F437054

General Info

Members Datasets Scaffolds Average Seq Length
409 289 376 104

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0351992|Ga0466965_0351992_109_486
Length 125
Sequence LRCRAWAKAATNNEGLNIIMTTQFDNVSVVKKANIYFDGKCVSHTVLFADGTKKTIGVIFPSSLTFNTGAPEIMELNAGKCRIRLKGEEEWKAYEGGQSFNVPGNSSFDIETLETLDYVCHFVAA

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
8 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
9 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
10 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
11 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
12 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
13 2818991452 Burkholderia cepacia 561 Isolate Unclassified
14 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
15 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
16 2904564687 Burkholderia sp. 571 Isolate Unclassified
17 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
18 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
19 2928163908 Burkholderia sp. 567 Isolate Unclassified
20 2928170801 Burkholderia sp. 572 Isolate Unclassified
21 2928536128 Burkholderia sola 565 Isolate Unclassified
22 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
280 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
281 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
282 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
283 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
284 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
285 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
286 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
287 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
288 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
289 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.04
Metatranscriptomes 4.89
Isolates 8.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.47
Nodule 0.49
Rhizoplane 3.67
Rhizosphere 77.75
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10240510 3300002067 Bacteria 527
2 JGI25151J46595_10002835 3300003187 Bacteria 9990
3 JGI25151J46595_10032173 3300003187 Bacteria 2037
4 JGI25153J46596_10055721 3300003215 Bacteria 1104
5 rootH2_10133009 3300003320 Bacteria 1776
6 Ga0007417J51691_1075180 3300003544 Bacteria 1051
7 Ga0007409J51694_1052044 3300003575 Bacteria 681
8 Ga0007416J51690_1058785 3300003577 Bacteria 665
9 Ga0055532_1001753 3300003758 Bacteria 5477
10 Ga0055529_1002548 3300003763 Bacteria 3442
11 Ga0055526_1008392 3300003771 Bacteria 5165
12 Ga0055526_1009933 3300003771 Bacteria 4503
13 Ga0055526_1010258 3300003771 Bacteria 4381
14 Ga0055524_1003056 3300003775 Bacteria 8282
15 Ga0055524_1012811 3300003775 Bacteria 3199
16 Ga0055536_1000252 3300003781 Bacteria 42499
17 Ga0055534_1000542 3300003784 Bacteria 20155
18 Ga0055534_1001318 3300003784 Bacteria 9988
19 Ga0055528_1001311 3300003790 Bacteria 15602
20 Ga0058692_1049358 3300003856 Bacteria 703
21 Ga0065704_10355062 3300005289 Bacteria 805
22 Ga0070658_10037275 3300005327 Bacteria 3919
23 Ga0070670_101446606 3300005331 Bacteria 630
24 Ga0070677_10078793 3300005333 Bacteria 1404
25 Ga0068869_100573432 3300005334 Bacteria 950
26 Ga0070666_10067285 3300005335 Bacteria 2432
27 Ga0070682_100033505 3300005337 Bacteria 3121
28 Ga0070682_100635279 3300005337 Bacteria 848
29 Ga0070660_100000013 3300005339 Bacteria 116814
30 Ga0070660_100000420 3300005339 Bacteria 28168
31 Ga0070689_100185080 3300005340 Bacteria 1693
32 Ga0070689_100324474 3300005340 Bacteria 1286
33 Ga0070661_100221150 3300005344 Bacteria 1452
34 Ga0070692_10289727 3300005345 Bacteria 996
35 Ga0070668_101646596 3300005347 Bacteria 588
36 Ga0070669_100259408 3300005353 Bacteria 1386
37 Ga0070675_100291830 3300005354 Bacteria 1435
38 Ga0070675_101483411 3300005354 Bacteria 625
39 Ga0070671_100170388 3300005355 Bacteria 1841
40 Ga0070671_100924768 3300005355 Bacteria 762
41 Ga0070674_100098683 3300005356 Bacteria 2123
42 Ga0070673_100496410 3300005364 Bacteria 1103
43 Ga0070673_101018599 3300005364 Bacteria 771
44 Ga0070659_100000028 3300005366 Bacteria 140665
45 Ga0070659_100002423 3300005366 Bacteria 13252
46 Ga0070659_101241050 3300005366 Bacteria 660
47 Ga0070667_100455383 3300005367 Bacteria 1169
48 Ga0070700_100098253 3300005441 Bacteria 1924
49 Ga0070694_101038078 3300005444 Bacteria 682
50 Ga0070663_100000106 3300005455 Bacteria 38737
51 Ga0070678_100561490 3300005456 Bacteria 1014
52 Ga0070662_100259601 3300005457 Bacteria 1399
53 Ga0070662_101971582 3300005457 Bacteria 504
54 Ga0070685_10095352 3300005466 Bacteria 1808
55 Ga0070706_100206019 3300005467 Bacteria 1837
56 Ga0068853_100787340 3300005539 Bacteria 910
57 Ga0070672_100181849 3300005543 Bacteria 1752
58 Ga0070704_100580855 3300005549 Bacteria 983
59 Ga0068855_100456279 3300005563 Bacteria 1394
60 Ga0068855_100516492 3300005563 Bacteria 1296
61 Ga0070664_100017877 3300005564 Bacteria 5822
62 Ga0070664_100165765 3300005564 Bacteria 1958
63 Ga0070664_100392825 3300005564 Bacteria 1268
64 Ga0068857_100179285 3300005577 Bacteria 1928
65 Ga0068857_101295812 3300005577 Bacteria 707
66 Ga0068854_100532622 3300005578 Bacteria 994
67 Ga0068856_100167018 3300005614 Bacteria 2212
68 Ga0068856_100817066 3300005614 Bacteria 952
69 Ga0068856_101784739 3300005614 Bacteria 627
70 Ga0070702_100019498 3300005615 Bacteria 3539
71 Ga0068852_100004530 3300005616 Bacteria 9834
72 Ga0068852_100073030 3300005616 Bacteria 3017
73 Ga0068859_100156519 3300005617 Bacteria 2356
74 Ga0068859_101089578 3300005617 Bacteria 878
75 Ga0068864_100323227 3300005618 Bacteria 1449
76 Ga0068861_100779445 3300005719 Bacteria 895
77 Ga0068863_100756975 3300005841 Bacteria 967
78 Ga0068858_100429885 3300005842 Bacteria 1270
79 Ga0068858_100578578 3300005842 Bacteria 1088
80 Ga0068860_100276389 3300005843 Bacteria 1640
81 Ga0075366_10011429 3300006195 Bacteria 5015
82 Ga0068871_100078822 3300006358 Bacteria 2724
83 Ga0068871_101660439 3300006358 Bacteria 605
84 Ga0068865_100035818 3300006881 Bacteria 3341
85 Ga0097620_100156492 3300006931 Bacteria 2356
86 Ga0097620_101089535 3300006931 Bacteria 878
87 Ga0105250_10056390 3300009092 Bacteria 1577
88 Ga0105240_10000885 3300009093 Bacteria 53803
89 Ga0105240_10012920 3300009093 Bacteria 11500
90 Ga0105240_11002687 3300009093 Bacteria 893
91 Ga0111539_10479600 3300009094 Bacteria 1449
92 Ga0105245_10036965 3300009098 Bacteria 4340
93 Ga0105247_10103879 3300009101 Bacteria 1820
94 Ga0105243_10060648 3300009148 Bacteria 3022
95 Ga0105241_11341324 3300009174 Bacteria 683
96 Ga0105242_10107929 3300009176 Bacteria 2369
97 Ga0105248_10607022 3300009177 Bacteria 1234
98 Ga0105248_11217089 3300009177 Bacteria 852
99 Ga0105238_10013704 3300009551 Bacteria 8189
100 Ga0105249_10230723 3300009553 Bacteria 1825
101 Ga0105239_10042567 3300010375 Bacteria 4976
102 Ga0105246_10360965 3300011119 Bacteria 1194
103 Ga0157378_11554666 3300013297 Bacteria 707
104 Ga0163162_10949207 3300013306 Bacteria 971
105 Ga0163162_11822564 3300013306 Bacteria 696
106 Ga0157375_11265641 3300013308 Bacteria 866
107 Ga0157375_11571218 3300013308 Bacteria 777
108 Ga0163163_10004848 3300014325 Bacteria 11562
109 Ga0163163_10258120 3300014325 Bacteria 1793
110 Ga0157380_10093613 3300014326 Bacteria 2485
111 Ga0157380_11039440 3300014326 Bacteria 855
112 Ga0157377_10183978 3300014745 Bacteria 1316
113 Ga0157379_10165161 3300014968 Bacteria 1998
114 Ga0157379_10210090 3300014968 Bacteria 1762
115 Ga0157376_10298404 3300014969 Bacteria 1524
116 Ga0157376_10565507 3300014969 Bacteria 1127
117 Ga0182005_1048244 3300015265 Bacteria 1157
118 Ga0163161_10048368 3300017792 Bacteria 3071
119 Ga0163161_10517769 3300017792 Bacteria 974
120 Ga0213872_10012190 3300021361 Bacteria 4052
121 Ga0213872_10012490 3300021361 Bacteria 3993
122 Ga0213872_10090818 3300021361 Bacteria 1367
123 Ga0209566_100296 3300025225 Bacteria 45153
124 Ga0209674_102092 3300025226 Bacteria 4534
125 Ga0209672_100067 3300025228 Bacteria 180819
126 Ga0209672_100079 3300025228 Bacteria 156875
127 Ga0209147_100012 3300025229 Bacteria 681990
128 Ga0209147_100061 3300025229 Bacteria 248809
129 Ga0209147_100107 3300025229 Bacteria 156875
130 Ga0209258_100107 3300025242 Bacteria 206572
131 Ga0209258_100273 3300025242 Bacteria 87726
132 Ga0207425_1048000 3300025245 Bacteria 789
133 Ga0209148_1000022 3300025254 Bacteria 681990
134 Ga0209759_1005629 3300025256 Bacteria 4339
135 Ga0209565_1000093 3300025263 Bacteria 138690
136 Ga0209565_1010865 3300025263 Bacteria 2243
137 Ga0209565_1057182 3300025263 Bacteria 684
138 Ga0207666_1042118 3300025271 Bacteria 715
139 Ga0209455_1000024 3300025272 Bacteria 676133
140 Ga0209673_1000021 3300025273 Bacteria 422978
141 Ga0209673_1077145 3300025273 Bacteria 774
142 Ga0209130_1038087 3300025284 Bacteria 945
143 Ga0209675_1000100 3300025291 Bacteria 128565
144 Ga0209675_1003452 3300025291 Bacteria 7509
145 Ga0209675_1021674 3300025291 Bacteria 1708
146 Ga0209676_1000012 3300025292 Bacteria 841431
147 Ga0209025_1000390 3300025294 Bacteria 90952
148 Ga0209025_1000625 3300025294 Bacteria 62737
149 Ga0209025_1004460 3300025294 Bacteria 12158
150 Ga0209025_1006034 3300025294 Bacteria 9587
151 Ga0209025_1008761 3300025294 Bacteria 7201
152 Ga0209564_1001276 3300025295 Bacteria 27713
153 Ga0209564_1001785 3300025295 Bacteria 19902
154 Ga0209564_1004358 3300025295 Bacteria 8706
155 Ga0209564_1007871 3300025295 Bacteria 5395
156 Ga0209758_1014768 3300025297 Bacteria 4118
157 Ga0209256_1000676 3300025299 Bacteria 46097
158 Ga0209256_1002190 3300025299 Bacteria 16744
159 Ga0209051_1087418 3300025303 Bacteria 878
160 Ga0207696_1130015 3300025711 Bacteria 676
161 Ga0207682_10002729 3300025893 Bacteria 7829
162 Ga0207642_10013421 3300025899 Bacteria 2989
163 Ga0207680_10703465 3300025903 Bacteria 724
164 Ga0207647_10011413 3300025904 Bacteria 6233
165 Ga0207645_10050638 3300025907 Bacteria 2652
166 Ga0207643_10006931 3300025908 Bacteria 6076
167 Ga0207705_10137491 3300025909 Bacteria 1822
168 Ga0207684_10237450 3300025910 Bacteria 1572
169 Ga0207654_11200040 3300025911 Bacteria 553
170 Ga0207695_10013953 3300025913 Bacteria 9550
171 Ga0207695_10309815 3300025913 Bacteria 1469
172 Ga0207695_10507184 3300025913 Bacteria 1088
173 Ga0207671_10374579 3300025914 Bacteria 1131
174 Ga0207662_10084331 3300025918 Bacteria 1944
175 Ga0207657_10000017 3300025919 Bacteria 173373
176 Ga0207657_10001145 3300025919 Bacteria 28192
177 Ga0207649_10166312 3300025920 Bacteria 1532
178 Ga0207681_10663053 3300025923 Bacteria 865
179 Ga0207694_10262769 3300025924 Bacteria 1414
180 Ga0207694_11856331 3300025924 Bacteria 506
181 Ga0207650_10008738 3300025925 Bacteria 6919
182 Ga0207690_10000009 3300025932 Bacteria 366044
183 Ga0207690_10004281 3300025932 Bacteria 8427
184 Ga0207690_10370831 3300025932 Bacteria 1135
185 Ga0207706_10053728 3300025933 Bacteria 3556
186 Ga0207686_10429489 3300025934 Bacteria 1012
187 Ga0207704_10108617 3300025938 Bacteria 1869
188 Ga0207691_10785105 3300025940 Bacteria 801
189 Ga0207711_10623364 3300025941 Bacteria 1006
190 Ga0207711_11033888 3300025941 Bacteria 761
191 Ga0207689_10047919 3300025942 Bacteria 3525
192 Ga0207689_11366091 3300025942 Bacteria 594
193 Ga0207679_10019988 3300025945 Bacteria 4511
194 Ga0207679_10325034 3300025945 Bacteria 1333
195 Ga0207667_10012365 3300025949 Bacteria 9839
196 Ga0207667_10389860 3300025949 Bacteria 1419
197 Ga0207651_10169903 3300025960 Bacteria 1718
198 Ga0207651_12046086 3300025960 Bacteria 514
199 Ga0207712_10103461 3300025961 Bacteria 2122
200 Ga0207640_10360637 3300025981 Bacteria 1171
201 Ga0207640_11608175 3300025981 Bacteria 585
202 Ga0207658_10856531 3300025986 Bacteria 826
203 Ga0207677_10211418 3300026023 Bacteria 1549
204 Ga0207703_10468996 3300026035 Bacteria 1178
205 Ga0207703_12303645 3300026035 Bacteria 514
206 Ga0207639_10912639 3300026041 Bacteria 821
207 Ga0207678_10000369 3300026067 Bacteria 40965
208 Ga0207708_10004528 3300026075 Bacteria 10227
209 Ga0207702_10461285 3300026078 Bacteria 1234
210 Ga0207702_10973020 3300026078 Bacteria 842
211 Ga0207641_10051929 3300026088 Bacteria 3471
212 Ga0207641_11308244 3300026088 Bacteria 725
213 Ga0207648_10029549 3300026089 Bacteria 4860
214 Ga0207676_12093034 3300026095 Bacteria 564
215 Ga0207674_10093079 3300026116 Bacteria 3003
216 Ga0207674_11131930 3300026116 Bacteria 752
217 Ga0207675_100042855 3300026118 Bacteria 4226
218 Ga0207683_10102023 3300026121 Bacteria 2562
219 Ga0207698_10019245 3300026142 Bacteria 4671
220 Ga0207698_10095622 3300026142 Bacteria 2446
221 Ga0207698_12319844 3300026142 Unclassified 548
222 Ga0209371_1000961 3300027312 Bacteria 22360
223 Ga0268266_11091830 3300028379 Bacteria 772
224 Ga0268265_10459516 3300028380 Bacteria 1191
225 Ga0268264_11185119 3300028381 Bacteria 773
226 Ga0265319_1254943 3300028563 Bacteria 534
227 Ga0265323_10001279 3300028653 Bacteria 12572
228 Ga0265336_10044377 3300028666 Bacteria 1353
229 Ga0268256_1000809 3300030500 Bacteria 22398
230 Ga0316183_1098232 3300030742 Bacteria 714
231 Ga0265332_10003776 3300031238 Bacteria 7242
232 Ga0265325_10006618 3300031241 Bacteria 7015
233 Ga0265325_10100908 3300031241 Bacteria 1413
234 Ga0265327_10001024 3300031251 Bacteria 39464
235 Ga0265327_10048510 3300031251 Bacteria 2233
236 Ga0265316_10000005 3300031344 Bacteria 304442
237 Ga0265316_10136480 3300031344 Bacteria 1845
238 Ga0307508_10352636 3300031616 Bacteria 1063
239 Ga0265314_10023421 3300031711 Bacteria 4708
240 Ga0373928_0053750 3300035084 Bacteria 957
241 Ga0373928_0083744 3300035084 Bacteria 808
242 Ga0373946_0726517 3300035171 Bacteria 520
243 Ga0373931_0209316 3300035691 Bacteria 1169
244 Ga0395899_0000753 3300037312 Bacteria 32064
245 Ga0395899_0005697 3300037312 Bacteria 9670
246 Ga0395899_0014911 3300037312 Bacteria 5928
247 Ga0395899_0577403 3300037312 Bacteria 719
248 Ga0395900_0072127 3300037418 Bacteria 3550
249 Ga0395900_0201662 3300037418 Bacteria 2012
250 Ga0395900_0446124 3300037418 Bacteria 1251
251 Ga0395898_0048259 3300037466 Bacteria 4176
252 Ga0395905_0000905 3300037471 Bacteria 38512
253 Ga0395905_0001709 3300037471 Bacteria 25795
254 Ga0395905_0039921 3300037471 Bacteria 4403
255 Ga0395901_0007536 3300038443 Bacteria 10992
256 Ga0395901_0011581 3300038443 Bacteria 8937
257 Ga0395901_0046846 3300038443 Bacteria 4492
258 Ga0395901_0066342 3300038443 Bacteria 3759
259 Ga0436365_1315208 3300039437 Bacteria 4534
260 Ga0436361_0094736 3300039447 Bacteria 760
261 Ga0436361_0195958 3300039447 Bacteria 1766
262 Ga0436361_0277479 3300039447 Bacteria 922
263 Ga0436361_0938544 3300039447 Bacteria 31788
264 Ga0439453_0139799 3300041408 Bacteria 568
265 Ga0439465_0017989 3300041413 Bacteria 2209
266 Ga0451843_0708525 3300041509 Bacteria 2932
267 Ga0451577_0000635 3300042876 Bacteria 56126
268 Ga0451577_0140526 3300042876 Bacteria 2170
269 Ga0451577_0145183 3300042876 Bacteria 2133
270 Ga0451577_0321282 3300042876 Bacteria 1404
271 Ga0451577_0673889 3300042876 Bacteria 937
272 Ga0451577_0919171 3300042876 Bacteria 787
273 Ga0451577_1165578 3300042876 Bacteria 688
274 Ga0453683_0301613 3300044673 Bacteria 1025
275 Ga0453683_1108612 3300044673 Bacteria 528
276 Ga0466965_0351992 3300044683 Bacteria 807
277 Ga0466966_0018553 3300044684 Bacteria 4587
278 Ga0453684_0000005 3300044712 Bacteria 1431632
279 Ga0453684_0000102 3300044712 Bacteria 366870
280 Ga0453684_0000459 3300044712 Bacteria 163142
281 Ga0453684_0002888 3300044712 Bacteria 40310
282 Ga0453684_0493303 3300044712 Bacteria 1357
283 Ga0453684_0753662 3300044712 Bacteria 1054
284 Ga0453684_1137576 3300044712 Bacteria 823
285 Ga0453684_1631353 3300044712 Bacteria 661
286 Ga0466971_0152295 3300044719 Bacteria 1080
287 Ga0466970_0022221 3300044765 Bacteria 3311
288 Ga0466970_0615629 3300044765 Bacteria 630
289 Ga0466957_0189316 3300044842 Bacteria 1347
290 Ga0466960_0218117 3300044901 Bacteria 1049
291 Ga0466959_0742651 3300045049 Bacteria 657
292 Ga0451576_0000418 3300045051 Bacteria 98732
293 Ga0451576_0098665 3300045051 Bacteria 3039
294 Ga0451576_0481414 3300045051 Bacteria 1304
295 Ga0451576_0696074 3300045051 Bacteria 1068
296 Ga0451576_0939773 3300045051 Bacteria 907
297 Ga0451576_1306929 3300045051 Bacteria 756
298 Ga0451576_1452996 3300045051 Bacteria 713
299 Ga0451576_1518142 3300045051 Bacteria 696
300 Ga0451576_1743366 3300045051 Bacteria 644
301 Ga0495606_0030257 3300046507 Bacteria 3785
302 Ga0495620_0264346 3300046515 Bacteria 655
303 Ga0495643_0012413 3300046522 Bacteria 5140
304 Ga0495644_0361812 3300046523 Bacteria 572
305 Ga0495663_0116053 3300046525 Bacteria 893
306 Ga0495666_0100900 3300046526 Bacteria 1360
307 Ga0495642_0049656 3300046528 Bacteria 1724
308 Ga0495598_0072191 3300046537 Bacteria 1089
309 Ga0495621_0281414 3300046539 Bacteria 685
310 Ga0495597_0061160 3300046542 Bacteria 1641
311 Ga0495633_0091625 3300046558 Bacteria 1413
312 Ga0495668_0167679 3300046616 Bacteria 1203
313 Ga0495661_0021657 3300046665 Bacteria 4187
314 Ga0495658_0033708 3300046683 Bacteria 2807
315 Ga0495669_0020954 3300046684 Bacteria 2833
316 Ga0495670_0459039 3300046691 Bacteria 690
317 Ga0495649_0145390 3300046694 Bacteria 1247
318 Ga0495687_015357 3300047443 Bacteria 3898
319 Ga0495687_046448 3300047443 Bacteria 1874
320 Ga0496100_0394891 3300048903 Bacteria 1052
321 Ga0496101_0145179 3300048904 Bacteria 1811
322 Ga0496102_0821417 3300048905 Bacteria 852
323 Ga0496103_0403842 3300048906 Bacteria 878
324 Ga0496104_0644528 3300048907 Bacteria 968
325 Ga0496104_1193832 3300048907 Bacteria 664
326 Ga0496109_1474000 3300048912 Bacteria 616
327 Ga0496110_1272501 3300048913 Bacteria 645
328 Ga0496112_1289082 3300048915 Bacteria 646
329 Ga0496114_0014471 3300048917 Bacteria 6337
330 Ga0496114_0478331 3300048917 Bacteria 1102
331 Ga0496121_0307082 3300048924 Bacteria 1074
332 Ga0496123_0353077 3300048926 Bacteria 683
333 Ga0496125_0001079 3300048928 Bacteria 41999
334 Ga0501304_044415 3300049160 Bacteria 504
335 Ga0501312_125284 3300049528 Bacteria 500
336 Ga0501321_019706 3300049537 Bacteria 828
337 Ga0501323_080234 3300049539 Bacteria 533
338 Ga0501328_06209 3300049544 Bacteria 616
339 Ga0501032_0390485 3300049569 Bacteria 894
340 Ga0501033_0087626 3300049570 Bacteria 2278
341 Ga0501034_0004775 3300049571 Bacteria 15000
342 Ga0501034_0139405 3300049571 Bacteria 2405
343 Ga0501034_0293290 3300049571 Bacteria 1564
344 Ga0501036_0108624 3300049572 Bacteria 2345
345 Ga0501037_0058573 3300049573 Bacteria 2810
346 Ga0501038_0036498 3300049574 Bacteria 4313
347 Ga0501042_1367741 3300049578 Bacteria 516
348 Ga0501043_0005259 3300049579 Bacteria 10463
349 Ga0501043_0344863 3300049579 Bacteria 1132
350 Ga0501046_0117946 3300049580 Bacteria 2022
351 Ga0501047_0528090 3300049581 Bacteria 1005
352 Ga0501047_1129982 3300049581 Bacteria 597
353 Ga0501068_0053072 3300049584 Bacteria 2453
354 Ga0501069_0586591 3300049585 Bacteria 668
355 Ga0501073_0044994 3300049589 Bacteria 3110
356 Ga0501074_0160771 3300049590 Bacteria 1604
357 Ga0501238_037217 3300049671 Bacteria 711
358 Ga0501079_0303122 3300049741 Bacteria 1250
359 Ga0501080_0001810 3300049742 Bacteria 18335
360 Ga0501083_0031217 3300049744 Bacteria 3657
361 Ga0501035_0181327 3300049822 Bacteria 1814
362 Ga0501044_0094327 3300049823 Bacteria 3017
363 nmdc:mga0k408_2396_c1 3300050493 Bacteria 5015
364 Ga0587077_036178 3300059493 Bacteria 968
365 Ga0587077_096038 3300059493 Bacteria 705
366 Ga0587082_072257 3300059504 Bacteria 703
367 Ga0587092_095442 3300059512 Bacteria 606
368 Ga0587101_058587 3300059623 Bacteria 682
369 Ga0587117_044754 3300059627 Bacteria 717
370 Ga0587069_074494 3300059642 Bacteria 651
371 Ga0587075_109018 3300059644 Bacteria 561
372 Ga0587076_000856 3300059645 Bacteria 2822
373 Ga0587078_041268 3300059646 Bacteria 652
374 Ga0587079_068746 3300059647 Bacteria 785
375 Ga0587071_060736 3300060344 Bacteria 803
376 Ga0501082_0103951 3300060353 Bacteria 2457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2526164512 2526213046 99
2 iso_pu_bacteria 2547132512 2548846863 99
3 iso_pu_bacteria 2643221603 2644027732 100
4 3300031241 Ga0265325_10006618 Ga0265325_100066181 101
5 3300031251 Ga0265327_10048510 Ga0265327_100485104 101
6 3300042876 Ga0451577_0000635 Ga0451577_0000635_54515_54823 101
7 3300042876 Ga0451577_0321282 Ga0451577_0321282_102_410 101
8 3300042876 Ga0451577_0673889 Ga0451577_0673889_595_903 101
9 3300044673 Ga0453683_0301613 Ga0453683_0301613_413_721 101
10 3300044712 Ga0453684_0000005 Ga0453684_0000005_1149056_1149364 101
11 3300044712 Ga0453684_0000459 Ga0453684_0000459_14133_14441 101
12 3300044712 Ga0453684_0002888 Ga0453684_0002888_5142_5450 101
13 3300045051 Ga0451576_0000418 Ga0451576_0000418_46205_46513 101
14 iso_pu_bacteria 644736347 644748853 101
15 3300028666 Ga0265336_10044377 Ga0265336_100443772 102
16 3300031241 Ga0265325_10100908 Ga0265325_101009083 102
17 3300031251 Ga0265327_10001024 Ga0265327_100010243 102
18 3300042876 Ga0451577_1165578 Ga0451577_1165578_323_634 102
19 3300044712 Ga0453684_1631353 Ga0453684_1631353_137_448 102
20 3300045051 Ga0451576_1743366 Ga0451576_1743366_55_366 102
21 iso_pu_bacteria 2519103095 2519461427 102
22 iso_pu_bacteria 2582581311 2585290794 102
23 iso_pu_bacteria 2599185239 2599734698 102
24 iso_pu_bacteria 2599185240 2599745415 102
25 iso_pu_bacteria 2599185355 2600207322 102
26 iso_pu_bacteria 2675903129 2676741135 102
27 iso_pu_bacteria 2816332253 2817258332 102
28 iso_pu_bacteria 2816332256 2817281254 102
29 iso_pu_bacteria 2816332286 2817452058 102
30 iso_pu_bacteria 2818991452 2819634504 102
31 iso_pu_bacteria 2863421361 2863422168 102
32 iso_pu_bacteria 2870068957 2870075292 102
33 iso_pu_bacteria 2904564687 2904564691 102
34 iso_pu_bacteria 2904571731 2904572612 102
35 iso_pu_bacteria 2928157003 2928159063 102
36 iso_pu_bacteria 2928163908 2928167902 102
37 iso_pu_bacteria 2928170801 2928175353 102
38 iso_pu_bacteria 2928536128 2928537927 102
39 iso_pu_bacteria 2981990288 2981992445 102
40 iso_pu_bacteria 641736154 642416708 102
41 iso_pu_bacteria 8018845410 8018848500 102
42 iso_pu_bacteria 8020807995 8020810383 102
43 iso_pu_bacteria 8020938398 8020941831 102
44 iso_pu_bacteria 8020945358 8020945610 102
45 iso_pu_bacteria 8020953355 8020958696 102
46 iso_pu_bacteria 8021120328 8021121729 102
47 iso_pu_bacteria 8039098773 8039103983 102
48 iso_pu_bacteria 8040167225 8040167427 102
49 iso_pu_bacteria 8040173305 8040175437 102
50 3300003187 JGI25151J46595_10002835 JGI25151J46595_1000283512 103
51 3300003187 JGI25151J46595_10032173 JGI25151J46595_100321732 103
52 3300003215 JGI25153J46596_10055721 JGI25153J46596_100557212 103
53 3300003771 Ga0055526_1008392 Ga0055526_10083927 103
54 3300003771 Ga0055526_1009933 Ga0055526_10099336 103
55 3300003771 Ga0055526_1010258 Ga0055526_10102582 103
56 3300003775 Ga0055524_1003056 Ga0055524_10030563 103
57 3300003775 Ga0055524_1012811 Ga0055524_10128113 103
58 3300003781 Ga0055536_1000252 Ga0055536_100025236 103
59 3300003784 Ga0055534_1000542 Ga0055534_100054214 103
60 3300003784 Ga0055534_1001318 Ga0055534_10013185 103
61 3300005331 Ga0070670_101446606 Ga0070670_1014466062 103
62 3300005333 Ga0070677_10078793 Ga0070677_100787932 103
63 3300005334 Ga0068869_100573432 Ga0068869_1005734322 103
64 3300005335 Ga0070666_10067285 Ga0070666_100672854 103
65 3300005340 Ga0070689_100185080 Ga0070689_1001850802 103
66 3300005340 Ga0070689_100324474 Ga0070689_1003244742 103
67 3300005345 Ga0070692_10289727 Ga0070692_102897272 103
68 3300005347 Ga0070668_101646596 Ga0070668_1016465961 103
69 3300005353 Ga0070669_100259408 Ga0070669_1002594082 103
70 3300005354 Ga0070675_100291830 Ga0070675_1002918302 103
71 3300005354 Ga0070675_101483411 Ga0070675_1014834111 103
72 3300005355 Ga0070671_100170388 Ga0070671_1001703882 103
73 3300005355 Ga0070671_100924768 Ga0070671_1009247682 103
74 3300005356 Ga0070674_100098683 Ga0070674_1000986834 103
75 3300005364 Ga0070673_100496410 Ga0070673_1004964101 103
76 3300005364 Ga0070673_101018599 Ga0070673_1010185991 103
77 3300005366 Ga0070659_101241050 Ga0070659_1012410502 103
78 3300005367 Ga0070667_100455383 Ga0070667_1004553832 103
79 3300005441 Ga0070700_100098253 Ga0070700_1000982532 103
80 3300005444 Ga0070694_101038078 Ga0070694_1010380782 103
81 3300005456 Ga0070678_100561490 Ga0070678_1005614902 103
82 3300005457 Ga0070662_100259601 Ga0070662_1002596012 103
83 3300005466 Ga0070685_10095352 Ga0070685_100953522 103
84 3300005467 Ga0070706_100206019 Ga0070706_1002060192 103
85 3300005543 Ga0070672_100181849 Ga0070672_1001818492 103
86 3300005549 Ga0070704_100580855 Ga0070704_1005808552 103
87 3300005563 Ga0068855_100456279 Ga0068855_1004562792 103
88 3300005564 Ga0070664_100392825 Ga0070664_1003928252 103
89 3300005577 Ga0068857_100179285 Ga0068857_1001792851 103
90 3300005614 Ga0068856_100167018 Ga0068856_1001670183 103
91 3300005614 Ga0068856_101784739 Ga0068856_1017847391 103
92 3300005615 Ga0070702_100019498 Ga0070702_1000194982 103
93 3300005617 Ga0068859_100156519 Ga0068859_1001565192 103
94 3300005617 Ga0068859_101089578 Ga0068859_1010895782 103
95 3300005618 Ga0068864_100323227 Ga0068864_1003232272 103
96 3300005719 Ga0068861_100779445 Ga0068861_1007794451 103
97 3300005841 Ga0068863_100756975 Ga0068863_1007569752 103
98 3300005842 Ga0068858_100429885 Ga0068858_1004298852 103
99 3300005843 Ga0068860_100276389 Ga0068860_1002763891 103
100 3300006195 Ga0075366_10011429 Ga0075366_100114292 103
101 3300006358 Ga0068871_100078822 Ga0068871_1000788222 103
102 3300006358 Ga0068871_101660439 Ga0068871_1016604392 103
103 3300006881 Ga0068865_100035818 Ga0068865_1000358186 103
104 3300006931 Ga0097620_100156492 Ga0097620_1001564922 103
105 3300006931 Ga0097620_101089535 Ga0097620_1010895352 103
106 3300009093 Ga0105240_11002687 Ga0105240_110026871 103
107 3300009094 Ga0111539_10479600 Ga0111539_104796003 103
108 3300009098 Ga0105245_10036965 Ga0105245_100369656 103
109 3300009101 Ga0105247_10103879 Ga0105247_101038792 103
110 3300009148 Ga0105243_10060648 Ga0105243_100606482 103
111 3300009174 Ga0105241_11341324 Ga0105241_113413242 103
112 3300009176 Ga0105242_10107929 Ga0105242_101079292 103
113 3300009177 Ga0105248_10607022 Ga0105248_106070222 103
114 3300009177 Ga0105248_11217089 Ga0105248_112170892 103
115 3300009553 Ga0105249_10230723 Ga0105249_102307232 103
116 3300011119 Ga0105246_10360965 Ga0105246_103609652 103
117 3300013306 Ga0163162_10949207 Ga0163162_109492072 103
118 3300013306 Ga0163162_11822564 Ga0163162_118225642 103
119 3300013308 Ga0157375_11265641 Ga0157375_112656412 103
120 3300013308 Ga0157375_11571218 Ga0157375_115712182 103
121 3300014325 Ga0163163_10004848 Ga0163163_100048486 103
122 3300014325 Ga0163163_10258120 Ga0163163_102581203 103
123 3300014326 Ga0157380_10093613 Ga0157380_100936132 103
124 3300014326 Ga0157380_11039440 Ga0157380_110394402 103
125 3300014745 Ga0157377_10183978 Ga0157377_101839782 103
126 3300014968 Ga0157379_10165161 Ga0157379_101651612 103
127 3300014968 Ga0157379_10210090 Ga0157379_102100901 103
128 3300014969 Ga0157376_10565507 Ga0157376_105655072 103
129 3300017792 Ga0163161_10517769 Ga0163161_105177691 103
130 3300021361 Ga0213872_10012190 Ga0213872_100121902 103
131 3300025245 Ga0207425_1048000 Ga0207425_10480002 103
132 3300025263 Ga0209565_1000093 Ga0209565_100009399 103
133 3300025263 Ga0209565_1057182 Ga0209565_10571822 103
134 3300025271 Ga0207666_1042118 Ga0207666_10421182 103
135 3300025273 Ga0209673_1077145 Ga0209673_10771452 103
136 3300025284 Ga0209130_1038087 Ga0209130_10380871 103
137 3300025291 Ga0209675_1000100 Ga0209675_100010085 103
138 3300025291 Ga0209675_1003452 Ga0209675_10034528 103
139 3300025291 Ga0209675_1021674 Ga0209675_10216742 103
140 3300025292 Ga0209676_1000012 Ga0209676_1000012771 103
141 3300025294 Ga0209025_1000390 Ga0209025_100039055 103
142 3300025294 Ga0209025_1000625 Ga0209025_100062510 103
143 3300025294 Ga0209025_1004460 Ga0209025_100446010 103
144 3300025294 Ga0209025_1006034 Ga0209025_100603410 103
145 3300025294 Ga0209025_1008761 Ga0209025_10087612 103
146 3300025295 Ga0209564_1001276 Ga0209564_10012769 103
147 3300025295 Ga0209564_1001785 Ga0209564_100178510 103
148 3300025295 Ga0209564_1004358 Ga0209564_10043582 103
149 3300025297 Ga0209758_1014768 Ga0209758_10147682 103
150 3300025299 Ga0209256_1000676 Ga0209256_100067619 103
151 3300025299 Ga0209256_1002190 Ga0209256_100219017 103
152 3300025303 Ga0209051_1087418 Ga0209051_10874182 103
153 3300025893 Ga0207682_10002729 Ga0207682_100027296 103
154 3300025899 Ga0207642_10013421 Ga0207642_100134212 103
155 3300025903 Ga0207680_10703465 Ga0207680_107034651 103
156 3300025907 Ga0207645_10050638 Ga0207645_100506382 103
157 3300025908 Ga0207643_10006931 Ga0207643_100069314 103
158 3300025910 Ga0207684_10237450 Ga0207684_102374502 103
159 3300025911 Ga0207654_11200040 Ga0207654_112000402 103
160 3300025918 Ga0207662_10084331 Ga0207662_100843312 103
161 3300025923 Ga0207681_10663053 Ga0207681_106630532 103
162 3300025924 Ga0207694_11856331 Ga0207694_118563312 103
163 3300025925 Ga0207650_10008738 Ga0207650_100087388 103
164 3300025932 Ga0207690_10370831 Ga0207690_103708312 103
165 3300025933 Ga0207706_10053728 Ga0207706_100537284 103
166 3300025934 Ga0207686_10429489 Ga0207686_104294892 103
167 3300025938 Ga0207704_10108617 Ga0207704_101086174 103
168 3300025940 Ga0207691_10785105 Ga0207691_107851052 103
169 3300025941 Ga0207711_10623364 Ga0207711_106233642 103
170 3300025941 Ga0207711_11033888 Ga0207711_110338882 103
171 3300025942 Ga0207689_10047919 Ga0207689_100479196 103
172 3300025942 Ga0207689_11366091 Ga0207689_113660911 103
173 3300025945 Ga0207679_10325034 Ga0207679_103250342 103
174 3300025949 Ga0207667_10389860 Ga0207667_103898602 103
175 3300025960 Ga0207651_10169903 Ga0207651_101699033 103
176 3300025960 Ga0207651_12046086 Ga0207651_120460861 103
177 3300025961 Ga0207712_10103461 Ga0207712_101034612 103
178 3300025981 Ga0207640_10360637 Ga0207640_103606372 103
179 3300025986 Ga0207658_10856531 Ga0207658_108565312 103
180 3300026023 Ga0207677_10211418 Ga0207677_102114182 103
181 3300026035 Ga0207703_12303645 Ga0207703_123036451 103
182 3300026075 Ga0207708_10004528 Ga0207708_1000452811 103
183 3300026078 Ga0207702_10461285 Ga0207702_104612852 103
184 3300026088 Ga0207641_10051929 Ga0207641_100519292 103
185 3300026088 Ga0207641_11308244 Ga0207641_113082442 103
186 3300026089 Ga0207648_10029549 Ga0207648_100295492 103
187 3300026095 Ga0207676_12093034 Ga0207676_120930342 103
188 3300026116 Ga0207674_10093079 Ga0207674_100930792 103
189 3300026118 Ga0207675_100042855 Ga0207675_1000428556 103
190 3300026121 Ga0207683_10102023 Ga0207683_101020232 103
191 3300028379 Ga0268266_11091830 Ga0268266_110918301 103
192 3300028380 Ga0268265_10459516 Ga0268265_104595162 103
193 3300028381 Ga0268264_11185119 Ga0268264_111851192 103
194 3300028653 Ga0265323_10001279 Ga0265323_1000127911 103
195 3300030742 Ga0316183_1098232 Ga0316183_10982321 103
196 3300031344 Ga0265316_10136480 Ga0265316_101364802 103
197 3300031616 Ga0307508_10352636 Ga0307508_103526361 103
198 3300035084 Ga0373928_0053750 Ga0373928_0053750_388_705 103
199 3300035171 Ga0373946_0726517 Ga0373946_0726517_76_387 103
200 3300035691 Ga0373931_0209316 Ga0373931_0209316_683_1000 103
201 3300041509 Ga0451843_0708525 Ga0451843_0708525_526_843 103
202 3300042876 Ga0451577_0140526 Ga0451577_0140526_580_891 103
203 3300042876 Ga0451577_0145183 Ga0451577_0145183_1510_1821 103
204 3300042876 Ga0451577_0919171 Ga0451577_0919171_104_418 103
205 3300044673 Ga0453683_1108612 Ga0453683_1108612_135_449 103
206 3300044712 Ga0453684_0000102 Ga0453684_0000102_57650_57970 103
207 3300044712 Ga0453684_0493303 Ga0453684_0493303_395_706 103
208 3300044712 Ga0453684_0753662 Ga0453684_0753662_68_379 103
209 3300044712 Ga0453684_1137576 Ga0453684_1137576_55_366 103
210 3300045051 Ga0451576_0098665 Ga0451576_0098665_1791_2105 103
211 3300045051 Ga0451576_0481414 Ga0451576_0481414_531_842 103
212 3300045051 Ga0451576_0696074 Ga0451576_0696074_53_367 103
213 3300045051 Ga0451576_0939773 Ga0451576_0939773_444_755 103
214 3300045051 Ga0451576_1306929 Ga0451576_1306929_418_732 103
215 3300045051 Ga0451576_1452996 Ga0451576_1452996_91_402 103
216 3300045051 Ga0451576_1518142 Ga0451576_1518142_72_383 103
217 3300046515 Ga0495620_0264346 Ga0495620_0264346_240_551 103
218 3300046523 Ga0495644_0361812 Ga0495644_0361812_127_438 103
219 3300046525 Ga0495663_0116053 Ga0495663_0116053_17_328 103
220 3300046526 Ga0495666_0100900 Ga0495666_0100900_213_524 103
221 3300046528 Ga0495642_0049656 Ga0495642_0049656_1189_1500 103
222 3300046537 Ga0495598_0072191 Ga0495598_0072191_265_576 103
223 3300046539 Ga0495621_0281414 Ga0495621_0281414_51_362 103
224 3300046683 Ga0495658_0033708 Ga0495658_0033708_473_784 103
225 3300046684 Ga0495669_0020954 Ga0495669_0020954_235_546 103
226 3300046691 Ga0495670_0459039 Ga0495670_0459039_154_465 103
227 3300046694 Ga0495649_0145390 Ga0495649_0145390_562_873 103
228 3300048912 Ga0496109_1474000 Ga0496109_1474000_227_538 103
229 3300049537 Ga0501321_019706 Ga0501321_019706_298_609 103
230 3300049539 Ga0501323_080234 Ga0501323_080234_13_324 103
231 3300049544 Ga0501328_06209 Ga0501328_06209_202_513 103
232 3300049569 Ga0501032_0390485 Ga0501032_0390485_126_437 103
233 3300049570 Ga0501033_0087626 Ga0501033_0087626_707_1018 103
234 3300049571 Ga0501034_0139405 Ga0501034_0139405_573_884 103
235 3300049572 Ga0501036_0108624 Ga0501036_0108624_1660_1971 103
236 3300049573 Ga0501037_0058573 Ga0501037_0058573_1505_1816 103
237 3300049574 Ga0501038_0036498 Ga0501038_0036498_2672_2983 103
238 3300049578 Ga0501042_1367741 Ga0501042_1367741_140_451 103
239 3300049579 Ga0501043_0005259 Ga0501043_0005259_1553_1864 103
240 3300049580 Ga0501046_0117946 Ga0501046_0117946_710_1021 103
241 3300049581 Ga0501047_0528090 Ga0501047_0528090_595_906 103
242 3300049584 Ga0501068_0053072 Ga0501068_0053072_720_1031 103
243 3300049585 Ga0501069_0586591 Ga0501069_0586591_299_610 103
244 3300049589 Ga0501073_0044994 Ga0501073_0044994_1378_1689 103
245 3300049590 Ga0501074_0160771 Ga0501074_0160771_313_624 103
246 3300049741 Ga0501079_0303122 Ga0501079_0303122_862_1173 103
247 3300049742 Ga0501080_0001810 Ga0501080_0001810_14214_14525 103
248 3300049744 Ga0501083_0031217 Ga0501083_0031217_2737_3048 103
249 3300049822 Ga0501035_0181327 Ga0501035_0181327_1359_1670 103
250 3300049823 Ga0501044_0094327 Ga0501044_0094327_470_781 103
251 3300050493 nmdc:mga0k408_2396_c1 nmdc:mga0k408_2396_c1_658_969 103
252 3300060353 Ga0501082_0103951 Ga0501082_0103951_595_906 103
253 3300003544 Ga0007417J51691_1075180 Ga0007417J51691_10751802 104
254 3300003575 Ga0007409J51694_1052044 Ga0007409J51694_10520441 104
255 3300003577 Ga0007416J51690_1058785 Ga0007416J51690_10587851 104
256 3300005289 Ga0065704_10355062 Ga0065704_103550621 104
257 3300005337 Ga0070682_100033505 Ga0070682_1000335053 104
258 3300005337 Ga0070682_100635279 Ga0070682_1006352792 104
259 3300005339 Ga0070660_100000420 Ga0070660_10000042018 104
260 3300005344 Ga0070661_100221150 Ga0070661_1002211502 104
261 3300005366 Ga0070659_100002423 Ga0070659_1000024239 104
262 3300005539 Ga0068853_100787340 Ga0068853_1007873401 104
263 3300005564 Ga0070664_100017877 Ga0070664_1000178772 104
264 3300005616 Ga0068852_100004530 Ga0068852_1000045304 104
265 3300013297 Ga0157378_11554666 Ga0157378_115546662 104
266 3300014969 Ga0157376_10298404 Ga0157376_102984042 104
267 3300017792 Ga0163161_10048368 Ga0163161_100483681 104
268 3300021361 Ga0213872_10012490 Ga0213872_100124902 104
269 3300021361 Ga0213872_10090818 Ga0213872_100908182 104
270 3300025919 Ga0207657_10001145 Ga0207657_1000114511 104
271 3300025920 Ga0207649_10166312 Ga0207649_101663122 104
272 3300025932 Ga0207690_10004281 Ga0207690_100042819 104
273 3300025945 Ga0207679_10019988 Ga0207679_100199882 104
274 3300026142 Ga0207698_10019245 Ga0207698_100192454 104
275 3300028563 Ga0265319_1254943 Ga0265319_12549431 104
276 3300031344 Ga0265316_10000005 Ga0265316_10000005184 104
277 3300031711 Ga0265314_10023421 Ga0265314_100234211 104
278 3300037312 Ga0395899_0000753 Ga0395899_0000753_16558_16878 104
279 3300037312 Ga0395899_0005697 Ga0395899_0005697_5603_5923 104
280 3300037312 Ga0395899_0014911 Ga0395899_0014911_3759_4079 104
281 3300037418 Ga0395900_0072127 Ga0395900_0072127_1128_1448 104
282 3300037418 Ga0395900_0201662 Ga0395900_0201662_328_648 104
283 3300037466 Ga0395898_0048259 Ga0395898_0048259_2007_2327 104
284 3300037471 Ga0395905_0000905 Ga0395905_0000905_22477_22797 104
285 3300037471 Ga0395905_0039921 Ga0395905_0039921_2534_2854 104
286 3300038443 Ga0395901_0007536 Ga0395901_0007536_297_617 104
287 3300038443 Ga0395901_0011581 Ga0395901_0011581_3668_3988 104
288 3300038443 Ga0395901_0046846 Ga0395901_0046846_264_584 104
289 3300038443 Ga0395901_0066342 Ga0395901_0066342_2003_2323 104
290 3300039447 Ga0436361_0277479 Ga0436361_0277479_557_874 104
291 3300039447 Ga0436361_0938544 Ga0436361_0938544_30618_30932 104
292 3300041408 Ga0439453_0139799 Ga0439453_0139799_77_397 104
293 3300041413 Ga0439465_0017989 Ga0439465_0017989_1832_2152 104
294 3300044683 Ga0466965_0351992 Ga0466965_0351992_109_486 104
295 3300044684 Ga0466966_0018553 Ga0466966_0018553_3392_3712 104
296 3300044719 Ga0466971_0152295 Ga0466971_0152295_534_854 104
297 3300044765 Ga0466970_0022221 Ga0466970_0022221_93_407 104
298 3300044765 Ga0466970_0615629 Ga0466970_0615629_11_331 104
299 3300044842 Ga0466957_0189316 Ga0466957_0189316_15_329 104
300 3300044901 Ga0466960_0218117 Ga0466960_0218117_196_516 104
301 3300045049 Ga0466959_0742651 Ga0466959_0742651_160_474 104
302 3300046507 Ga0495606_0030257 Ga0495606_0030257_1121_1441 104
303 3300046522 Ga0495643_0012413 Ga0495643_0012413_470_784 104
304 3300046542 Ga0495597_0061160 Ga0495597_0061160_554_868 104
305 3300046558 Ga0495633_0091625 Ga0495633_0091625_843_1157 104
306 3300046616 Ga0495668_0167679 Ga0495668_0167679_398_712 104
307 3300046665 Ga0495661_0021657 Ga0495661_0021657_3071_3385 104
308 3300047443 Ga0495687_015357 Ga0495687_015357_3068_3397 104
309 3300047443 Ga0495687_046448 Ga0495687_046448_950_1264 104
310 3300048903 Ga0496100_0394891 Ga0496100_0394891_169_483 104
311 3300048904 Ga0496101_0145179 Ga0496101_0145179_444_758 104
312 3300048907 Ga0496104_0644528 Ga0496104_0644528_90_404 104
313 3300048913 Ga0496110_1272501 Ga0496110_1272501_91_411 104
314 3300048915 Ga0496112_1289082 Ga0496112_1289082_318_632 104
315 3300048917 Ga0496114_0014471 Ga0496114_0014471_2407_2721 104
316 3300048917 Ga0496114_0478331 Ga0496114_0478331_552_872 104
317 3300048924 Ga0496121_0307082 Ga0496121_0307082_381_695 104
318 3300048926 Ga0496123_0353077 Ga0496123_0353077_150_464 104
319 3300048928 Ga0496125_0001079 Ga0496125_0001079_6262_6576 104
320 3300049160 Ga0501304_044415 Ga0501304_044415_166_486 104
321 3300049528 Ga0501312_125284 Ga0501312_125284_166_486 104
322 3300049571 Ga0501034_0293290 Ga0501034_0293290_785_1105 104
323 3300049581 Ga0501047_1129982 Ga0501047_1129982_16_330 104
324 3300049671 Ga0501238_037217 Ga0501238_037217_95_409 104
325 3300059493 Ga0587077_036178 Ga0587077_036178_361_681 104
326 3300059493 Ga0587077_096038 Ga0587077_096038_288_608 104
327 3300059504 Ga0587082_072257 Ga0587082_072257_287_607 104
328 3300059512 Ga0587092_095442 Ga0587092_095442_110_430 104
329 3300059623 Ga0587101_058587 Ga0587101_058587_265_585 104
330 3300059627 Ga0587117_044754 Ga0587117_044754_352_672 104
331 3300059642 Ga0587069_074494 Ga0587069_074494_50_370 104
332 3300059644 Ga0587075_109018 Ga0587075_109018_162_482 104
333 3300059645 Ga0587076_000856 Ga0587076_000856_100_420 104
334 3300059646 Ga0587078_041268 Ga0587078_041268_263_583 104
335 3300059647 Ga0587079_068746 Ga0587079_068746_269_589 104
336 3300060344 Ga0587071_060736 Ga0587071_060736_44_364 104
337 3300025913 Ga0207695_10507184 Ga0207695_105071842 105
338 3300026142 Ga0207698_12319844 Ga0207698_123198442 105
339 3300031238 Ga0265332_10003776 Ga0265332_1000377613 105
340 3300035084 Ga0373928_0083744 Ga0373928_0083744_437_763 105
341 3300037312 Ga0395899_0577403 Ga0395899_0577403_356_673 105
342 3300037418 Ga0395900_0446124 Ga0395900_0446124_163_480 105
343 3300037471 Ga0395905_0001709 Ga0395905_0001709_21732_22064 105
344 3300039447 Ga0436361_0195958 Ga0436361_0195958_20_337 105
345 3300048905 Ga0496102_0821417 Ga0496102_0821417_119_436 105
346 3300048906 Ga0496103_0403842 Ga0496103_0403842_385_702 105
347 3300048907 Ga0496104_1193832 Ga0496104_1193832_296_613 105
348 3300049571 Ga0501034_0004775 Ga0501034_0004775_14260_14586 105
349 3300049579 Ga0501043_0344863 Ga0501043_0344863_134_457 105
350 3300002067 JGI24735J21928_10240510 JGI24735J21928_102405101 106
351 3300003320 rootH2_10133009 rootH2_101330094 106
352 3300003758 Ga0055532_1001753 Ga0055532_10017533 106
353 3300003763 Ga0055529_1002548 Ga0055529_10025481 106
354 3300003790 Ga0055528_1001311 Ga0055528_10013113 106
355 3300003856 Ga0058692_1049358 Ga0058692_10493581 106
356 3300005327 Ga0070658_10037275 Ga0070658_100372752 106
357 3300005339 Ga0070660_100000013 Ga0070660_10000001397 106
358 3300005366 Ga0070659_100000028 Ga0070659_1000000283 106
359 3300005455 Ga0070663_100000106 Ga0070663_1000001062 106
360 3300005457 Ga0070662_101971582 Ga0070662_1019715821 106
361 3300005563 Ga0068855_100516492 Ga0068855_1005164921 106
362 3300005564 Ga0070664_100165765 Ga0070664_1001657652 106
363 3300005577 Ga0068857_101295812 Ga0068857_1012958122 106
364 3300005578 Ga0068854_100532622 Ga0068854_1005326222 106
365 3300005614 Ga0068856_100817066 Ga0068856_1008170662 106
366 3300005616 Ga0068852_100073030 Ga0068852_1000730303 106
367 3300005842 Ga0068858_100578578 Ga0068858_1005785782 106
368 3300009092 Ga0105250_10056390 Ga0105250_100563902 106
369 3300009093 Ga0105240_10000885 Ga0105240_1000088513 106
370 3300009093 Ga0105240_10012920 Ga0105240_100129208 106
371 3300009551 Ga0105238_10013704 Ga0105238_100137048 106
372 3300010375 Ga0105239_10042567 Ga0105239_100425673 106
373 3300015265 Ga0182005_1048244 Ga0182005_10482442 106
374 3300025225 Ga0209566_100296 Ga0209566_10029639 106
375 3300025226 Ga0209674_102092 Ga0209674_1020926 106
376 3300025228 Ga0209672_100067 Ga0209672_10006740 106
377 3300025228 Ga0209672_100079 Ga0209672_100079106 106
378 3300025229 Ga0209147_100012 Ga0209147_100012487 106
379 3300025229 Ga0209147_100061 Ga0209147_100061105 106
380 3300025229 Ga0209147_100107 Ga0209147_100107106 106
381 3300025242 Ga0209258_100107 Ga0209258_10010748 106
382 3300025242 Ga0209258_100273 Ga0209258_10027343 106
383 3300025254 Ga0209148_1000022 Ga0209148_1000022140 106
384 3300025256 Ga0209759_1005629 Ga0209759_10056295 106
385 3300025263 Ga0209565_1010865 Ga0209565_10108653 106
386 3300025272 Ga0209455_1000024 Ga0209455_1000024483 106
387 3300025273 Ga0209673_1000021 Ga0209673_100002195 106
388 3300025295 Ga0209564_1007871 Ga0209564_10078716 106
389 3300025711 Ga0207696_1130015 Ga0207696_11300152 106
390 3300025904 Ga0207647_10011413 Ga0207647_100114131 106
391 3300025909 Ga0207705_10137491 Ga0207705_101374911 106
392 3300025913 Ga0207695_10013953 Ga0207695_100139533 106
393 3300025913 Ga0207695_10309815 Ga0207695_103098151 106
394 3300025914 Ga0207671_10374579 Ga0207671_103745792 106
395 3300025919 Ga0207657_10000017 Ga0207657_1000001761 106
396 3300025924 Ga0207694_10262769 Ga0207694_102627692 106
397 3300025932 Ga0207690_10000009 Ga0207690_10000009154 106
398 3300025949 Ga0207667_10012365 Ga0207667_100123652 106
399 3300025981 Ga0207640_11608175 Ga0207640_116081751 106
400 3300026035 Ga0207703_10468996 Ga0207703_104689962 106
401 3300026041 Ga0207639_10912639 Ga0207639_109126392 106
402 3300026067 Ga0207678_10000369 Ga0207678_1000036935 106
403 3300026078 Ga0207702_10973020 Ga0207702_109730202 106
404 3300026116 Ga0207674_11131930 Ga0207674_111319302 106
405 3300026142 Ga0207698_10095622 Ga0207698_100956223 106
406 3300027312 Ga0209371_1000961 Ga0209371_100096111 106
407 3300030500 Ga0268256_1000809 Ga0268256_100080911 106
408 3300039437 Ga0436365_1315208 Ga0436365_1315208_1252_1572 106
409 3300039447 Ga0436361_0094736 Ga0436361_0094736_312_638 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06865

Ppnp

Pyrimidine/purine nucleoside phosphorylase

31

122

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.9678 15 106
3hqx-assembly1.cif.gz_A-2 crystal structure of protein of unknown function (duf1255,pf06865) from acinetobacter sp. adp1 0.9623 6 106
7eyp-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa ppnp 0.9611 15 106
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.9544 11 106
7eyj-assembly1.cif.gz_A crystal structure of escherichia coli ppnp 0.9509 15 106
ID Description Score Start End Superfamily
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9561 15 105 2.60.120.10
3hqxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9482 6 106 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9473 11 106 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9277 11 106 2.60.120.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9262 15 105 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1W1E2L5-F1-model_v4 Uncharacterized protein 1.003 40 106 GO:0004731
GO:0005829
GO:0016154
AF-A0A3D2UJL5-F1-model_v4 deleted 0.999 26 106
AF-A0A800IGA3-F1-model_v4 DUF1255 family protein 0.9961 39 106 GO:0004731
GO:0005829
GO:0016154
AF-A0A836TFZ2-F1-model_v4 Pyrimidine/purine nucleoside phosphorylase 0.993 19 106 GO:0004731
GO:0005829
GO:0016154
AF-A0A090RWU4-F1-model_v4 deleted 0.9918 42 106

Feature Viewer

pLDDT pTM Quality
94.87 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map