F437276

General Info

Members Datasets Scaffolds Average Seq Length
410 224 820 138

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100005846|Ga0207675_1000058462
Length 164
Sequence LLPFLNPFQNILLLVEIPLNNKSVFKMSKKVAVFRREHFNAAHRLFNPDWDDATNEKVFGKCALPHYHGHNYELEVKVAGKPDKKTGYVMDLKELSDLIKAEIHSRFDHKNLNLDTEEFKDLNPTAENIVVVIYDILRPLIDRKKDLHIRLYETPRNFVEYPVD

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
150 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
151 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
152 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
169 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
189 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
190 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
191 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
192 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
193 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
194 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
198 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
202 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
203 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
204 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
205 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
208 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
209 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
213 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
216 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 1.22
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 16.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100005846 3300026118 Bacteria 11754
2 MRS1b_contig_5809440 2162886011 Bacteria 1090
3 JGI24744J21845_10015017 3300002077 Bacteria 1550
4 JGI24751J29686_10000772 3300002459 Bacteria 7557
5 rootH2_10166393 3300003320 Unclassified 1296
6 rootH2_10219491 3300003320 Bacteria 1460
7 rootL2_10279768 3300003322 Bacteria 1282
8 rootH1_10267672 3300003323 Bacteria 1353
9 Ga0065712_10020440 3300005290 Bacteria 1808
10 Ga0065712_10171991 3300005290 Unclassified 1238
11 Ga0065712_10209652 3300005290 Bacteria 1077
12 Ga0070658_10082699 3300005327 Bacteria 2639
13 Ga0070676_10014586 3300005328 Bacteria 4322
14 Ga0070676_10456802 3300005328 Bacteria 899
15 Ga0070683_100030002 3300005329 Bacteria 4931
16 Ga0070683_100660043 3300005329 Bacteria 1001
17 Ga0070683_100707286 3300005329 Bacteria 965
18 Ga0070670_100008042 3300005331 Bacteria 8971
19 Ga0070670_100028055 3300005331 Bacteria 4844
20 Ga0070670_100042933 3300005331 Bacteria 3888
21 Ga0070670_100063511 3300005331 Bacteria 3170
22 Ga0070670_100117584 3300005331 Unclassified 2293
23 Ga0070670_100158711 3300005331 Bacteria 1959
24 Ga0070670_101105629 3300005331 Unclassified 723
25 Ga0070670_101350128 3300005331 Bacteria 653
26 Ga0070677_10092984 3300005333 Bacteria 1315
27 Ga0070677_10125825 3300005333 Bacteria 1163
28 Ga0068869_100007967 3300005334 Bacteria 6807
29 Ga0068869_100028124 3300005334 Bacteria 3925
30 Ga0068869_100032320 3300005334 Bacteria 3687
31 Ga0070666_10074320 3300005335 Bacteria 2316
32 Ga0070682_100709912 3300005337 Bacteria 807
33 Ga0068868_100024419 3300005338 Bacteria 4586
34 Ga0070660_100311960 3300005339 Bacteria 1291
35 Ga0070689_100447655 3300005340 Bacteria 1098
36 Ga0070689_101256009 3300005340 Bacteria 666
37 Ga0070687_100181051 3300005343 Bacteria 1262
38 Ga0070687_101125575 3300005343 Bacteria 575
39 Ga0070661_100075441 3300005344 Bacteria 2484
40 Ga0070661_101156830 3300005344 Bacteria 646
41 Ga0070668_100079125 3300005347 Bacteria 2573
42 Ga0070668_100681089 3300005347 Unclassified 905
43 Ga0070669_100007903 3300005353 Bacteria 7600
44 Ga0070675_100193385 3300005354 Bacteria 1764
45 Ga0070675_100393868 3300005354 Unclassified 1235
46 Ga0070671_100032017 3300005355 Bacteria 4348
47 Ga0070671_100046397 3300005355 Bacteria 3613
48 Ga0070674_100026419 3300005356 Bacteria 3792
49 Ga0070674_100257046 3300005356 Bacteria 1374
50 Ga0070673_100006820 3300005364 Bacteria 7461
51 Ga0070667_100116398 3300005367 Bacteria 2322
52 Ga0070667_100386145 3300005367 Unclassified 1272
53 Ga0070667_100398005 3300005367 Bacteria 1253
54 Ga0070667_100437882 3300005367 Bacteria 1193
55 Ga0070708_100361977 3300005445 Bacteria 1367
56 Ga0070663_101310122 3300005455 Bacteria 639
57 Ga0070678_100001168 3300005456 Bacteria 13928
58 Ga0070678_100396260 3300005456 Bacteria 1198
59 Ga0070662_101305727 3300005457 Bacteria 624
60 Ga0068867_100024007 3300005459 Bacteria 4369
61 Ga0068867_100059460 3300005459 Bacteria 2833
62 Ga0068867_100473294 3300005459 Unclassified 1072
63 Ga0068867_101663223 3300005459 Bacteria 598
64 Ga0070684_101118205 3300005535 Bacteria 740
65 Ga0068853_100045327 3300005539 Bacteria 3766
66 Ga0068853_100428574 3300005539 Bacteria 1241
67 Ga0070672_100054477 3300005543 Bacteria 3131
68 Ga0070672_100191506 3300005543 Bacteria 1708
69 Ga0070665_100037088 3300005548 Bacteria 4902
70 Ga0070664_100006075 3300005564 Bacteria 9761
71 Ga0070664_100023668 3300005564 Bacteria 5074
72 Ga0070664_100337142 3300005564 Bacteria 1369
73 Ga0070664_100662637 3300005564 Bacteria 970
74 Ga0068857_100053347 3300005577 Bacteria 3587
75 Ga0068857_100220639 3300005577 Bacteria 1732
76 Ga0068857_100261642 3300005577 Bacteria 1588
77 Ga0068857_101414730 3300005577 Bacteria 677
78 Ga0068854_100053598 3300005578 Bacteria 2897
79 Ga0068854_100071388 3300005578 Bacteria 2540
80 Ga0068854_100725666 3300005578 Unclassified 860
81 Ga0068854_101248799 3300005578 Bacteria 667
82 Ga0068852_100020748 3300005616 Bacteria 5228
83 Ga0068852_100268401 3300005616 Bacteria 1641
84 Ga0068852_101349605 3300005616 Bacteria 735
85 Ga0068859_100008262 3300005617 Bacteria 10553
86 Ga0068859_100485429 3300005617 Unclassified 1331
87 Ga0068859_101622319 3300005617 Bacteria 714
88 Ga0068864_100079743 3300005618 Bacteria 2867
89 Ga0068864_100471101 3300005618 Bacteria 1204
90 Ga0068864_100950502 3300005618 Bacteria 850
91 Ga0068866_10010738 3300005718 Bacteria 3937
92 Ga0068866_10059633 3300005718 Bacteria 1975
93 Ga0068866_10943651 3300005718 Unclassified 609
94 Ga0068861_100428909 3300005719 Bacteria 1180
95 Ga0068861_100506051 3300005719 Bacteria 1093
96 Ga0068861_101513231 3300005719 Unclassified 659
97 Ga0068851_10017160 3300005834 Unclassified 3473
98 Ga0068851_10030970 3300005834 Bacteria 2655
99 Ga0068863_100132513 3300005841 Bacteria 2379
100 Ga0068863_100408859 3300005841 Unclassified 1328
101 Ga0068858_100598604 3300005842 Bacteria 1069
102 Ga0068860_100268250 3300005843 Bacteria 1665
103 Ga0068860_100554611 3300005843 Bacteria 1152
104 Ga0068862_100136723 3300005844 Bacteria 2172
105 Ga0068862_100521611 3300005844 Bacteria 1130
106 Ga0075366_10025936 3300006195 Bacteria 3429
107 Ga0075366_10059762 3300006195 Bacteria 2264
108 Ga0097621_100003051 3300006237 Bacteria 11488
109 Ga0097621_100065274 3300006237 Bacteria 2995
110 Ga0097621_100108461 3300006237 Bacteria 2344
111 Ga0068871_100000757 3300006358 Bacteria 21823
112 Ga0068871_100012971 3300006358 Bacteria 6171
113 Ga0068865_100014622 3300006881 Bacteria 4991
114 Ga0068865_100129747 3300006881 Bacteria 1887
115 Ga0068865_102103343 3300006881 Bacteria 513
116 Ga0097620_100008262 3300006931 Bacteria 10553
117 Ga0097620_100485393 3300006931 Unclassified 1331
118 Ga0097620_101622454 3300006931 Bacteria 714
119 Ga0105247_10000597 3300009101 Bacteria 29260
120 Ga0105243_10314960 3300009148 Bacteria 1423
121 Ga0105243_10762044 3300009148 Unclassified 950
122 Ga0105241_10152782 3300009174 Bacteria 1890
123 Ga0105242_11292564 3300009176 Bacteria 753
124 Ga0105248_10029757 3300009177 Bacteria 6094
125 Ga0105248_12461415 3300009177 Bacteria 593
126 Ga0105237_10022870 3300009545 Bacteria 6411
127 Ga0105249_10005022 3300009553 Bacteria 11406
128 Ga0105249_10006600 3300009553 Bacteria 10096
129 Ga0105249_10207287 3300009553 Bacteria 1921
130 Ga0105249_10628589 3300009553 Bacteria 1130
131 Ga0105249_10852864 3300009553 Unclassified 976
132 Ga0105249_12979863 3300009553 Bacteria 544
133 Ga0105246_10006299 3300011119 Bacteria 7243
134 Ga0105246_10356403 3300011119 Bacteria 1200
135 Ga0105246_10784834 3300011119 Bacteria 844
136 Ga0157373_10009632 3300013100 Bacteria 7130
137 Ga0157371_10065164 3300013102 Bacteria 2580
138 Ga0157371_10306325 3300013102 Unclassified 1151
139 Ga0157371_10845283 3300013102 Unclassified 692
140 Ga0157370_10104205 3300013104 Bacteria 2655
141 Ga0157370_11415767 3300013104 Bacteria 625
142 Ga0157369_10512565 3300013105 Bacteria 1241
143 Ga0157374_10095907 3300013296 Unclassified 2837
144 Ga0157374_10110805 3300013296 Bacteria 2640
145 Ga0157374_10531776 3300013296 Bacteria 1182
146 Ga0157378_10034282 3300013297 Bacteria 4489
147 Ga0157378_10047044 3300013297 Bacteria 3835
148 Ga0157378_11252878 3300013297 Bacteria 782
149 Ga0157378_12756055 3300013297 Bacteria 544
150 Ga0163162_10000951 3300013306 Bacteria 26878
151 Ga0163162_10808166 3300013306 Unclassified 1055
152 Ga0157372_10156731 3300013307 Bacteria 2630
153 Ga0157372_10350066 3300013307 Bacteria 1721
154 Ga0157372_10902946 3300013307 Bacteria 1025
155 Ga0157372_11270553 3300013307 Bacteria 850
156 Ga0157372_11590614 3300013307 Unclassified 752
157 Ga0157375_10001239 3300013308 Bacteria 22051
158 Ga0157375_10645462 3300013308 Bacteria 1215
159 Ga0157375_12004220 3300013308 Unclassified 688
160 Ga0157375_12149996 3300013308 Unclassified 664
161 Ga0163163_10002503 3300014325 Bacteria 15547
162 Ga0163163_10006549 3300014325 Bacteria 10199
163 Ga0157380_10502626 3300014326 Bacteria 1178
164 Ga0157377_10014519 3300014745 Bacteria 4009
165 Ga0157379_10013411 3300014968 Bacteria 7180
166 Ga0157379_10260515 3300014968 Bacteria 1575
167 Ga0157379_10280886 3300014968 Bacteria 1515
168 Ga0157379_10304338 3300014968 Bacteria 1453
169 Ga0157376_10000221 3300014969 Bacteria 39575
170 Ga0157376_10266854 3300014969 Bacteria 1606
171 Ga0163161_10060993 3300017792 Bacteria 2746
172 Ga0163161_10118198 3300017792 Bacteria 1989
173 Ga0207697_10060079 3300025315 Bacteria 1580
174 Ga0207656_10107003 3300025321 Bacteria 1288
175 Ga0207656_10107440 3300025321 Bacteria 1286
176 Ga0207642_10093263 3300025899 Unclassified 1493
177 Ga0207642_10184163 3300025899 Bacteria 1140
178 Ga0207642_10862766 3300025899 Unclassified 578
179 Ga0207710_10000352 3300025900 Bacteria 33079
180 Ga0207688_10009492 3300025901 Bacteria 5295
181 Ga0207680_10348870 3300025903 Bacteria 1039
182 Ga0207647_10137722 3300025904 Bacteria 1432
183 Ga0207645_10000174 3300025907 Bacteria 51463
184 Ga0207645_10099476 3300025907 Bacteria 1875
185 Ga0207705_10070688 3300025909 Bacteria 2530
186 Ga0207654_10096607 3300025911 Bacteria 1812
187 Ga0207654_11307491 3300025911 Bacteria 529
188 Ga0207660_11318508 3300025917 Unclassified 586
189 Ga0207662_10143816 3300025918 Bacteria 1512
190 Ga0207657_10308387 3300025919 Bacteria 1253
191 Ga0207681_10128502 3300025923 Bacteria 1870
192 Ga0207650_10004181 3300025925 Bacteria 9863
193 Ga0207650_10056844 3300025925 Bacteria 2908
194 Ga0207650_10095176 3300025925 Bacteria 2283
195 Ga0207650_10108414 3300025925 Bacteria 2146
196 Ga0207650_10116041 3300025925 Bacteria 2079
197 Ga0207650_10760252 3300025925 Bacteria 820
198 Ga0207659_10175805 3300025926 Bacteria 1692
199 Ga0207659_10701618 3300025926 Bacteria 866
200 Ga0207659_10882676 3300025926 Bacteria 769
201 Ga0207644_10036054 3300025931 Bacteria 3470
202 Ga0207644_10292644 3300025931 Bacteria 1310
203 Ga0207644_10406660 3300025931 Bacteria 1113
204 Ga0207686_10190027 3300025934 Bacteria 1463
205 Ga0207709_10110310 3300025935 Bacteria 1838
206 Ga0207670_10467946 3300025936 Bacteria 1019
207 Ga0207670_10643321 3300025936 Unclassified 874
208 Ga0207669_10046526 3300025937 Bacteria 2564
209 Ga0207669_10230442 3300025937 Bacteria 1366
210 Ga0207704_10023560 3300025938 Bacteria 3321
211 Ga0207704_10404355 3300025938 Bacteria 1078
212 Ga0207704_10596818 3300025938 Unclassified 903
213 Ga0207704_10986323 3300025938 Bacteria 712
214 Ga0207691_10037790 3300025940 Bacteria 4469
215 Ga0207691_10103010 3300025940 Bacteria 2545
216 Ga0207711_10128073 3300025941 Bacteria 2273
217 Ga0207689_10001741 3300025942 Bacteria 20541
218 Ga0207689_10013336 3300025942 Bacteria 7012
219 Ga0207689_10136367 3300025942 Bacteria 2021
220 Ga0207661_10096778 3300025944 Bacteria 2470
221 Ga0207679_10048250 3300025945 Bacteria 3099
222 Ga0207679_10085580 3300025945 Bacteria 2422
223 Ga0207679_10780993 3300025945 Bacteria 870
224 Ga0207651_10163126 3300025960 Bacteria 1749
225 Ga0207712_10078204 3300025961 Bacteria 2400
226 Ga0207712_10661197 3300025961 Bacteria 909
227 Ga0207668_10113409 3300025972 Bacteria 2038
228 Ga0207668_10151329 3300025972 Bacteria 1797
229 Ga0207668_11421922 3300025972 Unclassified 625
230 Ga0207640_10087077 3300025981 Bacteria 2152
231 Ga0207640_10806938 3300025981 Bacteria 813
232 Ga0207658_10190521 3300025986 Unclassified 1704
233 Ga0207658_10573048 3300025986 Unclassified 1012
234 Ga0207677_10013093 3300026023 Bacteria 4794
235 Ga0207677_10179859 3300026023 Unclassified 1663
236 Ga0207677_10195386 3300026023 Bacteria 1604
237 Ga0207703_10542566 3300026035 Bacteria 1096
238 Ga0207639_10038491 3300026041 Bacteria 3558
239 Ga0207639_10369873 3300026041 Bacteria 1285
240 Ga0207639_10564780 3300026041 Bacteria 1046
241 Ga0207678_11248348 3300026067 Bacteria 658
242 Ga0207702_11813054 3300026078 Bacteria 602
243 Ga0207641_10021463 3300026088 Bacteria 5306
244 Ga0207641_10145129 3300026088 Unclassified 2145
245 Ga0207641_10397700 3300026088 Bacteria 1322
246 Ga0207648_10000479 3300026089 Bacteria 44522
247 Ga0207648_10012535 3300026089 Bacteria 7933
248 Ga0207648_10343639 3300026089 Bacteria 1344
249 Ga0207676_10035984 3300026095 Unclassified 3763
250 Ga0207674_10060257 3300026116 Bacteria 3839
251 Ga0207674_10227768 3300026116 Bacteria 1812
252 Ga0207674_11070189 3300026116 Bacteria 776
253 Ga0207675_100044726 3300026118 Bacteria 4138
254 Ga0207675_100076479 3300026118 Bacteria 3135
255 Ga0207675_100301745 3300026118 Bacteria 1560
256 Ga0207683_10000349 3300026121 Bacteria 42155
257 Ga0207683_10880483 3300026121 Bacteria 831
258 Ga0207698_10112746 3300026142 Unclassified 2283
259 Ga0207698_10208852 3300026142 Bacteria 1755
260 Ga0209974_10026812 3300027876 Bacteria 1906
261 Ga0268266_10115671 3300028379 Bacteria 2381
262 Ga0268265_10085315 3300028380 Bacteria 2506
263 Ga0268265_10216734 3300028380 Bacteria 1672
264 Ga0268265_10525791 3300028380 Bacteria 1119
265 Ga0268265_11586613 3300028380 Bacteria 659
266 Ga0268264_10019980 3300028381 Bacteria 5472
267 Ga0268264_10083216 3300028381 Bacteria 2741
268 Ga0268264_11178877 3300028381 Bacteria 775
269 Ga0307513_10383699 3300031456 Bacteria 1144
270 Ga0307408_100252273 3300031548 Bacteria 1456
271 Ga0307408_100601671 3300031548 Bacteria 977
272 Ga0307516_10195095 3300031730 Bacteria 1748
273 Ga0307516_10437783 3300031730 Bacteria 964
274 Ga0307405_10165339 3300031731 Bacteria 1572
275 Ga0307410_10077316 3300031852 Bacteria 2326
276 Ga0307406_10440267 3300031901 Bacteria 1043
277 Ga0307406_11659880 3300031901 Bacteria 566
278 Ga0307406_11705845 3300031901 Bacteria 558
279 Ga0307407_10846370 3300031903 Bacteria 699
280 Ga0307412_10575680 3300031911 Bacteria 950
281 Ga0307412_10652054 3300031911 Unclassified 898
282 Ga0307409_100145176 3300031995 Bacteria 2051
283 Ga0307416_100660038 3300032002 Bacteria 1131
284 Ga0307416_101708844 3300032002 Unclassified 734
285 Ga0307414_10589112 3300032004 Unclassified 996
286 Ga0307411_10062374 3300032005 Bacteria 2486
287 Ga0307411_10245726 3300032005 Bacteria 1404
288 Ga0307411_10486570 3300032005 Bacteria 1040
289 Ga0307411_12157113 3300032005 Unclassified 522
290 Ga0395900_0050282 3300037418 Bacteria 4294
291 Ga0395900_0296326 3300037418 Bacteria 1605
292 Ga0395898_0132010 3300037466 Bacteria 2392
293 Ga0395905_0000509 3300037471 Bacteria 53346
294 Ga0395901_0483891 3300038443 Bacteria 1262
295 Ga0436365_0839862 3300039437 Unclassified 679
296 Ga0439439_0029341 3300041406 Unclassified 1396
297 Ga0451802_1226740 3300041460 Unclassified 589
298 Ga0451807_0724230 3300041486 Unclassified 578
299 Ga0451837_1460602 3300041494 Bacteria 518
300 Ga0451843_1717459 3300041509 Bacteria 686
301 Ga0439431_0102780 3300041997 Unclassified 786
302 Ga0439442_026910 3300042002 Bacteria 1198
303 Ga0450923_119418 3300042125 Bacteria 621
304 Ga0450897_031075 3300042128 Bacteria 604
305 Ga0450898_000671 3300042134 Bacteria 4121
306 Ga0439446_0300030 3300042156 Bacteria 564
307 Ga0439434_0042300 3300042435 Bacteria 1401
308 Ga0451577_0725334 3300042876 Unclassified 900
309 Ga0466972_0065111 3300044658 Bacteria 1744
310 Ga0453683_0347115 3300044673 Unclassified 953
311 Ga0453684_0990601 3300044712 Bacteria 894
312 Ga0466967_1249809 3300045976 Unclassified 740
313 Ga0495638_0024177 3300046460 Bacteria 3965
314 Ga0495643_0035714 3300046522 Bacteria 2735
315 Ga0495611_0101289 3300046648 Bacteria 1337
316 Ga0495672_0006319 3300047320 Bacteria 9212
317 Ga0495672_0051237 3300047320 Bacteria 2432
318 Ga0495686_0030902 3300047472 Bacteria 3476
319 Ga0495686_0047203 3300047472 Bacteria 2720
320 Ga0496101_0050768 3300048904 Bacteria 2987
321 Ga0496104_0729623 3300048907 Unclassified 898
322 Ga0496106_0779612 3300048909 Bacteria 759
323 Ga0501290_027975 3300049513 Bacteria 797
324 Ga0501296_065920 3300049519 Unclassified 555
325 Ga0501296_072276 3300049519 Unclassified 537
326 Ga0501298_002774 3300049521 Bacteria 2679
327 Ga0501299_054583 3300049522 Unclassified 833
328 Ga0501031_0025910 3300049568 Bacteria 3825
329 Ga0501032_0005427 3300049569 Bacteria 9476
330 Ga0501032_0039500 3300049569 Bacteria 3210
331 Ga0501034_0002458 3300049571 Bacteria 22331
332 Ga0501036_0041710 3300049572 Bacteria 3883
333 Ga0501036_0212672 3300049572 Bacteria 1624
334 Ga0501037_0227229 3300049573 Unclassified 1311
335 Ga0501038_0032641 3300049574 Bacteria 4592
336 Ga0501039_0010204 3300049575 Bacteria 7157
337 Ga0501039_0022474 3300049575 Bacteria 4842
338 Ga0501042_0519592 3300049578 Bacteria 865
339 Ga0501043_0016486 3300049579 Bacteria 5791
340 Ga0501043_0017398 3300049579 Bacteria 5635
341 Ga0501046_0023437 3300049580 Bacteria 5078
342 Ga0501047_0024377 3300049581 Bacteria 5807
343 Ga0501047_0729977 3300049581 Bacteria 807
344 Ga0501048_0551601 3300049582 Bacteria 827
345 Ga0501070_0058088 3300049586 Bacteria 3207
346 Ga0501072_0612481 3300049588 Bacteria 858
347 Ga0501073_0010670 3300049589 Bacteria 6726
348 Ga0501073_0145885 3300049589 Bacteria 1640
349 Ga0501073_0627618 3300049589 Unclassified 742
350 Ga0501074_0177549 3300049590 Bacteria 1519
351 Ga0501202_001022 3300049652 Bacteria 4345
352 Ga0501202_010051 3300049652 Bacteria 1748
353 Ga0501202_054782 3300049652 Bacteria 890
354 Ga0501207_001286 3300049654 Bacteria 3111
355 Ga0501208_106055 3300049655 Bacteria 607
356 Ga0501217_001905 3300049661 Bacteria 4003
357 Ga0501217_007513 3300049661 Bacteria 2339
358 Ga0501217_011461 3300049661 Bacteria 1962
359 Ga0501217_059387 3300049661 Unclassified 1018
360 Ga0501222_000764 3300049662 Bacteria 4648
361 Ga0501222_032924 3300049662 Bacteria 717
362 Ga0501223_002665 3300049663 Bacteria 3932
363 Ga0501223_016692 3300049663 Bacteria 1451
364 Ga0501224_002895 3300049664 Bacteria 2369
365 Ga0501233_011397 3300049668 Bacteria 1767
366 Ga0501235_003136 3300049669 Bacteria 3563
367 Ga0501235_010314 3300049669 Unclassified 2043
368 Ga0501235_015278 3300049669 Bacteria 1693
369 Ga0501239_071001 3300049672 Unclassified 542
370 Ga0501242_020468 3300049674 Unclassified 850
371 Ga0501242_049583 3300049674 Unclassified 613
372 Ga0501243_000064 3300049675 Bacteria 10452
373 Ga0501243_092474 3300049675 Unclassified 602
374 Ga0501249_096139 3300049679 Unclassified 706
375 Ga0501250_001023 3300049680 Bacteria 2155
376 Ga0501252_002948 3300049682 Bacteria 1723
377 Ga0501257_019982 3300049686 Bacteria 1569
378 Ga0501257_077999 3300049686 Unclassified 852
379 Ga0501259_001703 3300049688 Bacteria 3657
380 Ga0501221_001628 3300049704 Bacteria 3732
381 Ga0501225_0002808 3300049705 Bacteria 5351
382 Ga0501225_0105096 3300049705 Unclassified 828
383 Ga0501229_035983 3300049706 Unclassified 693
384 Ga0501234_002734 3300049707 Bacteria 2778
385 Ga0501234_057536 3300049707 Unclassified 655
386 Ga0501245_002214 3300049708 Bacteria 2587
387 Ga0501245_014721 3300049708 Bacteria 1170
388 Ga0501245_138048 3300049708 Unclassified 528
389 Ga0501080_0048501 3300049742 Bacteria 3952
390 Ga0501080_0819004 3300049742 Bacteria 816
391 Ga0501080_0820774 3300049742 Bacteria 814
392 Ga0501083_0005031 3300049744 Bacteria 9362
393 Ga0501232_003975 3300049757 Bacteria 1384
394 Ga0501232_030850 3300049757 Bacteria 744
395 Ga0501266_004359 3300049763 Bacteria 1753
396 Ga0501268_002590 3300049765 Bacteria 2394
397 Ga0501268_010935 3300049765 Bacteria 1423
398 Ga0501269_009637 3300049766 Unclassified 1171
399 Ga0501270_022799 3300049767 Unclassified 970
400 Ga0501035_0038124 3300049822 Bacteria 4352
401 Ga0501044_0003711 3300049823 Bacteria 17152
402 Ga0501044_0008589 3300049823 Bacteria 11188
403 Ga0501212_026755 3300049851 Bacteria 915
404 nmdc:mga0k408_32704_c1 3300050493 Bacteria 2971
405 nmdc:mga0k408_436664_c1 3300050493 Bacteria 778
406 nmdc:mga0k408_54264_c1 3300050493 Unclassified 1231
407 Ga0500641_0014843 3300053096 Bacteria 2880
408 Ga0500568_0001078 3300053139 Bacteria 18433
409 Ga0500611_000002 3300053727 Bacteria 345991
410 Ga0501082_0600586 3300060353 Bacteria 963
411 Ga0207675_100005846
412 MRS1b_contig_5809440
413 JGI24744J21845_10015017
414 JGI24751J29686_10000772
415 rootH2_10166393
416 rootH2_10219491
417 rootL2_10279768
418 rootH1_10267672
419 Ga0065712_10020440
420 Ga0065712_10171991
421 Ga0065712_10209652
422 Ga0070658_10082699
423 Ga0070676_10014586
424 Ga0070676_10456802
425 Ga0070683_100030002
426 Ga0070683_100660043
427 Ga0070683_100707286
428 Ga0070670_100008042
429 Ga0070670_100028055
430 Ga0070670_100042933
431 Ga0070670_100063511
432 Ga0070670_100117584
433 Ga0070670_100158711
434 Ga0070670_101105629
435 Ga0070670_101350128
436 Ga0070677_10092984
437 Ga0070677_10125825
438 Ga0068869_100007967
439 Ga0068869_100028124
440 Ga0068869_100032320
441 Ga0070666_10074320
442 Ga0070682_100709912
443 Ga0068868_100024419
444 Ga0070660_100311960
445 Ga0070689_100447655
446 Ga0070689_101256009
447 Ga0070687_100181051
448 Ga0070687_101125575
449 Ga0070661_100075441
450 Ga0070661_101156830
451 Ga0070668_100079125
452 Ga0070668_100681089
453 Ga0070669_100007903
454 Ga0070675_100193385
455 Ga0070675_100393868
456 Ga0070671_100032017
457 Ga0070671_100046397
458 Ga0070674_100026419
459 Ga0070674_100257046
460 Ga0070673_100006820
461 Ga0070667_100116398
462 Ga0070667_100386145
463 Ga0070667_100398005
464 Ga0070667_100437882
465 Ga0070708_100361977
466 Ga0070663_101310122
467 Ga0070678_100001168
468 Ga0070678_100396260
469 Ga0070662_101305727
470 Ga0068867_100024007
471 Ga0068867_100059460
472 Ga0068867_100473294
473 Ga0068867_101663223
474 Ga0070684_101118205
475 Ga0068853_100045327
476 Ga0068853_100428574
477 Ga0070672_100054477
478 Ga0070672_100191506
479 Ga0070665_100037088
480 Ga0070664_100006075
481 Ga0070664_100023668
482 Ga0070664_100337142
483 Ga0070664_100662637
484 Ga0068857_100053347
485 Ga0068857_100220639
486 Ga0068857_100261642
487 Ga0068857_101414730
488 Ga0068854_100053598
489 Ga0068854_100071388
490 Ga0068854_100725666
491 Ga0068854_101248799
492 Ga0068852_100020748
493 Ga0068852_100268401
494 Ga0068852_101349605
495 Ga0068859_100008262
496 Ga0068859_100485429
497 Ga0068859_101622319
498 Ga0068864_100079743
499 Ga0068864_100471101
500 Ga0068864_100950502
501 Ga0068866_10010738
502 Ga0068866_10059633
503 Ga0068866_10943651
504 Ga0068861_100428909
505 Ga0068861_100506051
506 Ga0068861_101513231
507 Ga0068851_10017160
508 Ga0068851_10030970
509 Ga0068863_100132513
510 Ga0068863_100408859
511 Ga0068858_100598604
512 Ga0068860_100268250
513 Ga0068860_100554611
514 Ga0068862_100136723
515 Ga0068862_100521611
516 Ga0075366_10025936
517 Ga0075366_10059762
518 Ga0097621_100003051
519 Ga0097621_100065274
520 Ga0097621_100108461
521 Ga0068871_100000757
522 Ga0068871_100012971
523 Ga0068865_100014622
524 Ga0068865_100129747
525 Ga0068865_102103343
526 Ga0097620_100008262
527 Ga0097620_100485393
528 Ga0097620_101622454
529 Ga0105247_10000597
530 Ga0105243_10314960
531 Ga0105243_10762044
532 Ga0105241_10152782
533 Ga0105242_11292564
534 Ga0105248_10029757
535 Ga0105248_12461415
536 Ga0105237_10022870
537 Ga0105249_10005022
538 Ga0105249_10006600
539 Ga0105249_10207287
540 Ga0105249_10628589
541 Ga0105249_10852864
542 Ga0105249_12979863
543 Ga0105246_10006299
544 Ga0105246_10356403
545 Ga0105246_10784834
546 Ga0157373_10009632
547 Ga0157371_10065164
548 Ga0157371_10306325
549 Ga0157371_10845283
550 Ga0157370_10104205
551 Ga0157370_11415767
552 Ga0157369_10512565
553 Ga0157374_10095907
554 Ga0157374_10110805
555 Ga0157374_10531776
556 Ga0157378_10034282
557 Ga0157378_10047044
558 Ga0157378_11252878
559 Ga0157378_12756055
560 Ga0163162_10000951
561 Ga0163162_10808166
562 Ga0157372_10156731
563 Ga0157372_10350066
564 Ga0157372_10902946
565 Ga0157372_11270553
566 Ga0157372_11590614
567 Ga0157375_10001239
568 Ga0157375_10645462
569 Ga0157375_12004220
570 Ga0157375_12149996
571 Ga0163163_10002503
572 Ga0163163_10006549
573 Ga0157380_10502626
574 Ga0157377_10014519
575 Ga0157379_10013411
576 Ga0157379_10260515
577 Ga0157379_10280886
578 Ga0157379_10304338
579 Ga0157376_10000221
580 Ga0157376_10266854
581 Ga0163161_10060993
582 Ga0163161_10118198
583 Ga0207697_10060079
584 Ga0207656_10107003
585 Ga0207656_10107440
586 Ga0207642_10093263
587 Ga0207642_10184163
588 Ga0207642_10862766
589 Ga0207710_10000352
590 Ga0207688_10009492
591 Ga0207680_10348870
592 Ga0207647_10137722
593 Ga0207645_10000174
594 Ga0207645_10099476
595 Ga0207705_10070688
596 Ga0207654_10096607
597 Ga0207654_11307491
598 Ga0207660_11318508
599 Ga0207662_10143816
600 Ga0207657_10308387
601 Ga0207681_10128502
602 Ga0207650_10004181
603 Ga0207650_10056844
604 Ga0207650_10095176
605 Ga0207650_10108414
606 Ga0207650_10116041
607 Ga0207650_10760252
608 Ga0207659_10175805
609 Ga0207659_10701618
610 Ga0207659_10882676
611 Ga0207644_10036054
612 Ga0207644_10292644
613 Ga0207644_10406660
614 Ga0207686_10190027
615 Ga0207709_10110310
616 Ga0207670_10467946
617 Ga0207670_10643321
618 Ga0207669_10046526
619 Ga0207669_10230442
620 Ga0207704_10023560
621 Ga0207704_10404355
622 Ga0207704_10596818
623 Ga0207704_10986323
624 Ga0207691_10037790
625 Ga0207691_10103010
626 Ga0207711_10128073
627 Ga0207689_10001741
628 Ga0207689_10013336
629 Ga0207689_10136367
630 Ga0207661_10096778
631 Ga0207679_10048250
632 Ga0207679_10085580
633 Ga0207679_10780993
634 Ga0207651_10163126
635 Ga0207712_10078204
636 Ga0207712_10661197
637 Ga0207668_10113409
638 Ga0207668_10151329
639 Ga0207668_11421922
640 Ga0207640_10087077
641 Ga0207640_10806938
642 Ga0207658_10190521
643 Ga0207658_10573048
644 Ga0207677_10013093
645 Ga0207677_10179859
646 Ga0207677_10195386
647 Ga0207703_10542566
648 Ga0207639_10038491
649 Ga0207639_10369873
650 Ga0207639_10564780
651 Ga0207678_11248348
652 Ga0207702_11813054
653 Ga0207641_10021463
654 Ga0207641_10145129
655 Ga0207641_10397700
656 Ga0207648_10000479
657 Ga0207648_10012535
658 Ga0207648_10343639
659 Ga0207676_10035984
660 Ga0207674_10060257
661 Ga0207674_10227768
662 Ga0207674_11070189
663 Ga0207675_100044726
664 Ga0207675_100076479
665 Ga0207675_100301745
666 Ga0207683_10000349
667 Ga0207683_10880483
668 Ga0207698_10112746
669 Ga0207698_10208852
670 Ga0209974_10026812
671 Ga0268266_10115671
672 Ga0268265_10085315
673 Ga0268265_10216734
674 Ga0268265_10525791
675 Ga0268265_11586613
676 Ga0268264_10019980
677 Ga0268264_10083216
678 Ga0268264_11178877
679 Ga0307513_10383699
680 Ga0307408_100252273
681 Ga0307408_100601671
682 Ga0307516_10195095
683 Ga0307516_10437783
684 Ga0307405_10165339
685 Ga0307410_10077316
686 Ga0307406_10440267
687 Ga0307406_11659880
688 Ga0307406_11705845
689 Ga0307407_10846370
690 Ga0307412_10575680
691 Ga0307412_10652054
692 Ga0307409_100145176
693 Ga0307416_100660038
694 Ga0307416_101708844
695 Ga0307414_10589112
696 Ga0307411_10062374
697 Ga0307411_10245726
698 Ga0307411_10486570
699 Ga0307411_12157113
700 Ga0395900_0050282
701 Ga0395900_0296326
702 Ga0395898_0132010
703 Ga0395905_0000509
704 Ga0395901_0483891
705 Ga0436365_0839862
706 Ga0439439_0029341
707 Ga0451802_1226740
708 Ga0451807_0724230
709 Ga0451837_1460602
710 Ga0451843_1717459
711 Ga0439431_0102780
712 Ga0439442_026910
713 Ga0450923_119418
714 Ga0450897_031075
715 Ga0450898_000671
716 Ga0439446_0300030
717 Ga0439434_0042300
718 Ga0451577_0725334
719 Ga0466972_0065111
720 Ga0453683_0347115
721 Ga0453684_0990601
722 Ga0466967_1249809
723 Ga0495638_0024177
724 Ga0495643_0035714
725 Ga0495611_0101289
726 Ga0495672_0006319
727 Ga0495672_0051237
728 Ga0495686_0030902
729 Ga0495686_0047203
730 Ga0496101_0050768
731 Ga0496104_0729623
732 Ga0496106_0779612
733 Ga0501290_027975
734 Ga0501296_065920
735 Ga0501296_072276
736 Ga0501298_002774
737 Ga0501299_054583
738 Ga0501031_0025910
739 Ga0501032_0005427
740 Ga0501032_0039500
741 Ga0501034_0002458
742 Ga0501036_0041710
743 Ga0501036_0212672
744 Ga0501037_0227229
745 Ga0501038_0032641
746 Ga0501039_0010204
747 Ga0501039_0022474
748 Ga0501042_0519592
749 Ga0501043_0016486
750 Ga0501043_0017398
751 Ga0501046_0023437
752 Ga0501047_0024377
753 Ga0501047_0729977
754 Ga0501048_0551601
755 Ga0501070_0058088
756 Ga0501072_0612481
757 Ga0501073_0010670
758 Ga0501073_0145885
759 Ga0501073_0627618
760 Ga0501074_0177549
761 Ga0501202_001022
762 Ga0501202_010051
763 Ga0501202_054782
764 Ga0501207_001286
765 Ga0501208_106055
766 Ga0501217_001905
767 Ga0501217_007513
768 Ga0501217_011461
769 Ga0501217_059387
770 Ga0501222_000764
771 Ga0501222_032924
772 Ga0501223_002665
773 Ga0501223_016692
774 Ga0501224_002895
775 Ga0501233_011397
776 Ga0501235_003136
777 Ga0501235_010314
778 Ga0501235_015278
779 Ga0501239_071001
780 Ga0501242_020468
781 Ga0501242_049583
782 Ga0501243_000064
783 Ga0501243_092474
784 Ga0501249_096139
785 Ga0501250_001023
786 Ga0501252_002948
787 Ga0501257_019982
788 Ga0501257_077999
789 Ga0501259_001703
790 Ga0501221_001628
791 Ga0501225_0002808
792 Ga0501225_0105096
793 Ga0501229_035983
794 Ga0501234_002734
795 Ga0501234_057536
796 Ga0501245_002214
797 Ga0501245_014721
798 Ga0501245_138048
799 Ga0501080_0048501
800 Ga0501080_0819004
801 Ga0501080_0820774
802 Ga0501083_0005031
803 Ga0501232_003975
804 Ga0501232_030850
805 Ga0501266_004359
806 Ga0501268_002590
807 Ga0501268_010935
808 Ga0501269_009637
809 Ga0501270_022799
810 Ga0501035_0038124
811 Ga0501044_0003711
812 Ga0501044_0008589
813 Ga0501212_026755
814 nmdc:mga0k408_32704_c1
815 nmdc:mga0k408_436664_c1
816 nmdc:mga0k408_54264_c1
817 Ga0500641_0014843
818 Ga0500568_0001078
819 Ga0500611_000002
820 Ga0501082_0600586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

32

163

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9589 4 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.946 1 135
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9291 4 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9261 1 135
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9183 4 135
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9562 1 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9291 4 135 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.929 1 135 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9103 5 135 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.903 4 134 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A090X5N0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9981 64 135 GO:0046872
GO:0070497
AF-A0A7C4YA94-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9933 18 137 GO:0046872
GO:0070497
AF-A0A2E1AVZ2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9924 4 135 GO:0008616
GO:0046872
GO:0070497
AF-A0A2M8JRD4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9918 4 135 GO:0008616
GO:0046872
GO:0070497
AF-A0A2G6FAJ3-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9915 4 135 GO:0008616
GO:0046872
GO:0070497

Map