F437272

General Info

Members Datasets Scaffolds Average Seq Length
410 233 820 86

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10413291|Ga0207712_104132913
Length 91
Sequence VGGRVTRPRLATGARLRYDEVREEHLLLIPEGAVKLNPTAAEVLELCDGERSMEEIVSALSERYDGADVRDDVTELVEGLAQRGLVIDAAE

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.05
Rhizosphere 89.02
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10413291 3300025961 Bacteria 1136
2 JGI25407J50210_10164732 3300003373 Bacteria 546
3 Ga0070676_10532084 3300005328 Bacteria 839
4 Ga0070690_100551811 3300005330 Bacteria 869
5 Ga0070670_101648949 3300005331 Bacteria 590
6 Ga0068869_100110593 3300005334 Bacteria 2090
7 Ga0070666_11510055 3300005335 Bacteria 503
8 Ga0070680_101510537 3300005336 Bacteria 582
9 Ga0070682_100514869 3300005337 Bacteria 930
10 Ga0070682_101173345 3300005337 Bacteria 647
11 Ga0068868_100430696 3300005338 Bacteria 1144
12 Ga0070660_100314775 3300005339 Bacteria 1285
13 Ga0070660_101230172 3300005339 Bacteria 635
14 Ga0070660_101406244 3300005339 Bacteria 593
15 Ga0070692_10775204 3300005345 Bacteria 652
16 Ga0070692_11212869 3300005345 Bacteria 538
17 Ga0070692_11310569 3300005345 Bacteria 520
18 Ga0070671_100950703 3300005355 Bacteria 752
19 Ga0070674_100300855 3300005356 Bacteria 1279
20 Ga0070674_101246023 3300005356 Bacteria 662
21 Ga0070673_101159763 3300005364 Bacteria 723
22 Ga0070688_100466463 3300005365 Bacteria 947
23 Ga0070709_10976449 3300005434 Bacteria 673
24 Ga0070713_100597393 3300005436 Bacteria 1048
25 Ga0070710_10195660 3300005437 Bacteria 1274
26 Ga0070701_10650412 3300005438 Bacteria 704
27 Ga0070701_10842384 3300005438 Bacteria 629
28 Ga0070701_10941661 3300005438 Bacteria 599
29 Ga0070711_101492217 3300005439 Bacteria 590
30 Ga0070705_100566035 3300005440 Bacteria 874
31 Ga0070700_100154752 3300005441 Bacteria 1572
32 Ga0070700_100460384 3300005441 Bacteria 970
33 Ga0070700_101365103 3300005441 Bacteria 598
34 Ga0070694_101866469 3300005444 Bacteria 513
35 Ga0070678_100976543 3300005456 Bacteria 777
36 Ga0070662_100402616 3300005457 Bacteria 1130
37 Ga0070662_100588849 3300005457 Bacteria 935
38 Ga0070662_100821425 3300005457 Bacteria 791
39 Ga0070662_101489192 3300005457 Bacteria 584
40 Ga0070681_10917199 3300005458 Bacteria 795
41 Ga0070681_11719397 3300005458 Bacteria 554
42 Ga0068867_100973448 3300005459 Bacteria 768
43 Ga0070685_10943013 3300005466 Bacteria 644
44 Ga0070679_101031417 3300005530 Bacteria 767
45 Ga0070679_101398585 3300005530 Bacteria 646
46 Ga0070684_100158029 3300005535 Bacteria 2056
47 Ga0070684_100395437 3300005535 Bacteria 1274
48 Ga0068853_101960122 3300005539 Bacteria 568
49 Ga0070686_100214775 3300005544 Bacteria 1387
50 Ga0070696_100412616 3300005546 Bacteria 1059
51 Ga0070704_101176423 3300005549 Bacteria 699
52 Ga0070664_100092013 3300005564 Bacteria 2626
53 Ga0068857_100860637 3300005577 Bacteria 868
54 Ga0068857_101104593 3300005577 Bacteria 766
55 Ga0068854_101539260 3300005578 Unclassified 604
56 Ga0068856_100217074 3300005614 Bacteria 1928
57 Ga0068856_100702351 3300005614 Bacteria 1032
58 Ga0068856_100976256 3300005614 Bacteria 866
59 Ga0068856_101028944 3300005614 Bacteria 842
60 Ga0070702_100016670 3300005615 Bacteria 3774
61 Ga0068852_101150345 3300005616 Unclassified 797
62 Ga0068852_101773433 3300005616 Bacteria 640
63 Ga0068852_102618427 3300005616 Bacteria 524
64 Ga0068864_101706423 3300005618 Bacteria 635
65 Ga0068866_10819026 3300005718 Bacteria 649
66 Ga0068866_10938963 3300005718 Bacteria 611
67 Ga0068861_100012298 3300005719 Bacteria 5970
68 Ga0068861_100633179 3300005719 Bacteria 986
69 Ga0068861_101138480 3300005719 Bacteria 752
70 Ga0068851_10212953 3300005834 Bacteria 1083
71 Ga0068858_100176882 3300005842 Bacteria 2014
72 Ga0068858_100651217 3300005842 Bacteria 1024
73 Ga0068858_101777886 3300005842 Bacteria 609
74 Ga0081455_10062532 3300005937 Bacteria 3128
75 Ga0081455_10153151 3300005937 Bacteria 1775
76 Ga0081455_10208785 3300005937 Bacteria 1456
77 Ga0081455_10282815 3300005937 Bacteria 1198
78 Ga0081538_10000397 3300005981 Bacteria 49637
79 Ga0081538_10002546 3300005981 Bacteria 17728
80 Ga0081538_10003581 3300005981 Bacteria 14605
81 Ga0081538_10012197 3300005981 Bacteria 6905
82 Ga0081538_10022436 3300005981 Bacteria 4573
83 Ga0081538_10030133 3300005981 Bacteria 3690
84 Ga0081538_10053997 3300005981 Bacteria 2381
85 Ga0081538_10082590 3300005981 Bacteria 1702
86 Ga0081538_10107861 3300005981 Bacteria 1377
87 Ga0081538_10205957 3300005981 Bacteria 800
88 Ga0081540_1000312 3300005983 Bacteria 50256
89 Ga0081540_1191696 3300005983 Bacteria 753
90 Ga0081540_1285620 3300005983 Bacteria 569
91 Ga0081539_10004305 3300005985 Bacteria 15916
92 Ga0070715_10233253 3300006163 Bacteria 953
93 Ga0070715_10489014 3300006163 Bacteria 702
94 Ga0070712_100451075 3300006175 Bacteria 1071
95 Ga0068871_101854782 3300006358 Unclassified 573
96 Ga0075428_100049486 3300006844 Bacteria 4611
97 Ga0075431_100316698 3300006847 Bacteria 1574
98 Ga0075431_100500262 3300006847 Bacteria 1207
99 Ga0075429_101573586 3300006880 Bacteria 571
100 Ga0068865_100016112 3300006881 Bacteria 4775
101 Ga0068865_102116095 3300006881 Bacteria 512
102 Ga0105240_11580484 3300009093 Bacteria 686
103 Ga0111539_10019012 3300009094 Bacteria 8493
104 Ga0111539_11281005 3300009094 Bacteria 851
105 Ga0105245_10499078 3300009098 Bacteria 1233
106 Ga0105245_11965947 3300009098 Bacteria 638
107 Ga0105245_12983184 3300009098 Bacteria 524
108 Ga0105247_11711061 3300009101 Unclassified 520
109 Ga0105247_11870602 3300009101 Bacteria 501
110 Ga0114129_10977358 3300009147 Bacteria 1068
111 Ga0114129_12217112 3300009147 Bacteria 661
112 Ga0105243_10225864 3300009148 Bacteria 1658
113 Ga0105243_10597402 3300009148 Bacteria 1062
114 Ga0105243_10660711 3300009148 Bacteria 1014
115 Ga0105243_10848270 3300009148 Bacteria 904
116 Ga0105242_12708264 3300009176 Unclassified 546
117 Ga0105248_12180335 3300009177 Bacteria 630
118 Ga0105248_13196053 3300009177 Bacteria 521
119 Ga0105238_11630753 3300009551 Bacteria 675
120 Ga0105249_11070977 3300009553 Bacteria 876
121 Ga0105249_12829113 3300009553 Bacteria 557
122 Ga0105239_12085865 3300010375 Bacteria 659
123 Ga0105239_12387950 3300010375 Bacteria 616
124 Ga0105239_12559755 3300010375 Bacteria 595
125 Ga0105246_11798055 3300011119 Bacteria 585
126 Ga0105246_11843436 3300011119 Bacteria 579
127 Ga0157369_12645672 3300013105 Bacteria 506
128 Ga0157374_11177023 3300013296 Bacteria 788
129 Ga0157378_10970591 3300013297 Bacteria 883
130 Ga0163162_10496396 3300013306 Bacteria 1351
131 Ga0163162_11916268 3300013306 Bacteria 678
132 Ga0163162_12233381 3300013306 Bacteria 628
133 Ga0157372_10433207 3300013307 Bacteria 1533
134 Ga0157372_10771846 3300013307 Bacteria 1117
135 Ga0157372_11766788 3300013307 Bacteria 711
136 Ga0157372_12140741 3300013307 Bacteria 643
137 Ga0157372_12188612 3300013307 Bacteria 635
138 Ga0157375_10406144 3300013308 Bacteria 1529
139 Ga0157375_10477825 3300013308 Bacteria 1411
140 Ga0163163_10264209 3300014325 Bacteria 1772
141 Ga0163163_10854806 3300014325 Bacteria 973
142 Ga0157380_10635770 3300014326 Bacteria 1062
143 Ga0157377_10217185 3300014745 Bacteria 1222
144 Ga0157377_10447915 3300014745 Bacteria 891
145 Ga0157379_12469841 3300014968 Bacteria 519
146 Ga0157376_12092854 3300014969 Bacteria 604
147 Ga0163161_11661564 3300017792 Bacteria 565
148 Ga0163161_11931615 3300017792 Unclassified 525
149 Ga0213876_10044551 3300021384 Bacteria 2345
150 Ga0213876_10093011 3300021384 Bacteria 1597
151 Ga0213875_10000286 3300021388 Bacteria 49191
152 Ga0213871_10236684 3300021441 Bacteria 577
153 Ga0207656_10155282 3300025321 Bacteria 1086
154 Ga0207692_10435699 3300025898 Bacteria 823
155 Ga0207692_10612775 3300025898 Bacteria 701
156 Ga0207642_10129449 3300025899 Bacteria 1315
157 Ga0207688_10116009 3300025901 Bacteria 1559
158 Ga0207688_10700830 3300025901 Bacteria 640
159 Ga0207688_10955205 3300025901 Bacteria 542
160 Ga0207685_10265575 3300025905 Bacteria 836
161 Ga0207699_10247429 3300025906 Bacteria 1227
162 Ga0207643_10605356 3300025908 Bacteria 705
163 Ga0207705_10959053 3300025909 Bacteria 661
164 Ga0207705_11259572 3300025909 Bacteria 566
165 Ga0207654_10730862 3300025911 Bacteria 712
166 Ga0207707_10464948 3300025912 Bacteria 1081
167 Ga0207663_11271817 3300025916 Bacteria 593
168 Ga0207660_11337211 3300025917 Bacteria 581
169 Ga0207662_10349920 3300025918 Bacteria 992
170 Ga0207657_10199881 3300025919 Bacteria 1608
171 Ga0207657_10482416 3300025919 Bacteria 972
172 Ga0207652_10476035 3300025921 Bacteria 1125
173 Ga0207681_10304908 3300025923 Bacteria 1261
174 Ga0207659_11395230 3300025926 Bacteria 601
175 Ga0207687_11281267 3300025927 Bacteria 630
176 Ga0207687_11450274 3300025927 Bacteria 590
177 Ga0207687_11470152 3300025927 Bacteria 585
178 Ga0207700_10418215 3300025928 Bacteria 1177
179 Ga0207690_10020818 3300025932 Bacteria 4059
180 Ga0207690_10153746 3300025932 Bacteria 1708
181 Ga0207690_10802868 3300025932 Bacteria 778
182 Ga0207706_10089685 3300025933 Bacteria 2703
183 Ga0207706_10288563 3300025933 Bacteria 1430
184 Ga0207706_10871341 3300025933 Bacteria 762
185 Ga0207706_11044018 3300025933 Unclassified 685
186 Ga0207686_10570737 3300025934 Bacteria 887
187 Ga0207686_10591363 3300025934 Bacteria 872
188 Ga0207709_10006789 3300025935 Bacteria 6403
189 Ga0207709_10160292 3300025935 Bacteria 1568
190 Ga0207670_10667773 3300025936 Bacteria 858
191 Ga0207704_10123806 3300025938 Bacteria 1775
192 Ga0207704_10638560 3300025938 Bacteria 876
193 Ga0207704_10766863 3300025938 Bacteria 803
194 Ga0207691_10992279 3300025940 Bacteria 701
195 Ga0207689_10046785 3300025942 Bacteria 3574
196 Ga0207689_10932274 3300025942 Bacteria 733
197 Ga0207689_11626644 3300025942 Bacteria 537
198 Ga0207661_10013518 3300025944 Bacteria 5961
199 Ga0207661_11559800 3300025944 Bacteria 605
200 Ga0207679_12007896 3300025945 Bacteria 526
201 Ga0207679_12138442 3300025945 Bacteria 508
202 Ga0207651_11004186 3300025960 Bacteria 746
203 Ga0207712_11199456 3300025961 Bacteria 677
204 Ga0207668_10166513 3300025972 Bacteria 1724
205 Ga0207640_10180096 3300025981 Bacteria 1584
206 Ga0207640_10320561 3300025981 Bacteria 1234
207 Ga0207640_10623873 3300025981 Bacteria 915
208 Ga0207640_12066157 3300025981 Bacteria 516
209 Ga0207658_10594589 3300025986 Bacteria 994
210 Ga0207677_10055296 3300026023 Bacteria 2713
211 Ga0207703_10436787 3300026035 Bacteria 1220
212 Ga0207639_10080440 3300026041 Bacteria 2577
213 Ga0207639_11513126 3300026041 Bacteria 630
214 Ga0207708_10165305 3300026075 Bacteria 1749
215 Ga0207708_10523749 3300026075 Bacteria 996
216 Ga0207702_10132998 3300026078 Bacteria 2240
217 Ga0207702_10230256 3300026078 Bacteria 1731
218 Ga0207702_10641023 3300026078 Bacteria 1044
219 Ga0207648_10362697 3300026089 Bacteria 1307
220 Ga0207648_12199546 3300026089 Unclassified 512
221 Ga0207674_10403290 3300026116 Bacteria 1321
222 Ga0207674_11013301 3300026116 Bacteria 799
223 Ga0207675_100005705 3300026118 Bacteria 11914
224 Ga0207698_10050583 3300026142 Bacteria 3171
225 Ga0207698_10350299 3300026142 Bacteria 1394
226 Ga0207428_10202117 3300027907 Bacteria 1495
227 Ga0268265_11697897 3300028380 Unclassified 637
228 Ga0268264_10930848 3300028381 Bacteria 873
229 Ga0307408_100021502 3300031548 Bacteria 4367
230 Ga0307408_101522075 3300031548 Bacteria 633
231 Ga0307405_10191261 3300031731 Bacteria 1478
232 Ga0307405_10402351 3300031731 Bacteria 1072
233 Ga0307405_10616193 3300031731 Bacteria 888
234 Ga0307413_10028402 3300031824 Bacteria 3115
235 Ga0307413_10381861 3300031824 Bacteria 1098
236 Ga0307413_10431308 3300031824 Bacteria 1041
237 Ga0307413_10682683 3300031824 Bacteria 851
238 Ga0307413_11040575 3300031824 Bacteria 704
239 Ga0307413_12103388 3300031824 Unclassified 510
240 Ga0307410_10012908 3300031852 Bacteria 4852
241 Ga0307410_11129706 3300031852 Bacteria 680
242 Ga0307406_10010919 3300031901 Bacteria 5137
243 Ga0307406_10022258 3300031901 Bacteria 3758
244 Ga0307406_10189043 3300031901 Bacteria 1506
245 Ga0307406_10355721 3300031901 Bacteria 1146
246 Ga0307406_11944558 3300031901 Unclassified 525
247 Ga0307407_10018455 3300031903 Bacteria 3529
248 Ga0307407_10088423 3300031903 Bacteria 1893
249 Ga0307407_10399431 3300031903 Bacteria 986
250 Ga0307407_10714249 3300031903 Bacteria 756
251 Ga0307407_11667722 3300031903 Bacteria 507
252 Ga0307412_10023054 3300031911 Bacteria 3826
253 Ga0307409_100097501 3300031995 Bacteria 2428
254 Ga0307409_100351107 3300031995 Bacteria 1392
255 Ga0307409_100366810 3300031995 Bacteria 1364
256 Ga0307409_100462921 3300031995 Bacteria 1226
257 Ga0307409_100964998 3300031995 Bacteria 869
258 Ga0307409_101060680 3300031995 Bacteria 830
259 Ga0307409_101238277 3300031995 Bacteria 770
260 Ga0307409_101655500 3300031995 Bacteria 668
261 Ga0307416_100002309 3300032002 Bacteria 10896
262 Ga0307416_100110753 3300032002 Bacteria 2418
263 Ga0307416_100753436 3300032002 Bacteria 1067
264 Ga0307416_101228825 3300032002 Bacteria 855
265 Ga0307416_102241639 3300032002 Bacteria 647
266 Ga0307416_102696037 3300032002 Bacteria 594
267 Ga0307414_10108104 3300032004 Bacteria 2109
268 Ga0307411_10296334 3300032005 Bacteria 1295
269 Ga0307411_10694622 3300032005 Bacteria 885
270 Ga0307411_12105767 3300032005 Bacteria 528
271 Ga0307415_100002027 3300032126 Bacteria 9981
272 Ga0307415_100025921 3300032126 Bacteria 3689
273 Ga0307415_100079499 3300032126 Bacteria 2336
274 Ga0307415_101156767 3300032126 Bacteria 727
275 Ga0373946_0134422 3300035171 Bacteria 1141
276 Ga0373925_0360085 3300037068 Bacteria 1182
277 Ga0395900_1702126 3300037418 Bacteria 542
278 Ga0395898_0747043 3300037466 Bacteria 920
279 Ga0395898_0806302 3300037466 Bacteria 879
280 Ga0395905_1274636 3300037471 Bacteria 639
281 Ga0436364_0125866 3300037853 Bacteria 1467
282 Ga0436364_1299740 3300037853 Bacteria 98238
283 Ga0395901_0411628 3300038443 Bacteria 1388
284 Ga0395901_0728316 3300038443 Bacteria 987
285 Ga0395901_1642325 3300038443 Bacteria 595
286 Ga0436365_0212994 3300039437 Bacteria 568
287 Ga0436365_0420551 3300039437 Bacteria 1639
288 Ga0436365_1608073 3300039437 Bacteria 6656
289 Ga0436360_0545149 3300039438 Bacteria 6092
290 Ga0436361_1110418 3300039447 Bacteria 1749
291 Ga0436363_0228184 3300039450 Bacteria 55094
292 Ga0436363_0431261 3300039450 Bacteria 852
293 Ga0436362_0052970 3300039453 Unclassified 607
294 Ga0436362_0707746 3300039453 Bacteria 3376
295 Ga0436362_1041411 3300039453 Unclassified 541
296 Ga0451853_3010019 3300041512 Bacteria 529
297 Ga0451853_3382222 3300041512 Bacteria 886
298 Ga0439448_0019599 3300042005 Bacteria 2085
299 Ga0466966_0571805 3300044684 Bacteria 680
300 Ga0466961_0433432 3300044693 Bacteria 796
301 Ga0466963_0043055 3300044694 Bacteria 2967
302 Ga0466971_0144457 3300044719 Bacteria 1109
303 Ga0466957_0423005 3300044842 Bacteria 914
304 Ga0466957_0456281 3300044842 Bacteria 881
305 Ga0466960_0901239 3300044901 Bacteria 539
306 Ga0466959_0836750 3300045049 Bacteria 615
307 Ga0466959_0863363 3300045049 Bacteria 604
308 Ga0466958_0193540 3300045836 Bacteria 1293
309 Ga0466958_0275943 3300045836 Bacteria 1077
310 Ga0466967_0532303 3300045976 Bacteria 1155
311 Ga0466967_0637760 3300045976 Bacteria 1053
312 Ga0466967_1204017 3300045976 Bacteria 755
313 Ga0466967_2369248 3300045976 Bacteria 526
314 Ga0495603_0058795 3300046455 Bacteria 2273
315 Ga0495641_0131054 3300046461 Bacteria 1119
316 Ga0495651_0544303 3300046462 Unclassified 738
317 Ga0495605_0068621 3300046474 Bacteria 1680
318 Ga0495639_0508060 3300046475 Bacteria 616
319 Ga0495639_0527564 3300046475 Bacteria 604
320 Ga0495664_0191201 3300046477 Bacteria 1241
321 Ga0495584_0068644 3300046491 Bacteria 1781
322 Ga0495596_0236057 3300046500 Bacteria 710
323 Ga0495616_0214257 3300046513 Bacteria 841
324 Ga0495620_0104359 3300046515 Bacteria 1128
325 Ga0495630_0463375 3300046517 Unclassified 971
326 Ga0495631_0091107 3300046518 Bacteria 1313
327 Ga0495637_0107239 3300046520 Bacteria 1086
328 Ga0495644_0059903 3300046523 Bacteria 1431
329 Ga0495652_0424684 3300046529 Bacteria 936
330 Ga0495640_0242159 3300046533 Bacteria 1132
331 Ga0495587_0466851 3300046536 Bacteria 699
332 Ga0495645_0287778 3300046543 Bacteria 1078
333 Ga0495633_0148991 3300046558 Bacteria 1081
334 Ga0495656_0059458 3300046615 Bacteria 1663
335 Ga0495661_0150942 3300046665 Bacteria 1255
336 Ga0495588_0219485 3300046674 Bacteria 1004
337 Ga0495658_0555587 3300046683 Bacteria 735
338 Ga0495669_0046354 3300046684 Bacteria 1940
339 Ga0495671_0140071 3300046692 Bacteria 1179
340 Ga0495589_0172425 3300046794 Bacteria 1028
341 Ga0495589_0392929 3300046794 Bacteria 637
342 Ga0495581_0875756 3300047315 Bacteria 513
343 Ga0495674_0356289 3300047319 Bacteria 1187
344 Ga0495679_190756 3300047446 Bacteria 541
345 Ga0495673_0338682 3300047469 Bacteria 533
346 Ga0496100_0007786 3300048903 Bacteria 5940
347 Ga0496100_0205724 3300048903 Bacteria 1437
348 Ga0496101_0003564 3300048904 Bacteria 9713
349 Ga0496101_0129849 3300048904 Bacteria 1913
350 Ga0496102_0445494 3300048905 Bacteria 1215
351 Ga0496102_0887599 3300048905 Bacteria 813
352 Ga0496103_0936663 3300048906 Bacteria 542
353 Ga0496103_1007533 3300048906 Bacteria 518
354 Ga0496104_0021967 3300048907 Bacteria 5862
355 Ga0496106_0017398 3300048909 Bacteria 5319
356 Ga0496106_0175628 3300048909 Bacteria 1699
357 Ga0496106_0310297 3300048909 Bacteria 1266
358 Ga0496107_0231620 3300048910 Bacteria 1375
359 Ga0496107_0828567 3300048910 Bacteria 676
360 Ga0496107_1282780 3300048910 Bacteria 524
361 Ga0496108_0011234 3300048911 Bacteria 7274
362 Ga0496108_0117563 3300048911 Bacteria 2278
363 Ga0496108_0136471 3300048911 Bacteria 2111
364 Ga0496108_0566155 3300048911 Bacteria 991
365 Ga0496109_0042981 3300048912 Bacteria 4096
366 Ga0496109_0092927 3300048912 Bacteria 2790
367 Ga0496110_0053440 3300048913 Bacteria 3551
368 Ga0496110_0138249 3300048913 Bacteria 2202
369 Ga0496110_0753359 3300048913 Bacteria 877
370 Ga0496111_0037084 3300048914 Bacteria 3489
371 Ga0496111_0295282 3300048914 Bacteria 1201
372 Ga0496112_0188510 3300048915 Bacteria 2025
373 Ga0496112_0852540 3300048915 Bacteria 834
374 Ga0496113_0076684 3300048916 Bacteria 2554
375 Ga0496113_0367599 3300048916 Bacteria 1154
376 Ga0496114_0221471 3300048917 Bacteria 1661
377 Ga0496115_0405783 3300048918 Bacteria 1105
378 Ga0496115_1295255 3300048918 Bacteria 543
379 Ga0501036_0136425 3300049572 Bacteria 2071
380 Ga0501039_0672480 3300049575 Bacteria 810
381 Ga0501040_0073008 3300049576 Bacteria 2370
382 Ga0501040_0700089 3300049576 Bacteria 733
383 Ga0501041_0178582 3300049577 Bacteria 1329
384 Ga0501042_0463302 3300049578 Bacteria 919
385 Ga0501043_1157315 3300049579 Bacteria 545
386 Ga0501069_0387689 3300049585 Bacteria 826
387 Ga0501069_0750735 3300049585 Bacteria 590
388 Ga0501069_0882949 3300049585 Bacteria 544
389 Ga0501071_0461754 3300049587 Bacteria 972
390 Ga0501074_0960944 3300049590 Bacteria 601
391 Ga0501075_0064749 3300049591 Bacteria 2757
392 Ga0501076_0007008 3300049592 Bacteria 8188
393 Ga0501076_1043646 3300049592 Bacteria 673
394 Ga0501077_0177888 3300049593 Bacteria 1352
395 Ga0501079_0037190 3300049741 Bacteria 3751
396 Ga0501080_0398120 3300049742 Bacteria 1239
397 Ga0501080_0997122 3300049742 Bacteria 727
398 Ga0501081_0200528 3300049743 Bacteria 1447
399 nmdc:mga05p37_1163066_c1 3300050507 Bacteria 801
400 nmdc:mga09592_46788_c1 3300050508 Bacteria 3644
401 nmdc:mga06r32_404527_c1 3300050510 Bacteria 1347
402 nmdc:mga06r32_493562_c1 3300050510 Bacteria 1202
403 nmdc:mga08y16_1042248_c1 3300050511 Bacteria 796
404 nmdc:mga08y16_139235_c1 3300050511 Bacteria 2523
405 nmdc:mga08y16_329657_c1 3300050511 Bacteria 1570
406 nmdc:mga0a205_1590076_c1 3300050515 Bacteria 502
407 Ga0495655_0154678 3300053083 Bacteria 724
408 Ga0501084_0106344 3300054114 Bacteria 2357
409 Ga0466962_0084758 3300061719 Bacteria 1517
410 Ga0530510_0020997 3300061734 Bacteria 4644
411 Ga0207712_10413291
412 JGI25407J50210_10164732
413 Ga0070676_10532084
414 Ga0070690_100551811
415 Ga0070670_101648949
416 Ga0068869_100110593
417 Ga0070666_11510055
418 Ga0070680_101510537
419 Ga0070682_100514869
420 Ga0070682_101173345
421 Ga0068868_100430696
422 Ga0070660_100314775
423 Ga0070660_101230172
424 Ga0070660_101406244
425 Ga0070692_10775204
426 Ga0070692_11212869
427 Ga0070692_11310569
428 Ga0070671_100950703
429 Ga0070674_100300855
430 Ga0070674_101246023
431 Ga0070673_101159763
432 Ga0070688_100466463
433 Ga0070709_10976449
434 Ga0070713_100597393
435 Ga0070710_10195660
436 Ga0070701_10650412
437 Ga0070701_10842384
438 Ga0070701_10941661
439 Ga0070711_101492217
440 Ga0070705_100566035
441 Ga0070700_100154752
442 Ga0070700_100460384
443 Ga0070700_101365103
444 Ga0070694_101866469
445 Ga0070678_100976543
446 Ga0070662_100402616
447 Ga0070662_100588849
448 Ga0070662_100821425
449 Ga0070662_101489192
450 Ga0070681_10917199
451 Ga0070681_11719397
452 Ga0068867_100973448
453 Ga0070685_10943013
454 Ga0070679_101031417
455 Ga0070679_101398585
456 Ga0070684_100158029
457 Ga0070684_100395437
458 Ga0068853_101960122
459 Ga0070686_100214775
460 Ga0070696_100412616
461 Ga0070704_101176423
462 Ga0070664_100092013
463 Ga0068857_100860637
464 Ga0068857_101104593
465 Ga0068854_101539260
466 Ga0068856_100217074
467 Ga0068856_100702351
468 Ga0068856_100976256
469 Ga0068856_101028944
470 Ga0070702_100016670
471 Ga0068852_101150345
472 Ga0068852_101773433
473 Ga0068852_102618427
474 Ga0068864_101706423
475 Ga0068866_10819026
476 Ga0068866_10938963
477 Ga0068861_100012298
478 Ga0068861_100633179
479 Ga0068861_101138480
480 Ga0068851_10212953
481 Ga0068858_100176882
482 Ga0068858_100651217
483 Ga0068858_101777886
484 Ga0081455_10062532
485 Ga0081455_10153151
486 Ga0081455_10208785
487 Ga0081455_10282815
488 Ga0081538_10000397
489 Ga0081538_10002546
490 Ga0081538_10003581
491 Ga0081538_10012197
492 Ga0081538_10022436
493 Ga0081538_10030133
494 Ga0081538_10053997
495 Ga0081538_10082590
496 Ga0081538_10107861
497 Ga0081538_10205957
498 Ga0081540_1000312
499 Ga0081540_1191696
500 Ga0081540_1285620
501 Ga0081539_10004305
502 Ga0070715_10233253
503 Ga0070715_10489014
504 Ga0070712_100451075
505 Ga0068871_101854782
506 Ga0075428_100049486
507 Ga0075431_100316698
508 Ga0075431_100500262
509 Ga0075429_101573586
510 Ga0068865_100016112
511 Ga0068865_102116095
512 Ga0105240_11580484
513 Ga0111539_10019012
514 Ga0111539_11281005
515 Ga0105245_10499078
516 Ga0105245_11965947
517 Ga0105245_12983184
518 Ga0105247_11711061
519 Ga0105247_11870602
520 Ga0114129_10977358
521 Ga0114129_12217112
522 Ga0105243_10225864
523 Ga0105243_10597402
524 Ga0105243_10660711
525 Ga0105243_10848270
526 Ga0105242_12708264
527 Ga0105248_12180335
528 Ga0105248_13196053
529 Ga0105238_11630753
530 Ga0105249_11070977
531 Ga0105249_12829113
532 Ga0105239_12085865
533 Ga0105239_12387950
534 Ga0105239_12559755
535 Ga0105246_11798055
536 Ga0105246_11843436
537 Ga0157369_12645672
538 Ga0157374_11177023
539 Ga0157378_10970591
540 Ga0163162_10496396
541 Ga0163162_11916268
542 Ga0163162_12233381
543 Ga0157372_10433207
544 Ga0157372_10771846
545 Ga0157372_11766788
546 Ga0157372_12140741
547 Ga0157372_12188612
548 Ga0157375_10406144
549 Ga0157375_10477825
550 Ga0163163_10264209
551 Ga0163163_10854806
552 Ga0157380_10635770
553 Ga0157377_10217185
554 Ga0157377_10447915
555 Ga0157379_12469841
556 Ga0157376_12092854
557 Ga0163161_11661564
558 Ga0163161_11931615
559 Ga0213876_10044551
560 Ga0213876_10093011
561 Ga0213875_10000286
562 Ga0213871_10236684
563 Ga0207656_10155282
564 Ga0207692_10435699
565 Ga0207692_10612775
566 Ga0207642_10129449
567 Ga0207688_10116009
568 Ga0207688_10700830
569 Ga0207688_10955205
570 Ga0207685_10265575
571 Ga0207699_10247429
572 Ga0207643_10605356
573 Ga0207705_10959053
574 Ga0207705_11259572
575 Ga0207654_10730862
576 Ga0207707_10464948
577 Ga0207663_11271817
578 Ga0207660_11337211
579 Ga0207662_10349920
580 Ga0207657_10199881
581 Ga0207657_10482416
582 Ga0207652_10476035
583 Ga0207681_10304908
584 Ga0207659_11395230
585 Ga0207687_11281267
586 Ga0207687_11450274
587 Ga0207687_11470152
588 Ga0207700_10418215
589 Ga0207690_10020818
590 Ga0207690_10153746
591 Ga0207690_10802868
592 Ga0207706_10089685
593 Ga0207706_10288563
594 Ga0207706_10871341
595 Ga0207706_11044018
596 Ga0207686_10570737
597 Ga0207686_10591363
598 Ga0207709_10006789
599 Ga0207709_10160292
600 Ga0207670_10667773
601 Ga0207704_10123806
602 Ga0207704_10638560
603 Ga0207704_10766863
604 Ga0207691_10992279
605 Ga0207689_10046785
606 Ga0207689_10932274
607 Ga0207689_11626644
608 Ga0207661_10013518
609 Ga0207661_11559800
610 Ga0207679_12007896
611 Ga0207679_12138442
612 Ga0207651_11004186
613 Ga0207712_11199456
614 Ga0207668_10166513
615 Ga0207640_10180096
616 Ga0207640_10320561
617 Ga0207640_10623873
618 Ga0207640_12066157
619 Ga0207658_10594589
620 Ga0207677_10055296
621 Ga0207703_10436787
622 Ga0207639_10080440
623 Ga0207639_11513126
624 Ga0207708_10165305
625 Ga0207708_10523749
626 Ga0207702_10132998
627 Ga0207702_10230256
628 Ga0207702_10641023
629 Ga0207648_10362697
630 Ga0207648_12199546
631 Ga0207674_10403290
632 Ga0207674_11013301
633 Ga0207675_100005705
634 Ga0207698_10050583
635 Ga0207698_10350299
636 Ga0207428_10202117
637 Ga0268265_11697897
638 Ga0268264_10930848
639 Ga0307408_100021502
640 Ga0307408_101522075
641 Ga0307405_10191261
642 Ga0307405_10402351
643 Ga0307405_10616193
644 Ga0307413_10028402
645 Ga0307413_10381861
646 Ga0307413_10431308
647 Ga0307413_10682683
648 Ga0307413_11040575
649 Ga0307413_12103388
650 Ga0307410_10012908
651 Ga0307410_11129706
652 Ga0307406_10010919
653 Ga0307406_10022258
654 Ga0307406_10189043
655 Ga0307406_10355721
656 Ga0307406_11944558
657 Ga0307407_10018455
658 Ga0307407_10088423
659 Ga0307407_10399431
660 Ga0307407_10714249
661 Ga0307407_11667722
662 Ga0307412_10023054
663 Ga0307409_100097501
664 Ga0307409_100351107
665 Ga0307409_100366810
666 Ga0307409_100462921
667 Ga0307409_100964998
668 Ga0307409_101060680
669 Ga0307409_101238277
670 Ga0307409_101655500
671 Ga0307416_100002309
672 Ga0307416_100110753
673 Ga0307416_100753436
674 Ga0307416_101228825
675 Ga0307416_102241639
676 Ga0307416_102696037
677 Ga0307414_10108104
678 Ga0307411_10296334
679 Ga0307411_10694622
680 Ga0307411_12105767
681 Ga0307415_100002027
682 Ga0307415_100025921
683 Ga0307415_100079499
684 Ga0307415_101156767
685 Ga0373946_0134422
686 Ga0373925_0360085
687 Ga0395900_1702126
688 Ga0395898_0747043
689 Ga0395898_0806302
690 Ga0395905_1274636
691 Ga0436364_0125866
692 Ga0436364_1299740
693 Ga0395901_0411628
694 Ga0395901_0728316
695 Ga0395901_1642325
696 Ga0436365_0212994
697 Ga0436365_0420551
698 Ga0436365_1608073
699 Ga0436360_0545149
700 Ga0436361_1110418
701 Ga0436363_0228184
702 Ga0436363_0431261
703 Ga0436362_0052970
704 Ga0436362_0707746
705 Ga0436362_1041411
706 Ga0451853_3010019
707 Ga0451853_3382222
708 Ga0439448_0019599
709 Ga0466966_0571805
710 Ga0466961_0433432
711 Ga0466963_0043055
712 Ga0466971_0144457
713 Ga0466957_0423005
714 Ga0466957_0456281
715 Ga0466960_0901239
716 Ga0466959_0836750
717 Ga0466959_0863363
718 Ga0466958_0193540
719 Ga0466958_0275943
720 Ga0466967_0532303
721 Ga0466967_0637760
722 Ga0466967_1204017
723 Ga0466967_2369248
724 Ga0495603_0058795
725 Ga0495641_0131054
726 Ga0495651_0544303
727 Ga0495605_0068621
728 Ga0495639_0508060
729 Ga0495639_0527564
730 Ga0495664_0191201
731 Ga0495584_0068644
732 Ga0495596_0236057
733 Ga0495616_0214257
734 Ga0495620_0104359
735 Ga0495630_0463375
736 Ga0495631_0091107
737 Ga0495637_0107239
738 Ga0495644_0059903
739 Ga0495652_0424684
740 Ga0495640_0242159
741 Ga0495587_0466851
742 Ga0495645_0287778
743 Ga0495633_0148991
744 Ga0495656_0059458
745 Ga0495661_0150942
746 Ga0495588_0219485
747 Ga0495658_0555587
748 Ga0495669_0046354
749 Ga0495671_0140071
750 Ga0495589_0172425
751 Ga0495589_0392929
752 Ga0495581_0875756
753 Ga0495674_0356289
754 Ga0495679_190756
755 Ga0495673_0338682
756 Ga0496100_0007786
757 Ga0496100_0205724
758 Ga0496101_0003564
759 Ga0496101_0129849
760 Ga0496102_0445494
761 Ga0496102_0887599
762 Ga0496103_0936663
763 Ga0496103_1007533
764 Ga0496104_0021967
765 Ga0496106_0017398
766 Ga0496106_0175628
767 Ga0496106_0310297
768 Ga0496107_0231620
769 Ga0496107_0828567
770 Ga0496107_1282780
771 Ga0496108_0011234
772 Ga0496108_0117563
773 Ga0496108_0136471
774 Ga0496108_0566155
775 Ga0496109_0042981
776 Ga0496109_0092927
777 Ga0496110_0053440
778 Ga0496110_0138249
779 Ga0496110_0753359
780 Ga0496111_0037084
781 Ga0496111_0295282
782 Ga0496112_0188510
783 Ga0496112_0852540
784 Ga0496113_0076684
785 Ga0496113_0367599
786 Ga0496114_0221471
787 Ga0496115_0405783
788 Ga0496115_1295255
789 Ga0501036_0136425
790 Ga0501039_0672480
791 Ga0501040_0073008
792 Ga0501040_0700089
793 Ga0501041_0178582
794 Ga0501042_0463302
795 Ga0501043_1157315
796 Ga0501069_0387689
797 Ga0501069_0750735
798 Ga0501069_0882949
799 Ga0501071_0461754
800 Ga0501074_0960944
801 Ga0501075_0064749
802 Ga0501076_0007008
803 Ga0501076_1043646
804 Ga0501077_0177888
805 Ga0501079_0037190
806 Ga0501080_0398120
807 Ga0501080_0997122
808 Ga0501081_0200528
809 nmdc:mga05p37_1163066_c1
810 nmdc:mga09592_46788_c1
811 nmdc:mga06r32_404527_c1
812 nmdc:mga06r32_493562_c1
813 nmdc:mga08y16_1042248_c1
814 nmdc:mga08y16_139235_c1
815 nmdc:mga08y16_329657_c1
816 nmdc:mga0a205_1590076_c1
817 Ga0495655_0154678
818 Ga0501084_0106344
819 Ga0466962_0084758
820 Ga0530510_0020997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

24

86

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8762 2 85
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.835 2 85
5v1u-assembly2.cif.gz_B tbib1 in complex with the tbia(beta) leader peptide 0.8036 5 82
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.7927 2 85
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.7858 4 83
ID Description Score Start End Superfamily
af_Q552B8_771_989_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9268 10 23 2.130.10.10
af_Q96JB1_1683_1822_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.8212 10 34 1.20.58.1120
af_V6CJY2_717_933_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8102 10 33 3.90.70.10
af_Q18607_287_334_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8044 7 32 3.20.20.80
af_Q9C0G6_1303_1448_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.7883 10 34 1.20.58.1120
ID Description Score Start End GO Terms
AF-A0A423PMZ6-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9901 4 83 GO:0018189
GO:0048038
AF-A0A2E0IVJ6-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.985 2 84 GO:0018189
GO:0048038
AF-A0A5C7RT36-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9766 2 84 GO:0018189
GO:0048038
AF-A0A1Q8KP49-F1-model_v4 Coenzyme PQQ synthesis protein D 0.9763 2 83 GO:0018189
GO:0048038
AF-A0A7Y5WTN7-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9755 2 83 GO:0018189
GO:0048038

Map