F437572

General Info

Members Datasets Scaffolds Average Seq Length
411 251 822 305

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000234|Ga0395900_0000234_83516_84541
Length 341
Sequence MAGDSKKLQPIIVKKVKKGGHAAHGGAWKIAYADFVTAMMAFFLLMWLLGSTTEGDKKGIAEYFSSPLKIALLSSGSGAGDASHVIHGGGQDLTRTTGQVKRGEIAADRAHVNIKALKAEQIRAEVARLEDLKHRVEQKIKENGKLAAFKSQIKLDMTADGLRIQIVDAQNRPMFASGSATVEPYMRELLREIGSVLADVPNRLTLEGHTDAQAYAGGALGYSNWELSADRANASRRELIAGGLPEDHVLRVQGLASSMLLNPADPLDPINRRISIIVMNRDAEERFFRTSPEAARAADAGASATVDEPAASAPIAPPPVDITPQVRPRITDNQTDNPRKS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
143 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
172 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
173 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
224 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
225 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
226 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
227 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
228 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
229 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
230 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
231 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
232 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
243 2643221585 Pelomonas sp. Root662 Isolate Unclassified
244 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
245 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
246 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
247 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
248 2643221656 Pelomonas sp. Root405 Isolate Unclassified
249 2738541337 Pelomonas sp. BT06 Isolate Unclassified
250 2831864461 Roseateles noduli HZ7 Isolate Nodule
251 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0.73
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.22
Nodule 1.22
Rhizoplane 3.65
Rhizosphere 80.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0000234 3300037418 Bacteria 87083
2 JGI24740J21852_10008476 3300001979 Bacteria 4096
3 JGI24744J21845_10014087 3300002077 Bacteria 1609
4 rootH1_10021033 3300003316 Bacteria 1538
5 rootL2_10006277 3300003322 Bacteria 27243
6 Ga0055525_1000038 3300003759 Bacteria 297540
7 Ga0055526_1002934 3300003771 Bacteria 11176
8 Ga0055524_1000233 3300003775 Bacteria 58967
9 Ga0055530_10006306 3300003791 Bacteria 5332
10 Ga0055530_10018496 3300003791 Bacteria 2145
11 Ga0055540_1000080 3300003792 Bacteria 111063
12 Ga0055540_1008469 3300003792 Bacteria 3701
13 Ga0055540_1015203 3300003792 Bacteria 2253
14 Ga0055531_10000043 3300003794 Bacteria 133906
15 Ga0055531_10005914 3300003794 Bacteria 7046
16 Ga0055543_1012235 3300004625 Bacteria 1734
17 Ga0065165_1000732 3300005262 Bacteria 45731
18 Ga0065165_1002479 3300005262 Bacteria 15515
19 Ga0070658_10016734 3300005327 Bacteria 5869
20 Ga0070658_10041279 3300005327 Bacteria 3721
21 Ga0070676_10045541 3300005328 Bacteria 2555
22 Ga0070676_10214440 3300005328 Bacteria 1268
23 Ga0070683_100223713 3300005329 Bacteria 1788
24 Ga0070690_100195774 3300005330 Bacteria 1403
25 Ga0070670_100035514 3300005331 Bacteria 4291
26 Ga0068869_100034799 3300005334 Bacteria 3566
27 Ga0070666_10023799 3300005335 Bacteria 3987
28 Ga0070680_100066310 3300005336 Bacteria 2960
29 Ga0068868_100026628 3300005338 Bacteria 4409
30 Ga0070660_100148087 3300005339 Bacteria 1886
31 Ga0070660_100218563 3300005339 Bacteria 1548
32 Ga0070661_100054591 3300005344 Bacteria 2926
33 Ga0070668_100238773 3300005347 Bacteria 1505
34 Ga0070669_100024668 3300005353 Bacteria 4314
35 Ga0070669_100027665 3300005353 Bacteria 4081
36 Ga0070675_100006864 3300005354 Bacteria 8741
37 Ga0070675_100119695 3300005354 Bacteria 2236
38 Ga0070671_100015455 3300005355 Bacteria 6166
39 Ga0070671_100076273 3300005355 Bacteria 2801
40 Ga0070674_100108451 3300005356 Bacteria 2035
41 Ga0070674_100195852 3300005356 Bacteria 1557
42 Ga0070673_100001525 3300005364 Bacteria 13646
43 Ga0070673_100176104 3300005364 Bacteria 1828
44 Ga0070659_100082324 3300005366 Bacteria 2571
45 Ga0070659_100195542 3300005366 Bacteria 1663
46 Ga0070659_100292578 3300005366 Bacteria 1356
47 Ga0070667_100046954 3300005367 Bacteria 3633
48 Ga0070667_100066614 3300005367 Bacteria 3060
49 Ga0070701_10172183 3300005438 Bacteria 1261
50 Ga0070700_100066973 3300005441 Bacteria 2280
51 Ga0070663_100147083 3300005455 Bacteria 1803
52 Ga0070678_100032048 3300005456 Bacteria 3633
53 Ga0070678_100184749 3300005456 Bacteria 1710
54 Ga0070678_100293857 3300005456 Bacteria 1378
55 Ga0070662_100006407 3300005457 Bacteria 7585
56 Ga0070662_100066266 3300005457 Bacteria 2649
57 Ga0068867_100003038 3300005459 Bacteria 11836
58 Ga0068867_100003526 3300005459 Bacteria 11001
59 Ga0068867_100026346 3300005459 Bacteria 4174
60 Ga0070706_100161318 3300005467 Bacteria 2094
61 Ga0070699_100256942 3300005518 Bacteria 1562
62 Ga0070679_100000719 3300005530 Bacteria 28553
63 Ga0068853_100428467 3300005539 Bacteria 1241
64 Ga0068853_100548858 3300005539 Bacteria 1094
65 Ga0070693_100054646 3300005547 Bacteria 2297
66 Ga0070665_100003795 3300005548 Bacteria 15994
67 Ga0070665_100141960 3300005548 Bacteria 2405
68 Ga0068855_100137754 3300005563 Bacteria 2784
69 Ga0070664_100061146 3300005564 Bacteria 3209
70 Ga0068857_100479538 3300005577 Bacteria 1165
71 Ga0068854_100110296 3300005578 Bacteria 2074
72 Ga0068852_100043114 3300005616 Bacteria 3825
73 Ga0068852_100056217 3300005616 Bacteria 3400
74 Ga0068852_100069833 3300005616 Bacteria 3080
75 Ga0068852_100186987 3300005616 Bacteria 1951
76 Ga0068852_100469465 3300005616 Bacteria 1249
77 Ga0068859_100058503 3300005617 Bacteria 3883
78 Ga0068859_100170172 3300005617 Bacteria 2259
79 Ga0068859_100269211 3300005617 Bacteria 1796
80 Ga0068864_100153927 3300005618 Bacteria 2085
81 Ga0068866_10004162 3300005718 Bacteria 5933
82 Ga0068861_100002963 3300005719 Bacteria 11201
83 Ga0068863_100069374 3300005841 Bacteria 3333
84 Ga0068863_100180603 3300005841 Bacteria 2025
85 Ga0068858_100006112 3300005842 Bacteria 11747
86 Ga0068858_100037737 3300005842 Bacteria 4481
87 Ga0068858_100234398 3300005842 Bacteria 1741
88 Ga0068858_100261945 3300005842 Bacteria 1644
89 Ga0068860_100003339 3300005843 Bacteria 16528
90 Ga0068860_100006685 3300005843 Bacteria 11578
91 Ga0068860_100082566 3300005843 Bacteria 3056
92 Ga0068860_100398234 3300005843 Bacteria 1362
93 Ga0068862_100021183 3300005844 Bacteria 5434
94 Ga0068862_100166875 3300005844 Bacteria 1968
95 Ga0075366_10025881 3300006195 Bacteria 3432
96 Ga0075366_10035627 3300006195 Bacteria 2934
97 Ga0097621_100013671 3300006237 Bacteria 6060
98 Ga0097621_100401775 3300006237 Bacteria 1227
99 Ga0075370_10019889 3300006353 Bacteria 3660
100 Ga0075370_10027906 3300006353 Bacteria 3134
101 Ga0075370_10084453 3300006353 Bacteria 1827
102 Ga0068871_100037418 3300006358 Bacteria 3869
103 Ga0075430_100035665 3300006846 Bacteria 4219
104 Ga0075429_100001126 3300006880 Bacteria 21556
105 Ga0068865_100156814 3300006881 Bacteria 1732
106 Ga0068865_100311950 3300006881 Bacteria 1262
107 Ga0097620_100058503 3300006931 Bacteria 3883
108 Ga0097620_100170171 3300006931 Bacteria 2259
109 Ga0097620_100269211 3300006931 Bacteria 1796
110 Ga0099823_1012117 3300006944 Bacteria 8736
111 Ga0079104_1001201 3300006946 Bacteria 18424
112 Ga0105240_10092797 3300009093 Bacteria 3685
113 Ga0105240_10218331 3300009093 Bacteria 2223
114 Ga0105245_10072765 3300009098 Bacteria 3124
115 Ga0105245_10178350 3300009098 Bacteria 2028
116 Ga0114129_10207496 3300009147 Bacteria 2650
117 Ga0105243_10002920 3300009148 Bacteria 14153
118 Ga0105243_10062145 3300009148 Bacteria 2990
119 Ga0105243_10080080 3300009148 Bacteria 2663
120 Ga0105243_10165820 3300009148 Bacteria 1909
121 Ga0105241_10481899 3300009174 Bacteria 1103
122 Ga0105242_10009337 3300009176 Bacteria 7531
123 Ga0105248_10031431 3300009177 Bacteria 5935
124 Ga0105237_10000870 3300009545 Bacteria 41025
125 Ga0105238_10138998 3300009551 Bacteria 2406
126 Ga0105238_10528918 3300009551 Bacteria 1182
127 Ga0105249_10025299 3300009553 Bacteria 5342
128 Ga0105249_10042252 3300009553 Bacteria 4146
129 Ga0105239_10025434 3300010375 Bacteria 6518
130 Ga0105239_10053098 3300010375 Bacteria 4446
131 Ga0157319_1000037 3300012497 Bacteria 39883
132 Ga0157373_10051611 3300013100 Bacteria 2928
133 Ga0157374_10030089 3300013296 Bacteria 4927
134 Ga0157374_10083411 3300013296 Bacteria 3036
135 Ga0157378_10118898 3300013297 Bacteria 2433
136 Ga0157378_10178802 3300013297 Bacteria 1994
137 Ga0163162_10003099 3300013306 Bacteria 15876
138 Ga0163162_10151140 3300013306 Bacteria 2440
139 Ga0163162_10174747 3300013306 Bacteria 2273
140 Ga0163162_10280791 3300013306 Bacteria 1797
141 Ga0163162_10483984 3300013306 Bacteria 1369
142 Ga0157380_10002156 3300014326 Bacteria 13204
143 Ga0157380_10022358 3300014326 Bacteria 4758
144 Ga0157380_10033935 3300014326 Bacteria 3933
145 Ga0157377_10000313 3300014745 Bacteria 22234
146 Ga0157379_10029226 3300014968 Bacteria 4902
147 Ga0157379_10050957 3300014968 Bacteria 3696
148 Ga0157379_10069324 3300014968 Bacteria 3153
149 Ga0157376_10012002 3300014969 Bacteria 6410
150 Ga0213872_10000018 3300021361 Bacteria 175951
151 Ga0213872_10000050 3300021361 Bacteria 109093
152 Ga0213872_10000070 3300021361 Bacteria 91519
153 Ga0213872_10000417 3300021361 Bacteria 34831
154 Ga0213872_10013000 3300021361 Bacteria 3902
155 Ga0213872_10085355 3300021361 Bacteria 1415
156 Ga0209563_100005 3300025230 Bacteria 1774893
157 Ga0209759_1001266 3300025256 Bacteria 15217
158 Ga0207666_1004236 3300025271 Bacteria 1791
159 Ga0209673_1018766 3300025273 Bacteria 2504
160 Ga0209673_1020885 3300025273 Bacteria 2304
161 Ga0209564_1000051 3300025295 Bacteria 357748
162 Ga0209050_1003609 3300025298 Bacteria 11221
163 Ga0209050_1005594 3300025298 Bacteria 7802
164 Ga0209050_1017891 3300025298 Bacteria 2792
165 Ga0209050_1023059 3300025298 Bacteria 2205
166 Ga0209256_1000203 3300025299 Bacteria 112500
167 Ga0209256_1000471 3300025299 Bacteria 60530
168 Ga0209256_1005805 3300025299 Bacteria 6882
169 Ga0209051_1000035 3300025303 Bacteria 346999
170 Ga0209051_1002155 3300025303 Bacteria 14606
171 Ga0209051_1010205 3300025303 Bacteria 4770
172 Ga0209051_1014778 3300025303 Bacteria 3625
173 Ga0209257_1000182 3300025304 Bacteria 156672
174 Ga0209257_1000346 3300025304 Bacteria 95662
175 Ga0209257_1015761 3300025304 Bacteria 3114
176 Ga0207642_10000898 3300025899 Bacteria 9344
177 Ga0207642_10133647 3300025899 Bacteria 1298
178 Ga0207688_10044722 3300025901 Bacteria 2468
179 Ga0207680_10012142 3300025903 Bacteria 4379
180 Ga0207643_10038986 3300025908 Bacteria 2671
181 Ga0207705_10104662 3300025909 Bacteria 2085
182 Ga0207684_10037256 3300025910 Bacteria 4127
183 Ga0207695_10110885 3300025913 Bacteria 2723
184 Ga0207671_10013637 3300025914 Bacteria 6462
185 Ga0207660_10053976 3300025917 Bacteria 2866
186 Ga0207662_10061865 3300025918 Bacteria 2248
187 Ga0207657_10014285 3300025919 Bacteria 7759
188 Ga0207657_10163860 3300025919 Bacteria 1804
189 Ga0207649_10013050 3300025920 Bacteria 4633
190 Ga0207649_10316504 3300025920 Bacteria 1145
191 Ga0207652_10008106 3300025921 Bacteria 8435
192 Ga0207681_10002376 3300025923 Bacteria 11965
193 Ga0207694_10015412 3300025924 Bacteria 5764
194 Ga0207694_10036327 3300025924 Bacteria 3781
195 Ga0207650_10016281 3300025925 Bacteria 5194
196 Ga0207650_10105733 3300025925 Bacteria 2173
197 Ga0207659_10008261 3300025926 Bacteria 6452
198 Ga0207687_10009738 3300025927 Bacteria 6286
199 Ga0207687_10302415 3300025927 Bacteria 1289
200 Ga0207644_10001787 3300025931 Bacteria 13923
201 Ga0207644_10016766 3300025931 Bacteria 4933
202 Ga0207644_10023291 3300025931 Bacteria 4240
203 Ga0207644_10401583 3300025931 Bacteria 1120
204 Ga0207690_10023892 3300025932 Bacteria 3821
205 Ga0207706_10005993 3300025933 Bacteria 11303
206 Ga0207706_10045451 3300025933 Bacteria 3890
207 Ga0207686_10030836 3300025934 Bacteria 3179
208 Ga0207709_10005489 3300025935 Bacteria 7198
209 Ga0207709_10069939 3300025935 Bacteria 2224
210 Ga0207669_10083783 3300025937 Bacteria 2052
211 Ga0207669_10156159 3300025937 Bacteria 1605
212 Ga0207704_10138733 3300025938 Bacteria 1697
213 Ga0207691_10140875 3300025940 Bacteria 2125
214 Ga0207711_10010060 3300025941 Bacteria 7863
215 Ga0207711_10055104 3300025941 Bacteria 3413
216 Ga0207679_10042616 3300025945 Bacteria 3263
217 Ga0207667_10039330 3300025949 Bacteria 5042
218 Ga0207667_10255728 3300025949 Bacteria 1791
219 Ga0207712_10012989 3300025961 Bacteria 5333
220 Ga0207712_10053337 3300025961 Bacteria 2836
221 Ga0207712_10327933 3300025961 Bacteria 1265
222 Ga0207668_10261561 3300025972 Bacteria 1410
223 Ga0207640_10014279 3300025981 Bacteria 4569
224 Ga0207658_10040161 3300025986 Bacteria 3380
225 Ga0207658_10167301 3300025986 Bacteria 1807
226 Ga0207677_10117085 3300026023 Bacteria 1996
227 Ga0207703_10003656 3300026035 Bacteria 12817
228 Ga0207703_10040681 3300026035 Bacteria 3721
229 Ga0207703_10206990 3300026035 Bacteria 1747
230 Ga0207639_10035489 3300026041 Bacteria 3690
231 Ga0207702_10316460 3300026078 Bacteria 1485
232 Ga0207702_10329729 3300026078 Bacteria 1455
233 Ga0207641_10016868 3300026088 Bacteria 5980
234 Ga0207648_10000264 3300026089 Bacteria 56766
235 Ga0207648_10002564 3300026089 Bacteria 19471
236 Ga0207648_10022994 3300026089 Bacteria 5590
237 Ga0207648_10347027 3300026089 Bacteria 1337
238 Ga0207676_10047754 3300026095 Bacteria 3319
239 Ga0207676_10144139 3300026095 Bacteria 2043
240 Ga0207674_10416243 3300026116 Bacteria 1298
241 Ga0207675_100011443 3300026118 Bacteria 8299
242 Ga0207675_100024435 3300026118 Bacteria 5619
243 Ga0207675_100029183 3300026118 Bacteria 5141
244 Ga0207683_10027446 3300026121 Bacteria 4920
245 Ga0207698_10050577 3300026142 Bacteria 3171
246 Ga0207698_10053626 3300026142 Bacteria 3097
247 Ga0207698_10061937 3300026142 Bacteria 2919
248 Ga0209281_1000076 3300027111 Bacteria 263350
249 Ga0209389_1005598 3300027296 Bacteria 10733
250 Ga0268265_10127847 3300028380 Bacteria 2106
251 Ga0268264_10032972 3300028381 Bacteria 4251
252 Ga0268264_10155097 3300028381 Bacteria 2057
253 Ga0307515_10000232 3300028794 Bacteria 137778
254 Ga0307515_10004747 3300028794 Bacteria 27845
255 Ga0307515_10090374 3300028794 Bacteria 3841
256 Ga0307512_10062269 3300030522 Bacteria 2864
257 Ga0265325_10011694 3300031241 Bacteria 5037
258 Ga0265327_10000028 3300031251 Bacteria 361066
259 Ga0265327_10001687 3300031251 Bacteria 26413
260 Ga0307513_10041489 3300031456 Bacteria 5078
261 Ga0307408_100000160 3300031548 Bacteria 74342
262 Ga0307408_100072725 3300031548 Bacteria 2546
263 Ga0307408_100126353 3300031548 Bacteria 1989
264 Ga0307409_100028451 3300031995 Bacteria 3982
265 Ga0307416_100056400 3300032002 Bacteria 3170
266 Ga0307416_100838459 3300032002 Bacteria 1017
267 Ga0307414_10029087 3300032004 Bacteria 3593
268 Ga0307414_10072241 3300032004 Bacteria 2492
269 Ga0307411_10013696 3300032005 Bacteria 4485
270 Ga0307415_100016765 3300032126 Bacteria 4376
271 Ga0316583_10001393 3300032133 Bacteria 8039
272 Ga0373939_0000254 3300035114 Bacteria 14437
273 Ga0373960_0013668 3300035121 Bacteria 2042
274 Ga0373943_0031473 3300035170 Bacteria 2517
275 Ga0373955_0062754 3300035172 Bacteria 2056
276 Ga0373924_0090090 3300035410 Bacteria 1312
277 Ga0373924_0134251 3300035410 Bacteria 1078
278 Ga0373931_0002448 3300035691 Bacteria 8219
279 Ga0373931_0009177 3300035691 Bacteria 4723
280 Ga0373947_0172763 3300035725 Bacteria 1403
281 Ga0373925_0137665 3300037068 Bacteria 1909
282 Ga0373925_0168042 3300037068 Bacteria 1730
283 Ga0395898_0001513 3300037466 Bacteria 32059
284 Ga0395905_0000071 3300037471 Bacteria 174580
285 Ga0395905_0000140 3300037471 Bacteria 120221
286 Ga0395905_0001842 3300037471 Bacteria 24475
287 Ga0395905_0307925 3300037471 Bacteria 1472
288 Ga0436365_0485473 3300039437 Bacteria 5371
289 Ga0436361_0104381 3300039447 Bacteria 43863
290 Ga0436361_0154602 3300039447 Bacteria 3922
291 Ga0436361_0269507 3300039447 Bacteria 102308
292 Ga0436361_0677882 3300039447 Bacteria 228834
293 Ga0436361_0812713 3300039447 Bacteria 39089
294 Ga0436361_0857346 3300039447 Bacteria 1744
295 Ga0436363_1642591 3300039450 Bacteria 2518
296 Ga0439454_000243 3300042011 Bacteria 3928
297 Ga0450888_001639 3300042126 Bacteria 2160
298 Ga0450892_000384 3300042130 Bacteria 5243
299 Ga0439459_0000455 3300042438 Bacteria 5298
300 Ga0450893_0002582 3300042532 Bacteria 2830
301 Ga0451577_0000284 3300042876 Bacteria 98326
302 Ga0451577_0000747 3300042876 Bacteria 49907
303 Ga0451577_0000906 3300042876 Bacteria 43738
304 Ga0451577_0013455 3300042876 Bacteria 7655
305 Ga0451577_0049376 3300042876 Bacteria 3758
306 Ga0451577_0056211 3300042876 Bacteria 3510
307 Ga0466969_0000097 3300044656 Bacteria 45819
308 Ga0466969_0003842 3300044656 Bacteria 7974
309 Ga0466972_0025404 3300044658 Bacteria 2937
310 Ga0453683_0010377 3300044673 Bacteria 6173
311 Ga0453683_0120827 3300044673 Bacteria 1649
312 Ga0466965_0023705 3300044683 Bacteria 2964
313 Ga0466965_0154285 3300044683 Bacteria 1201
314 Ga0466966_0002183 3300044684 Bacteria 12706
315 Ga0466966_0017275 3300044684 Bacteria 4767
316 Ga0466961_0006372 3300044693 Bacteria 7494
317 Ga0466964_0002541 3300044706 Bacteria 6496
318 Ga0453684_0000102 3300044712 Bacteria 366870
319 Ga0453684_0000149 3300044712 Bacteria 307732
320 Ga0453684_0001320 3300044712 Bacteria 73258
321 Ga0453684_0002172 3300044712 Bacteria 49008
322 Ga0453684_0124597 3300044712 Bacteria 3104
323 Ga0453684_0142655 3300044712 Bacteria 2857
324 Ga0453684_0319077 3300044712 Bacteria 1760
325 Ga0466971_0013211 3300044719 Bacteria 3624
326 Ga0466970_0065310 3300044765 Bacteria 1952
327 Ga0466970_0091381 3300044765 Bacteria 1652
328 Ga0466957_0005623 3300044842 Bacteria 7048
329 Ga0466957_0257935 3300044842 Bacteria 1161
330 Ga0466960_0050115 3300044901 Bacteria 2012
331 Ga0466959_0000306 3300045049 Bacteria 29171
332 Ga0466959_0010927 3300045049 Bacteria 6510
333 Ga0466959_0021736 3300045049 Bacteria 4735
334 Ga0451576_0000184 3300045051 Bacteria 157166
335 Ga0451576_0003466 3300045051 Bacteria 21625
336 Ga0451576_0006498 3300045051 Bacteria 14312
337 Ga0451576_0050348 3300045051 Bacteria 4368
338 Ga0451576_0133183 3300045051 Bacteria 2591
339 Ga0451576_0144276 3300045051 Bacteria 2482
340 Ga0451576_0181088 3300045051 Bacteria 2200
341 Ga0466958_0025874 3300045836 Bacteria 3463
342 Ga0466967_0072422 3300045976 Bacteria 3088
343 Ga0495580_0285970 3300046472 Bacteria 1124
344 Ga0495628_0228404 3300046516 Bacteria 1396
345 Ga0495586_0015335 3300046535 Bacteria 4077
346 Ga0495667_0148306 3300046559 Bacteria 1511
347 Ga0495646_0159905 3300046680 Bacteria 1248
348 Ga0495658_0019480 3300046683 Bacteria 3543
349 Ga0495658_0091116 3300046683 Bacteria 1805
350 Ga0495658_0152444 3300046683 Bacteria 1420
351 Ga0495613_0058138 3300046689 Bacteria 2839
352 Ga0495671_0130175 3300046692 Bacteria 1227
353 Ga0495684_0108424 3300047471 Bacteria 2097
354 Ga0496101_0117690 3300048904 Bacteria 2006
355 Ga0496106_0324708 3300048909 Bacteria 1235
356 Ga0496107_0061904 3300048910 Bacteria 2710
357 Ga0496108_0306272 3300048911 Bacteria 1384
358 Ga0496109_0200512 3300048912 Bacteria 1876
359 Ga0496109_0287652 3300048912 Bacteria 1549
360 Ga0496109_0320429 3300048912 Bacteria 1463
361 Ga0496109_0454652 3300048912 Bacteria 1209
362 Ga0496110_0062763 3300048913 Bacteria 3282
363 Ga0496110_0142048 3300048913 Bacteria 2170
364 Ga0496111_0077772 3300048914 Bacteria 2419
365 Ga0496112_0163477 3300048915 Bacteria 2192
366 Ga0496114_0007493 3300048917 Bacteria 8629
367 Ga0496114_0263322 3300048917 Bacteria 1518
368 Ga0496115_0090575 3300048918 Bacteria 2498
369 Ga0496124_0155656 3300048927 Bacteria 1787
370 Ga0501309_000022 3300049129 Bacteria 8089
371 Ga0501310_000112 3300049130 Bacteria 8096
372 Ga0501307_011332 3300049162 Bacteria 1046
373 Ga0501292_001865 3300049515 Bacteria 2646
374 Ga0501034_0017111 3300049571 Bacteria 7438
375 Ga0501036_0070777 3300049572 Bacteria 2950
376 Ga0501043_0000439 3300049579 Bacteria 37482
377 Ga0501046_0003318 3300049580 Bacteria 14796
378 Ga0501047_0000069 3300049581 Bacteria 129231
379 Ga0501048_0010784 3300049582 Bacteria 6813
380 Ga0501207_014047 3300049654 Bacteria 1219
381 Ga0501233_003253 3300049668 Bacteria 2915
382 Ga0501235_010410 3300049669 Bacteria 2031
383 Ga0501249_004552 3300049679 Bacteria 2818
384 Ga0501221_001524 3300049704 Bacteria 3834
385 Ga0501229_000113 3300049706 Bacteria 8411
386 Ga0501262_002583 3300049759 Bacteria 2050
387 Ga0501264_002188 3300049761 Bacteria 1852
388 Ga0501269_003474 3300049766 Bacteria 1908
389 Ga0501204_009133 3300049850 Bacteria 1141
390 nmdc:mga0k408_39942_c1 3300050493 Bacteria 2698
391 nmdc:mga0k408_45419_c1 3300050493 Bacteria 2535
392 nmdc:mga0k408_89792_c1 3300050493 Bacteria 1805
393 nmdc:mga07m45_14618_c1 3300050496 Bacteria 4185
394 nmdc:mga07m45_62673_c1 3300050496 Bacteria 2108
395 nmdc:mga05p37_179331_c1 3300050507 Bacteria 2578
396 nmdc:mga09592_1090_c1 3300050508 Bacteria 21555
397 nmdc:mga0qj67_112496_c1 3300050509 Bacteria 2198
398 Ga0495601_0143826 3300053077 Bacteria 1556
399 Ga0495619_0209151 3300053085 Bacteria 1351
400 Ga0500622_0001285 3300053156 Bacteria 20450
401 Ga0590074_006434 3300059423 Bacteria 1949
402 2643746429 2643221544 Bacteria 5886209
403 2643933093 2643221585 Bacteria 5812563
404 2644217237 2643221639 Bacteria 6649903
405 2644248180 2643221644 Bacteria 6865017
406 2644258996 2643221646 Bacteria 6433402
407 2644301619 2643221654 Bacteria 5273570
408 2644314342 2643221656 Bacteria 5809961
409 2739055733 2738541337 Bacteria 6183410
410 2831866130 2831864461 Bacteria 6502356
411 2886852008 2886848708 Bacteria 5632523
412 Ga0395900_0000234
413 JGI24740J21852_10008476
414 JGI24744J21845_10014087
415 rootH1_10021033
416 rootL2_10006277
417 Ga0055525_1000038
418 Ga0055526_1002934
419 Ga0055524_1000233
420 Ga0055530_10006306
421 Ga0055530_10018496
422 Ga0055540_1000080
423 Ga0055540_1008469
424 Ga0055540_1015203
425 Ga0055531_10000043
426 Ga0055531_10005914
427 Ga0055543_1012235
428 Ga0065165_1000732
429 Ga0065165_1002479
430 Ga0070658_10016734
431 Ga0070658_10041279
432 Ga0070676_10045541
433 Ga0070676_10214440
434 Ga0070683_100223713
435 Ga0070690_100195774
436 Ga0070670_100035514
437 Ga0068869_100034799
438 Ga0070666_10023799
439 Ga0070680_100066310
440 Ga0068868_100026628
441 Ga0070660_100148087
442 Ga0070660_100218563
443 Ga0070661_100054591
444 Ga0070668_100238773
445 Ga0070669_100024668
446 Ga0070669_100027665
447 Ga0070675_100006864
448 Ga0070675_100119695
449 Ga0070671_100015455
450 Ga0070671_100076273
451 Ga0070674_100108451
452 Ga0070674_100195852
453 Ga0070673_100001525
454 Ga0070673_100176104
455 Ga0070659_100082324
456 Ga0070659_100195542
457 Ga0070659_100292578
458 Ga0070667_100046954
459 Ga0070667_100066614
460 Ga0070701_10172183
461 Ga0070700_100066973
462 Ga0070663_100147083
463 Ga0070678_100032048
464 Ga0070678_100184749
465 Ga0070678_100293857
466 Ga0070662_100006407
467 Ga0070662_100066266
468 Ga0068867_100003038
469 Ga0068867_100003526
470 Ga0068867_100026346
471 Ga0070706_100161318
472 Ga0070699_100256942
473 Ga0070679_100000719
474 Ga0068853_100428467
475 Ga0068853_100548858
476 Ga0070693_100054646
477 Ga0070665_100003795
478 Ga0070665_100141960
479 Ga0068855_100137754
480 Ga0070664_100061146
481 Ga0068857_100479538
482 Ga0068854_100110296
483 Ga0068852_100043114
484 Ga0068852_100056217
485 Ga0068852_100069833
486 Ga0068852_100186987
487 Ga0068852_100469465
488 Ga0068859_100058503
489 Ga0068859_100170172
490 Ga0068859_100269211
491 Ga0068864_100153927
492 Ga0068866_10004162
493 Ga0068861_100002963
494 Ga0068863_100069374
495 Ga0068863_100180603
496 Ga0068858_100006112
497 Ga0068858_100037737
498 Ga0068858_100234398
499 Ga0068858_100261945
500 Ga0068860_100003339
501 Ga0068860_100006685
502 Ga0068860_100082566
503 Ga0068860_100398234
504 Ga0068862_100021183
505 Ga0068862_100166875
506 Ga0075366_10025881
507 Ga0075366_10035627
508 Ga0097621_100013671
509 Ga0097621_100401775
510 Ga0075370_10019889
511 Ga0075370_10027906
512 Ga0075370_10084453
513 Ga0068871_100037418
514 Ga0075430_100035665
515 Ga0075429_100001126
516 Ga0068865_100156814
517 Ga0068865_100311950
518 Ga0097620_100058503
519 Ga0097620_100170171
520 Ga0097620_100269211
521 Ga0099823_1012117
522 Ga0079104_1001201
523 Ga0105240_10092797
524 Ga0105240_10218331
525 Ga0105245_10072765
526 Ga0105245_10178350
527 Ga0114129_10207496
528 Ga0105243_10002920
529 Ga0105243_10062145
530 Ga0105243_10080080
531 Ga0105243_10165820
532 Ga0105241_10481899
533 Ga0105242_10009337
534 Ga0105248_10031431
535 Ga0105237_10000870
536 Ga0105238_10138998
537 Ga0105238_10528918
538 Ga0105249_10025299
539 Ga0105249_10042252
540 Ga0105239_10025434
541 Ga0105239_10053098
542 Ga0157319_1000037
543 Ga0157373_10051611
544 Ga0157374_10030089
545 Ga0157374_10083411
546 Ga0157378_10118898
547 Ga0157378_10178802
548 Ga0163162_10003099
549 Ga0163162_10151140
550 Ga0163162_10174747
551 Ga0163162_10280791
552 Ga0163162_10483984
553 Ga0157380_10002156
554 Ga0157380_10022358
555 Ga0157380_10033935
556 Ga0157377_10000313
557 Ga0157379_10029226
558 Ga0157379_10050957
559 Ga0157379_10069324
560 Ga0157376_10012002
561 Ga0213872_10000018
562 Ga0213872_10000050
563 Ga0213872_10000070
564 Ga0213872_10000417
565 Ga0213872_10013000
566 Ga0213872_10085355
567 Ga0209563_100005
568 Ga0209759_1001266
569 Ga0207666_1004236
570 Ga0209673_1018766
571 Ga0209673_1020885
572 Ga0209564_1000051
573 Ga0209050_1003609
574 Ga0209050_1005594
575 Ga0209050_1017891
576 Ga0209050_1023059
577 Ga0209256_1000203
578 Ga0209256_1000471
579 Ga0209256_1005805
580 Ga0209051_1000035
581 Ga0209051_1002155
582 Ga0209051_1010205
583 Ga0209051_1014778
584 Ga0209257_1000182
585 Ga0209257_1000346
586 Ga0209257_1015761
587 Ga0207642_10000898
588 Ga0207642_10133647
589 Ga0207688_10044722
590 Ga0207680_10012142
591 Ga0207643_10038986
592 Ga0207705_10104662
593 Ga0207684_10037256
594 Ga0207695_10110885
595 Ga0207671_10013637
596 Ga0207660_10053976
597 Ga0207662_10061865
598 Ga0207657_10014285
599 Ga0207657_10163860
600 Ga0207649_10013050
601 Ga0207649_10316504
602 Ga0207652_10008106
603 Ga0207681_10002376
604 Ga0207694_10015412
605 Ga0207694_10036327
606 Ga0207650_10016281
607 Ga0207650_10105733
608 Ga0207659_10008261
609 Ga0207687_10009738
610 Ga0207687_10302415
611 Ga0207644_10001787
612 Ga0207644_10016766
613 Ga0207644_10023291
614 Ga0207644_10401583
615 Ga0207690_10023892
616 Ga0207706_10005993
617 Ga0207706_10045451
618 Ga0207686_10030836
619 Ga0207709_10005489
620 Ga0207709_10069939
621 Ga0207669_10083783
622 Ga0207669_10156159
623 Ga0207704_10138733
624 Ga0207691_10140875
625 Ga0207711_10010060
626 Ga0207711_10055104
627 Ga0207679_10042616
628 Ga0207667_10039330
629 Ga0207667_10255728
630 Ga0207712_10012989
631 Ga0207712_10053337
632 Ga0207712_10327933
633 Ga0207668_10261561
634 Ga0207640_10014279
635 Ga0207658_10040161
636 Ga0207658_10167301
637 Ga0207677_10117085
638 Ga0207703_10003656
639 Ga0207703_10040681
640 Ga0207703_10206990
641 Ga0207639_10035489
642 Ga0207702_10316460
643 Ga0207702_10329729
644 Ga0207641_10016868
645 Ga0207648_10000264
646 Ga0207648_10002564
647 Ga0207648_10022994
648 Ga0207648_10347027
649 Ga0207676_10047754
650 Ga0207676_10144139
651 Ga0207674_10416243
652 Ga0207675_100011443
653 Ga0207675_100024435
654 Ga0207675_100029183
655 Ga0207683_10027446
656 Ga0207698_10050577
657 Ga0207698_10053626
658 Ga0207698_10061937
659 Ga0209281_1000076
660 Ga0209389_1005598
661 Ga0268265_10127847
662 Ga0268264_10032972
663 Ga0268264_10155097
664 Ga0307515_10000232
665 Ga0307515_10004747
666 Ga0307515_10090374
667 Ga0307512_10062269
668 Ga0265325_10011694
669 Ga0265327_10000028
670 Ga0265327_10001687
671 Ga0307513_10041489
672 Ga0307408_100000160
673 Ga0307408_100072725
674 Ga0307408_100126353
675 Ga0307409_100028451
676 Ga0307416_100056400
677 Ga0307416_100838459
678 Ga0307414_10029087
679 Ga0307414_10072241
680 Ga0307411_10013696
681 Ga0307415_100016765
682 Ga0316583_10001393
683 Ga0373939_0000254
684 Ga0373960_0013668
685 Ga0373943_0031473
686 Ga0373955_0062754
687 Ga0373924_0090090
688 Ga0373924_0134251
689 Ga0373931_0002448
690 Ga0373931_0009177
691 Ga0373947_0172763
692 Ga0373925_0137665
693 Ga0373925_0168042
694 Ga0395898_0001513
695 Ga0395905_0000071
696 Ga0395905_0000140
697 Ga0395905_0001842
698 Ga0395905_0307925
699 Ga0436365_0485473
700 Ga0436361_0104381
701 Ga0436361_0154602
702 Ga0436361_0269507
703 Ga0436361_0677882
704 Ga0436361_0812713
705 Ga0436361_0857346
706 Ga0436363_1642591
707 Ga0439454_000243
708 Ga0450888_001639
709 Ga0450892_000384
710 Ga0439459_0000455
711 Ga0450893_0002582
712 Ga0451577_0000284
713 Ga0451577_0000747
714 Ga0451577_0000906
715 Ga0451577_0013455
716 Ga0451577_0049376
717 Ga0451577_0056211
718 Ga0466969_0000097
719 Ga0466969_0003842
720 Ga0466972_0025404
721 Ga0453683_0010377
722 Ga0453683_0120827
723 Ga0466965_0023705
724 Ga0466965_0154285
725 Ga0466966_0002183
726 Ga0466966_0017275
727 Ga0466961_0006372
728 Ga0466964_0002541
729 Ga0453684_0000102
730 Ga0453684_0000149
731 Ga0453684_0001320
732 Ga0453684_0002172
733 Ga0453684_0124597
734 Ga0453684_0142655
735 Ga0453684_0319077
736 Ga0466971_0013211
737 Ga0466970_0065310
738 Ga0466970_0091381
739 Ga0466957_0005623
740 Ga0466957_0257935
741 Ga0466960_0050115
742 Ga0466959_0000306
743 Ga0466959_0010927
744 Ga0466959_0021736
745 Ga0451576_0000184
746 Ga0451576_0003466
747 Ga0451576_0006498
748 Ga0451576_0050348
749 Ga0451576_0133183
750 Ga0451576_0144276
751 Ga0451576_0181088
752 Ga0466958_0025874
753 Ga0466967_0072422
754 Ga0495580_0285970
755 Ga0495628_0228404
756 Ga0495586_0015335
757 Ga0495667_0148306
758 Ga0495646_0159905
759 Ga0495658_0019480
760 Ga0495658_0091116
761 Ga0495658_0152444
762 Ga0495613_0058138
763 Ga0495671_0130175
764 Ga0495684_0108424
765 Ga0496101_0117690
766 Ga0496106_0324708
767 Ga0496107_0061904
768 Ga0496108_0306272
769 Ga0496109_0200512
770 Ga0496109_0287652
771 Ga0496109_0320429
772 Ga0496109_0454652
773 Ga0496110_0062763
774 Ga0496110_0142048
775 Ga0496111_0077772
776 Ga0496112_0163477
777 Ga0496114_0007493
778 Ga0496114_0263322
779 Ga0496115_0090575
780 Ga0496124_0155656
781 Ga0501309_000022
782 Ga0501310_000112
783 Ga0501307_011332
784 Ga0501292_001865
785 Ga0501034_0017111
786 Ga0501036_0070777
787 Ga0501043_0000439
788 Ga0501046_0003318
789 Ga0501047_0000069
790 Ga0501048_0010784
791 Ga0501207_014047
792 Ga0501233_003253
793 Ga0501235_010410
794 Ga0501249_004552
795 Ga0501221_001524
796 Ga0501229_000113
797 Ga0501262_002583
798 Ga0501264_002188
799 Ga0501269_003474
800 Ga0501204_009133
801 nmdc:mga0k408_39942_c1
802 nmdc:mga0k408_45419_c1
803 nmdc:mga0k408_89792_c1
804 nmdc:mga07m45_14618_c1
805 nmdc:mga07m45_62673_c1
806 nmdc:mga05p37_179331_c1
807 nmdc:mga09592_1090_c1
808 nmdc:mga0qj67_112496_c1
809 Ga0495601_0143826
810 Ga0495619_0209151
811 Ga0500622_0001285
812 Ga0590074_006434
813 2643746429
814 2643933093
815 2644217237
816 2644248180
817 2644258996
818 2644301619
819 2644314342
820 2739055733
821 2831866130
822 2886852008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13677

MotB_plug

Membrane MotB of proton-channel complex MotA/MotB

13

68

0.89

PF00691

OmpA

OmpA family

174

273

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zvz-assembly1.cif.gz_B structure of the periplasmic domain of motb from salmonella (crystal form iii) 0.9656 118 289
2zvz-assembly1.cif.gz_B structure of the periplasmic domain of motb from salmonella (crystal form iii) 0.9482 118 289
2zov-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9339 123 294
2zvy-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9159 113 289
2zvz-assembly1.cif.gz_A structure of the periplasmic domain of motb from salmonella (crystal form iii) 0.9137 118 288
ID Description Score Start End Superfamily
2zovA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9276 123 294 3.30.1330.60
2zovA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9112 123 294 3.30.1330.60
af_Q47154_16_197_3.30.1330.60 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9107 117 305 3.30.1330.60
2zvyA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9087 110 289 3.30.1330.60
af_Q47154_16_197_3.30.1330.60 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9011 117 305 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A1H3GY61-F1-model_v4 Chemotaxis protein MotB 0.9899 174 289 GO:0016020
AF-E6QWV2-F1-model_v4 Protein that enables flagellar motor rotation MotB 0.975 163 291 GO:0031514
AF-A0A645C9R1-F1-model_v4 OmpA-like domain-containing protein 0.9742 165 289
AF-A0A2W4RUQ2-F1-model_v4 OmpA-like domain-containing protein 0.9703 153 281 GO:0016020
AF-A0A3D2DDT7-F1-model_v4 deleted 0.9698 146 294

Map