300013307 Bacteria 726
214 Ga0157372_13089426 3300013307 Unclassified 532
215 Ga0157375_10705453 3300013308 Bacteria 1162
216 Ga0157375_11006458 3300013308 Unclassified 973
217 Ga0157375_12234056 3300013308 Bacteria 652
218 Ga0163163_10007227 3300014325 Bacteria 9786
219 Ga0163163_10016111 3300014325 Bacteria 6935
220 Ga0163163_10289493 3300014325 Unclassified 1690
221 Ga0163163_10291172 3300014325 Bacteria 1685
222 Ga0163163_10327874 3300014325 Bacteria 1585
223 Ga0163163_11869604 3300014325 Bacteria 660
224 Ga0157380_10696822 3300014326 Bacteria 1020
225 Ga0157380_11400339 3300014326 Bacteria 750
226 Ga0157380_11929706 3300014326 Bacteria 651
227 Ga0157377_10630585 3300014745 Bacteria 769
228 Ga0157377_11342586 3300014745 Unclassified 561
229 Ga0157377_11400965 3300014745 Unclassified 551
230 Ga0157379_10146050 3300014968 Bacteria 2133
231 Ga0157379_10450821 3300014968 Unclassified 1188
232 Ga0157379_12259096 3300014968 Bacteria 541
233 Ga0163161_10499140 3300017792 Bacteria 991
234 Ga0207710_10000436 3300025900 Bacteria 27277
235 Ga0207710_10434327 3300025900 Bacteria 677
236 Ga0207688_10197758 3300025901 Bacteria 1204
237 Ga0207647_10007153 3300025904 Bacteria 8093
238 Ga0207699_10428348 3300025906 Bacteria 946
239 Ga0207643_10002503 3300025908 Bacteria 9929
240 Ga0207643_10357148 3300025908 Unclassified 918
241 Ga0207684_10148168 3300025910 Bacteria 2019
242 Ga0207654_10005042 3300025911 Bacteria 6667
243 Ga0207654_10654638 3300025911 Unclassified 753
244 Ga0207654_11346728 3300025911 Unclassified 520
245 Ga0207707_10142556 3300025912 Bacteria 2095
246 Ga0207707_10223951 3300025912 Bacteria 1637
247 Ga0207695_10281064 3300025913 Bacteria 1558
248 Ga0207671_10604562 3300025914 Bacteria 874
249 Ga0207671_11152127 3300025914 Unclassified 608
250 Ga0207660_11112261 3300025917 Bacteria 644
251 Ga0207662_10392110 3300025918 Unclassified 940
252 Ga0207657_10128943 3300025919 Bacteria 2075
253 Ga0207649_10159670 3300025920 Bacteria 1561
254 Ga0207649_11108831 3300025920 Bacteria 624
255 Ga0207652_10182640 3300025921 Unclassified 1885
256 Ga0207681_10011530 3300025923 Bacteria 5431
257 Ga0207694_10001929 3300025924 Bacteria 17169
258 Ga0207694_10803739 3300025924 Unclassified 794
259 Ga0207650_10000011 3300025925 Bacteria 450115
260 Ga0207650_10029953 3300025925 Unclassified 3916
261 Ga0207650_10240993 3300025925 Unclassified 1461
262 Ga0207650_10683326 3300025925 Unclassified 866
263 Ga0207659_10295589 3300025926 Bacteria 1328
264 Ga0207659_11049212 3300025926 Bacteria 701
265 Ga0207687_11407083 3300025927 Bacteria 599
266 Ga0207687_11490252 3300025927 Bacteria 581
267 Ga0207644_10270806 3300025931 Unclassified 1361
268 Ga0207690_10082442 3300025932 Bacteria 2249
269 Ga0207690_10981990 3300025932 Bacteria 702
270 Ga0207706_11411752 3300025933 Unclassified 571
271 Ga0207686_10264660 3300025934 Bacteria 1262
272 Ga0207686_10692806 3300025934 Unclassified 809
273 Ga0207709_10230751 3300025935 Bacteria 1341
274 Ga0207670_10004214 3300025936 Bacteria 7712
275 Ga0207704_10380303 3300025938 Bacteria 1108
276 Ga0207665_10142489 3300025939 Bacteria 1711
277 Ga0207665_10184405 3300025939 Bacteria 1513
278 Ga0207691_10306572 3300025940 Bacteria 1363
279 Ga0207691_11284288 3300025940 Bacteria 605
280 Ga0207711_10243841 3300025941 Bacteria 1648
281 Ga0207711_10331492 3300025941 Bacteria 1407
282 Ga0207689_10348894 3300025942 Unclassified 1230
283 Ga0207689_10551741 3300025942 Unclassified 968
284 Ga0207689_10858060 3300025942 Unclassified 766
285 Ga0207679_10038692 3300025945 Bacteria 3400
286 Ga0207679_10496162 3300025945 Bacteria 1089
287 Ga0207679_10780519 3300025945 Bacteria 870
288 Ga0207679_11914897 3300025945 Unclassified 541
289 Ga0207667_10762681 3300025949 Unclassified 966
290 Ga0207667_11120991 3300025949 Bacteria 769
291 Ga0207651_10087127 3300025960 Bacteria 2272
292 Ga0207651_10596814 3300025960 Unclassified 965
293 Ga0207651_11198684 3300025960 Bacteria 682
294 Ga0207640_10855397 3300025981 Unclassified 792
295 Ga0207703_10045258 3300026035 Unclassified 3540
296 Ga0207703_10142186 3300026035 Bacteria 2084
297 Ga0207703_10181600 3300026035 Bacteria 1857
298 Ga0207703_10349113 3300026035 Bacteria 1361
299 Ga0207703_10683508 3300026035 Bacteria 975
300 Ga0207703_10832920 3300026035 Bacteria 882
301 Ga0207703_11321642 3300026035 Bacteria 693
302 Ga0207703_11465377 3300026035 Bacteria 657
303 Ga0207639_10050519 3300026041 Bacteria 3158
304 Ga0207639_10210475 3300026041 Bacteria 1673
305 Ga0207639_10269708 3300026041 Bacteria 1492
306 Ga0207639_11590631 3300026041 Unclassified 613
307 Ga0207708_10048663 3300026075 Bacteria 3228
308 Ga0207708_10369193 3300026075 Unclassified 1181
309 Ga0207708_10784311 3300026075 Bacteria 819
310 Ga0207641_10124888 3300026088 Bacteria 2303
311 Ga0207641_10163934 3300026088 Bacteria 2023
312 Ga0207641_10170767 3300026088 Bacteria 1984
313 Ga0207641_10481522 3300026088 Bacteria 1203
314 Ga0207648_10131638 3300026089 Unclassified 2202
315 Ga0207648_10445781 3300026089 Bacteria 1178
316 Ga0207648_10715709 3300026089 Bacteria 928
317 Ga0207648_10824494 3300026089 Unclassified 864
318 Ga0207676_10036141 3300026095 Unclassified 3756
319 Ga0207676_10226481 3300026095 Bacteria 1668
320 Ga0207676_10243055 3300026095 Unclassified 1616
321 Ga0207676_10302657 3300026095 Bacteria 1460
322 Ga0207676_10681902 3300026095 Unclassified 994
323 Ga0207676_10768577 3300026095 Bacteria 938
324 Ga0207674_10000169 3300026116 Bacteria 78781
325 Ga0207674_10033190 3300026116 Bacteria 5405
326 Ga0207674_10057907 3300026116 Unclassified 3928
327 Ga0207674_10224937 3300026116 Unclassified 1825
328 Ga0207674_11147846 3300026116 Unclassified 746
329 Ga0207675_100013723 3300026118 Bacteria 7558
330 Ga0207675_100072027 3300026118 Bacteria 3231
331 Ga0207675_100097202 3300026118 Bacteria 2773
332 Ga0207428_10007390 3300027907 Bacteria 10019
333 Ga0268265_10788387 3300028380 Bacteria 925
334 Ga0268265_11906296 3300028380 Bacteria 601
335 Ga0268264_10065926 3300028381 Unclassified 3052
336 Ga0268264_10247871 3300028381 Bacteria 1653
337 Ga0307406_10098241 3300031901 Bacteria 1988
338 Ga0307414_10159948 3300032004 Unclassified 1788
339 Ga0373940_0125139 3300035088 Unclassified 801
340 Ga0373951_0001430 3300035091 Bacteria 6261
341 Ga0373951_0048144 3300035091 Unclassified 1043
342 Ga0373952_0145228 3300035092 Unclassified 662
343 Ga0373931_0875819 3300035691 Unclassified 602
344 Ga0395899_0737095 3300037312 Bacteria 615
345 Ga0395898_1094528 3300037466 Unclassified 730
346 Ga0395901_0535646 3300038443 Unclassified 1188
347 Ga0395901_1483703 3300038443 Bacteria 634
348 Ga0242422_00592 3300038699 Bacteria 2356
349 Ga0242422_10808 3300038699 Bacteria 527
350 Ga0242420_004987 3300038996 Bacteria 2034
351 Ga0242420_060869 3300038996 Bacteria 753
352 Ga0439458_0002321 3300042157 Bacteria 4664
353 Ga0451576_0410065 3300045051 Unclassified 1421
354 Ga0451576_2617129 3300045051 Unclassified 514
355 Ga0496102_0607524 3300048905 Unclassified 1017
356 Ga0496102_1057595 3300048905 Bacteria 732
357 Ga0496103_0092162 3300048906 Unclassified 1913
358 Ga0496104_0244804 3300048907 Bacteria 1706
359 Ga0496104_0777446 3300048907 Bacteria 864
360 Ga0496106_0024322 3300048909 Bacteria 4502
361 Ga0496107_0233447 3300048910 Unclassified 1369
362 Ga0496109_0392268 3300048912 Bacteria 1312
363 Ga0496109_1012765 3300048912 Bacteria 768
364 Ga0496111_0651116 3300048914 Bacteria 769
365 Ga0496112_0053596 3300048915 Bacteria 3962
366 Ga0496112_0648607 3300048915 Unclassified 985
367 Ga0496112_1011141 3300048915 Bacteria 751
368 Ga0496113_1351463 3300048916 Bacteria 553
369 Ga0501295_068318 3300049518 Unclassified 790
370 Ga0501296_017687 3300049519 Unclassified 893
371 Ga0501298_009951 3300049521 Unclassified 1626
372 Ga0501299_012290 3300049522 Unclassified 1458
373 Ga0501300_044420 3300049523 Unclassified 675
374 Ga0501303_002655 3300049526 Unclassified 1393
375 Ga0501201_010492 3300049651 Unclassified 907
376 Ga0501207_002098 3300049654 Bacteria 2547
377 Ga0501216_019198 3300049660 Unclassified 1183
378 Ga0501216_034002 3300049660 Unclassified 953
379 Ga0501217_035966 3300049661 Bacteria 1241
380 Ga0501223_112680 3300049663 Unclassified 569
381 Ga0501227_001574 3300049665 Bacteria 5084
382 Ga0501227_121100 3300049665 Unclassified 707
383 Ga0501227_147146 3300049665 Unclassified 649
384 Ga0501230_094111 3300049667 Unclassified 640
385 Ga0501233_003635 3300049668 Bacteria 2782
386 Ga0501233_160546 3300049668 Unclassified 632
387 Ga0501233_203602 3300049668 Unclassified 577
388 Ga0501240_001826 3300049673 Unclassified 2150
389 Ga0501243_023748 3300049675 Unclassified 1021
390 Ga0501259_003763 3300049688 Unclassified 2411
391 Ga0501221_049206 3300049704 Unclassified 945
392 Ga0501225_0002220 3300049705 Bacteria 6003
393 Ga0501225_0030132 3300049705 Unclassified 1492
394 Ga0501225_0040877 3300049705 Unclassified 1278
395 Ga0501234_015802 3300049707 Bacteria 1189
396 Ga0501266_036469 3300049763 Unclassified 718
397 Ga0501272_014191 3300049769 Unclassified 918
398 Ga0501283_001531 3300049779 Bacteria 2998
399 Ga0501212_063925 3300049851 Bacteria 641
400 nmdc:mga05p37_1776047_c1 3300050507 Unclassified 597
401 nmdc:mga09592_445538_c1 3300050508 Unclassified 1117
402 nmdc:mga0qj67_413016_c1 3300050509 Bacteria 1089
403 nmdc:mga06r32_1230864_c1 3300050510 Unclassified 694
404 nmdc:mga08y16_629890_c1 3300050511 Bacteria 1079
405 nmdc:mga08y16_797478_c1 3300050511 Unclassified 937
406 nmdc:mga0n895_75037_c1 3300050512 Bacteria 3361
407 nmdc:mga0n895_81536_c1 3300050512 Bacteria 3224
408 nmdc:mga08x19_680040_c1 3300050514 Bacteria 730
409 nmdc:mga0a205_5297_c1 3300050515 Bacteria 11610
410 nmdc:mga0a205_90307_c1 3300050515 Bacteria 2960
411 nmdc:mga0a205_955248_c1 3300050515 Unclassified 704
412 Ga0501084_0113598 3300054114 Bacteria 2277
413 rootL2_10096324
414 CNBas_1001205
415 CNAas_1000643
416 JGI25406J46586_10046397
417 rootH2_10000422
418 Ga0065704_10003201
419 Ga0065712_10000591
420 Ga0065715_10152306
421 Ga0065715_10176294
422 Ga0065707_10010285
423 Ga0065707_10496452
424 Ga0070676_10364865
425 Ga0070690_100184235
426 Ga0070670_100000331
427 Ga0070670_100164572
428 Ga0070670_100198157
429 Ga0070670_101523891
430 Ga0068869_100300087
431 Ga0068869_100676675
432 Ga0068869_101932570
433 Ga0070680_100581099
434 Ga0070680_100781401
435 Ga0070689_100000147
436 Ga0070689_100566159
437 Ga0070661_100448002
438 Ga0070661_100713412
439 Ga0070661_101063126
440 Ga0070692_10422646
441 Ga0070692_10452787
442 Ga0070669_100023839
443 Ga0070675_100984631
444 Ga0070675_101223659
445 Ga0070671_101215198
446 Ga0070673_100432977
447 Ga0070673_101289788
448 Ga0070673_101291897
449 Ga0070673_101606576
450 Ga0070673_102001338
451 Ga0070659_100001121
452 Ga0070659_101726204
453 Ga0070667_101824012
454 Ga0070703_10040687
455 Ga0070709_10386810
456 Ga0070701_10043787
457 Ga0070705_100011933
458 Ga0070705_100269212
459 Ga0070705_100284653
460 Ga0070705_100364529
461 Ga0070705_101329242
462 Ga0070700_100879551
463 Ga0070694_100013533
464 Ga0070694_100061716
465 Ga0070694_100279493
466 Ga0070694_100634029
467 Ga0070694_100948370
468 Ga0070708_100163693
469 Ga0070708_101028821
470 Ga0070681_10006445
471 Ga0070681_10182816
472 Ga0070681_10417750
473 Ga0070681_10990740
474 Ga0070681_11768861
475 Ga0068867_100149615
476 Ga0068867_101000915
477 Ga0070706_100000661
478 Ga0070706_100277977
479 Ga0070699_100096160
480 Ga0070679_100046977
481 Ga0070679_100594607
482 Ga0070679_101948862
483 Ga0070684_100173255
484 Ga0070697_101106639
485 Ga0068853_100007439
486 Ga0068853_100071193
487 Ga0068853_100774317
488 Ga0070695_100014223
489 Ga0070695_100016319
490 Ga0070695_101587285
491 Ga0070696_100924551
492 Ga0070696_101382685
493 Ga0070693_100025727
494 Ga0070693_100033999
495 Ga0070693_100169574
496 Ga0070693_100170601
497 Ga0070704_100115645
498 Ga0070704_100405843
499 Ga0070704_100582924
500 Ga0068855_100173275
501 Ga0068855_100947853
502 Ga0070664_100000728
503 Ga0070664_101464169
504 Ga0070664_101473154
505 Ga0068857_100005650
506 Ga0068857_100186872
507 Ga0068857_100333266
508 Ga0068857_100379985
509 Ga0068857_100388549
510 Ga0068857_100726743
511 Ga0068857_101885074
512 Ga0068854_100139350
513 Ga0070702_100245132
514 Ga0070702_100297999
515 Ga0068852_100147062
516 Ga0068859_100075533
517 Ga0068859_100172796
518 Ga0068859_100202399
519 Ga0068859_100312449
520 Ga0068859_100440326
521 Ga0068859_101088719
522 Ga0068859_101740249
523 Ga0068864_100007629
524 Ga0068864_100009435
525 Ga0068864_100023582
526 Ga0068864_100429649
527 Ga0068864_100638227
528 Ga0068864_101648860
529 Ga0068861_100285532
530 Ga0068861_100293488
531 Ga0068861_100811170
532 Ga0068851_10395464
533 Ga0068851_10713536
534 Ga0068863_100086209
535 Ga0068863_101580959
536 Ga0068863_101784871
537 Ga0068858_100147313
538 Ga0068858_100178425
539 Ga0068858_101636622
540 Ga0068860_100008464
541 Ga0068860_100065761
542 Ga0068860_100108081
543 Ga0068860_100156255
544 Ga0068860_100498167
545 Ga0068860_100516796
546 Ga0068860_101139706
547 Ga0068862_100434406
548 Ga0068862_100641177
549 Ga0068862_100918323
550 Ga0068862_102162549
551 Ga0081539_10001231
552 Ga0081539_10001477
553 Ga0070715_10436035
554 Ga0070716_100054996
555 Ga0097621_100175468
556 Ga0068871_100231804
557 Ga0068871_101158419
558 Ga0075430_100076657
559 Ga0075430_100652341
560 Ga0075433_10890129
561 Ga0075433_10945851
562 Ga0075434_100509871
563 Ga0075434_101330608
564 Ga0075429_100248922
565 Ga0068865_101155015
566 Ga0097620_100075533
567 Ga0097620_100172782
568 Ga0097620_100202424
569 Ga0097620_100312454
570 Ga0097620_100440357
571 Ga0097620_100960627
572 Ga0097620_101088701
573 Ga0097620_101740204
574 Ga0105251_10643312
575 Ga0105250_10390305
576 Ga0105240_10663437
577 Ga0105240_11083234
578 Ga0111539_10007086
579 Ga0111539_10797453
580 Ga0105245_12723555
581 Ga0105247_10000669
582 Ga0105247_10195150
583 Ga0105247_11662930
584 Ga0114129_10528985
585 Ga0105243_10214367
586 Ga0105243_10822574
587 Ga0105243_11050228
588 Ga0105243_11380179
589 Ga0105243_11651969
590 Ga0105241_10006550
591 Ga0105241_10048787
592 Ga0105241_10105964
593 Ga0105241_11655973
594 Ga0105241_12352943
595 Ga0105242_10408255
596 Ga0105242_10729544
597 Ga0105248_10310905
598 Ga0105248_10672883
599 Ga0105248_10848063
600 Ga0105248_10848779
601 Ga0105248_11100397
602 Ga0105248_11108003
603 Ga0105248_11350698
604 Ga0105248_11819324
605 Ga0105237_11062933
606 Ga0105237_11133660
607 Ga0105237_11378503
608 Ga0105238_10007482
609 Ga0105238_10699388
610 Ga0105249_10025884
611 Ga0105249_12009849
612 Ga0105246_11599041
613 Ga0105246_12415558
614 Ga0157373_10002615
615 Ga0157373_10052957
616 Ga0157373_10170413
617 Ga0157373_10774263
618 Ga0157373_11302144
619 Ga0157378_10347285
620 Ga0157378_10980516
621 Ga0163162_13057518
622 Ga0157372_10482638
623 Ga0157372_10933082
624 Ga0157372_11333092
625 Ga0157372_11699436
626 Ga0157372_13089426
627 Ga0157375_10705453
628 Ga0157375_11006458
629 Ga0157375_12234056
630 Ga0163163_10007227
631 Ga0163163_10016111
632 Ga0163163_10289493
633 Ga0163163_10291172
634 Ga0163163_10327874
635 Ga0163163_11869604
636 Ga0157380_10696822
637 Ga0157380_11400339
638 Ga0157380_11929706
639 Ga0157377_10630585
640 Ga0157377_11342586
641 Ga0157377_11400965
642 Ga0157379_10146050
643 Ga0157379_10450821
644 Ga0157379_12259096
645 Ga0163161_10499140
646 Ga0207710_10000436
647 Ga0207710_10434327
648 Ga0207688_10197758
649 Ga0207647_10007153
650 Ga0207699_10428348
651 Ga0207643_10002503
652 Ga0207643_10357148
653 Ga0207684_10148168
654 Ga0207654_10005042
655 Ga0207654_10654638
656 Ga0207654_11346728
657 Ga0207707_10142556
658 Ga0207707_10223951
659 Ga0207695_10281064
660 Ga0207671_10604562
661 Ga0207671_11152127
662 Ga0207660_11112261
663 Ga0207662_10392110
664 Ga0207657_10128943
665 Ga0207649_10159670
666 Ga0207649_11108831
667 Ga0207652_10182640
668 Ga0207681_10011530
669 Ga0207694_10001929
670 Ga0207694_10803739
671 Ga0207650_10000011
672 Ga0207650_10029953
673 Ga0207650_10240993
674 Ga0207650_10683326
675 Ga0207659_10295589
676 Ga0207659_11049212
677 Ga0207687_11407083
678 Ga0207687_11490252
679 Ga0207644_10270806
680 Ga0207690_10082442
681 Ga0207690_10981990
682 Ga0207706_11411752
683 Ga0207686_10264660
684 Ga0207686_10692806
685 Ga0207709_10230751
686 Ga0207670_10004214
687 Ga0207704_10380303
688 Ga0207665_10142489
689 Ga0207665_10184405
690 Ga0207691_10306572
691 Ga0207691_11284288
692 Ga0207711_10243841
693 Ga0207711_10331492
694 Ga0207689_10348894
695 Ga0207689_10551741
696 Ga0207689_10858060
697 Ga0207679_10038692
698 Ga0207679_10496162
699 Ga0207679_10780519
700 Ga0207679_11914897
701 Ga0207667_10762681
702 Ga0207667_11120991
703 Ga0207651_10087127
704 Ga0207651_10596814
705 Ga0207651_11198684
706 Ga0207640_10855397
707 Ga0207703_10045258
708 Ga0207703_10142186
709 Ga0207703_10181600
710 Ga0207703_10349113
711 Ga0207703_10683508
712 Ga0207703_10832920
713 Ga0207703_11321642
714 Ga0207703_11465377
715 Ga0207639_10050519
716 Ga0207639_10210475
717 Ga0207639_10269708
718 Ga0207639_11590631
719 Ga0207708_10048663
720 Ga0207708_10369193
721 Ga0207708_10784311
722 Ga0207641_10124888
723 Ga0207641_10163934
724 Ga0207641_10170767
725 Ga0207641_10481522
726 Ga0207648_10131638
727 Ga0207648_10445781
728 Ga0207648_10715709
729 Ga0207648_10824494
730 Ga0207676_10036141
731 Ga0207676_10226481
732 Ga0207676_10243055
733 Ga0207676_10302657
734 Ga0207676_10681902
735 Ga0207676_10768577
736 Ga0207674_10000169
737 Ga0207674_10033190
738 Ga0207674_10057907
739 Ga0207674_10224937
740 Ga0207674_11147846
741 Ga0207675_100013723
742 Ga0207675_100072027
743 Ga0207675_100097202
744 Ga0207428_10007390
745 Ga0268265_10788387
746 Ga0268265_11906296
747 Ga0268264_10065926
748 Ga0268264_10247871
749 Ga0307406_10098241
750 Ga0307414_10159948
751 Ga0373940_0125139
752 Ga0373951_0001430
753 Ga0373951_0048144
754 Ga0373952_0145228
755 Ga0373931_0875819
756 Ga0395899_0737095
757 Ga0395898_1094528
758 Ga0395901_0535646
759 Ga0395901_1483703
760 Ga0242422_00592
761 Ga0242422_10808
762 Ga0242420_004987
763 Ga0242420_060869
764 Ga0439458_0002321
765 Ga0451576_0410065
766 Ga0451576_2617129
767 Ga0496102_0607524
768 Ga0496102_1057595
769 Ga0496103_0092162
770 Ga0496104_0244804
771 Ga0496104_0777446
772 Ga0496106_0024322
773 Ga0496107_0233447
774 Ga0496109_0392268
775 Ga0496109_1012765
776 Ga0496111_0651116
777 Ga0496112_0053596
778 Ga0496112_0648607
779 Ga0496112_1011141
780 Ga0496113_1351463
781 Ga0501295_068318
782 Ga0501296_017687
783 Ga0501298_009951
784 Ga0501299_012290
785 Ga0501300_044420
786 Ga0501303_002655
787 Ga0501201_010492
788 Ga0501207_002098
789 Ga0501216_019198
790 Ga0501216_034002
791 Ga0501217_035966
792 Ga0501223_112680
793 Ga0501227_001574
794 Ga0501227_121100
795 Ga0501227_147146
796 Ga0501230_094111
797 Ga0501233_003635
798 Ga0501233_160546
799 Ga0501233_203602
800 Ga0501240_001826
801 Ga0501243_023748
802 Ga0501259_003763
803 Ga0501221_049206
804 Ga0501225_0002220
805 Ga0501225_0030132
806 Ga0501225_0040877
807 Ga0501234_015802
808 Ga0501266_036469
809 Ga0501272_014191
810 Ga0501283_001531
811 Ga0501212_063925
812 nmdc:mga05p37_1776047_c1
813 nmdc:mga09592_445538_c1
814 nmdc:mga0qj67_413016_c1
815 nmdc:mga06r32_1230864_c1
816 nmdc:mga08y16_629890_c1
817 nmdc:mga08y16_797478_c1
818 nmdc:mga0n895_75037_c1
819 nmdc:mga0n895_81536_c1
820 nmdc:mga08x19_680040_c1
821 nmdc:mga0a205_5297_c1
822 nmdc:mga0a205_90307_c1
823 nmdc:mga0a205_955248_c1
824 Ga0501084_0113598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11604

CusF_Ec

Copper binding periplasmic protein CusF

60

127

0.9

Map