F436885

General Info

Members Datasets Scaffolds Average Seq Length
409 229 818 117

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10061040|JGI24751J29686_100610401
Length 115
Sequence MSSEVAIETFPNPRPERDFEITISCPEFTSVCPKTGLPDFGRITYVPGDRCIELKSLKYYMFGFRNRGIFFEAATNAILDDLVKACQPRRMTVVGDFAVRGGMKTIVTASYDAVT

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
166 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.2
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 23.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10061040 3300002459 Unclassified 776
2 Ga0065712_10000181 3300005290 Bacteria 61982
3 Ga0065712_10330803 3300005290 Unclassified 814
4 Ga0065712_10349959 3300005290 Bacteria 789
5 Ga0065715_10028096 3300005293 Bacteria 1491
6 Ga0065715_10049701 3300005293 Unclassified 1115
7 Ga0065707_10004923 3300005295 Bacteria 3020
8 Ga0065707_10062221 3300005295 Bacteria 703
9 Ga0065707_10347685 3300005295 Bacteria 923
10 Ga0065707_10754520 3300005295 Unclassified 617
11 Ga0065707_10761774 3300005295 Unclassified 594
12 Ga0070683_101192479 3300005329 Bacteria 732
13 Ga0070690_100158823 3300005330 Bacteria 1547
14 Ga0070670_100213566 3300005331 Bacteria 1678
15 Ga0070670_100857989 3300005331 Bacteria 822
16 Ga0070670_101992766 3300005331 Bacteria 535
17 Ga0070677_10131323 3300005333 Bacteria 1144
18 Ga0070677_10451236 3300005333 Unclassified 688
19 Ga0068869_100071327 3300005334 Bacteria 2572
20 Ga0070680_101672182 3300005336 Unclassified 552
21 Ga0068868_100867008 3300005338 Bacteria 819
22 Ga0070689_101265854 3300005340 Bacteria 663
23 Ga0070687_100423634 3300005343 Unclassified 879
24 Ga0070668_100401832 3300005347 Bacteria 1170
25 Ga0070668_100404265 3300005347 Bacteria 1166
26 Ga0070668_100802109 3300005347 Bacteria 836
27 Ga0070669_100198944 3300005353 Bacteria 1576
28 Ga0070675_100026997 3300005354 Bacteria 4611
29 Ga0070671_100284780 3300005355 Bacteria 1406
30 Ga0070674_100192016 3300005356 Unclassified 1572
31 Ga0070674_100786242 3300005356 Unclassified 821
32 Ga0070674_100931078 3300005356 Unclassified 759
33 Ga0070673_100008838 3300005364 Bacteria 6727
34 Ga0070673_100113729 3300005364 Bacteria 2248
35 Ga0070659_100506944 3300005366 Bacteria 1029
36 Ga0070667_100480146 3300005367 Bacteria 1138
37 Ga0070703_10221111 3300005406 Bacteria 754
38 Ga0070709_10682010 3300005434 Bacteria 798
39 Ga0070714_100044384 3300005435 Bacteria 3763
40 Ga0070713_101191247 3300005436 Bacteria 737
41 Ga0070701_11165580 3300005438 Bacteria 545
42 Ga0070700_100297238 3300005441 Unclassified 1177
43 Ga0070700_100606321 3300005441 Unclassified 858
44 Ga0070694_100010746 3300005444 Bacteria 5661
45 Ga0070694_100698421 3300005444 Bacteria 825
46 Ga0070708_100032674 3300005445 Bacteria 4516
47 Ga0070708_100960331 3300005445 Bacteria 802
48 Ga0070708_101001166 3300005445 Bacteria 784
49 Ga0070663_100455968 3300005455 Unclassified 1055
50 Ga0070663_100662767 3300005455 Bacteria 884
51 Ga0070678_100576597 3300005456 Unclassified 1002
52 Ga0070678_100991929 3300005456 Bacteria 772
53 Ga0070662_101519132 3300005457 Bacteria 578
54 Ga0070681_10598666 3300005458 Bacteria 1017
55 Ga0068867_101164612 3300005459 Bacteria 706
56 Ga0070685_10096806 3300005466 Bacteria 1796
57 Ga0070706_100772215 3300005467 Unclassified 890
58 Ga0070706_101437283 3300005467 Bacteria 631
59 Ga0070707_100097221 3300005468 Bacteria 2852
60 Ga0070698_100048722 3300005471 Bacteria 4329
61 Ga0070698_100310121 3300005471 Unclassified 1509
62 Ga0070698_100485185 3300005471 Bacteria 1173
63 Ga0070698_101298778 3300005471 Bacteria 678
64 Ga0070699_100062353 3300005518 Unclassified 3231
65 Ga0070699_100541010 3300005518 Bacteria 1060
66 Ga0070699_100786783 3300005518 Bacteria 870
67 Ga0070697_100173529 3300005536 Bacteria 1826
68 Ga0070697_101542201 3300005536 Unclassified 594
69 Ga0070672_100029678 3300005543 Bacteria 4103
70 Ga0070672_100340515 3300005543 Unclassified 1277
71 Ga0070686_100321884 3300005544 Bacteria 1153
72 Ga0070686_100605209 3300005544 Unclassified 864
73 Ga0070695_100001664 3300005545 Bacteria 12507
74 Ga0070696_100044427 3300005546 Bacteria 3077
75 Ga0070696_101373788 3300005546 Unclassified 601
76 Ga0070704_101856045 3300005549 Unclassified 558
77 Ga0070704_101876448 3300005549 Bacteria 555
78 Ga0068855_100303104 3300005563 Bacteria 1769
79 Ga0068857_101769409 3300005577 Unclassified 605
80 Ga0068854_100933118 3300005578 Bacteria 765
81 Ga0068859_100178887 3300005617 Bacteria 2203
82 Ga0068859_102079260 3300005617 Bacteria 627
83 Ga0068859_102290821 3300005617 Unclassified 596
84 Ga0068864_100175171 3300005618 Bacteria 1958
85 Ga0068861_100083352 3300005719 Unclassified 2508
86 Ga0068861_100595778 3300005719 Bacteria 1014
87 Ga0068861_101056991 3300005719 Unclassified 778
88 Ga0068870_10069636 3300005840 Bacteria 1915
89 Ga0068863_100222720 3300005841 Bacteria 1818
90 Ga0068858_100059840 3300005842 Unclassified 3521
91 Ga0068858_102568872 3300005842 Bacteria 503
92 Ga0068860_100120185 3300005843 Bacteria 2515
93 Ga0068860_100721959 3300005843 Unclassified 1007
94 Ga0068860_100932548 3300005843 Unclassified 885
95 Ga0068862_100183460 3300005844 Bacteria 1879
96 Ga0068862_100809704 3300005844 Unclassified 915
97 Ga0081539_10323069 3300005985 Bacteria 656
98 Ga0075432_10202504 3300006058 Bacteria 786
99 Ga0075432_10205377 3300006058 Bacteria 781
100 Ga0068871_100600328 3300006358 Bacteria 1001
101 Ga0075428_100611732 3300006844 Bacteria 1163
102 Ga0075428_100983059 3300006844 Unclassified 894
103 Ga0075430_100032537 3300006846 Bacteria 4427
104 Ga0075430_100056709 3300006846 Bacteria 3295
105 Ga0075430_100144640 3300006846 Bacteria 1980
106 Ga0075430_100187541 3300006846 Bacteria 1719
107 Ga0075431_100003362 3300006847 Bacteria 15503
108 Ga0075431_100338925 3300006847 Bacteria 1513
109 Ga0075433_10000315 3300006852 Bacteria 29386
110 Ga0075433_10003764 3300006852 Bacteria 11737
111 Ga0075433_10004917 3300006852 Bacteria 10460
112 Ga0075433_10058934 3300006852 Bacteria 3359
113 Ga0075433_10182299 3300006852 Bacteria 1868
114 Ga0075433_10314823 3300006852 Bacteria 1385
115 Ga0075434_100001869 3300006871 Bacteria 18216
116 Ga0075434_100002387 3300006871 Bacteria 16486
117 Ga0075434_100064990 3300006871 Bacteria 3633
118 Ga0075434_100179776 3300006871 Unclassified 2135
119 Ga0075434_101042044 3300006871 Unclassified 832
120 Ga0075429_100078581 3300006880 Bacteria 2876
121 Ga0075429_100150891 3300006880 Bacteria 2035
122 Ga0075429_100369129 3300006880 Bacteria 1256
123 Ga0075429_101136671 3300006880 Bacteria 682
124 Ga0068865_100406109 3300006881 Bacteria 1117
125 Ga0068865_101187699 3300006881 Unclassified 675
126 Ga0075436_100007465 3300006914 Bacteria 7478
127 Ga0075436_100024867 3300006914 Bacteria 4118
128 Ga0075436_100490598 3300006914 Bacteria 898
129 Ga0097620_100178877 3300006931 Bacteria 2203
130 Ga0097620_102079917 3300006931 Bacteria 627
131 Ga0097620_102290968 3300006931 Unclassified 596
132 Ga0075435_100003794 3300007076 Bacteria 10303
133 Ga0075435_100169963 3300007076 Unclassified 1839
134 Ga0075435_100823494 3300007076 Bacteria 808
135 Ga0075435_101421250 3300007076 Bacteria 608
136 Ga0099794_10088836 3300007265 Bacteria 1532
137 Ga0105240_10089223 3300009093 Bacteria 3771
138 Ga0111539_10000057 3300009094 Bacteria 114860
139 Ga0111539_10001193 3300009094 Bacteria 34547
140 Ga0111539_10016607 3300009094 Bacteria 9124
141 Ga0111539_10069904 3300009094 Bacteria 4145
142 Ga0111539_10372391 3300009094 Bacteria 1662
143 Ga0111539_11401827 3300009094 Unclassified 811
144 Ga0111539_11667159 3300009094 Unclassified 739
145 Ga0111539_12059778 3300009094 Bacteria 662
146 Ga0105245_10053457 3300009098 Bacteria 3625
147 Ga0105247_10023361 3300009101 Bacteria 3724
148 Ga0114129_10011661 3300009147 Bacteria 12508
149 Ga0114129_10053753 3300009147 Bacteria 5649
150 Ga0114129_10063340 3300009147 Bacteria 5163
151 Ga0114129_10063621 3300009147 Bacteria 5150
152 Ga0114129_10084188 3300009147 Unclassified 4416
153 Ga0114129_10141524 3300009147 Bacteria 3297
154 Ga0114129_10177705 3300009147 Bacteria 2898
155 Ga0114129_10311972 3300009147 Bacteria 2093
156 Ga0114129_11090484 3300009147 Bacteria 1000
157 Ga0114129_11353006 3300009147 Bacteria 880
158 Ga0114129_11448222 3300009147 Bacteria 846
159 Ga0114129_11535525 3300009147 Bacteria 817
160 Ga0114129_11885921 3300009147 Bacteria 725
161 Ga0114129_13171869 3300009147 Bacteria 535
162 Ga0105243_10457546 3300009148 Bacteria 1199
163 Ga0105243_10548649 3300009148 Bacteria 1104
164 Ga0105241_11856417 3300009174 Unclassified 589
165 Ga0105242_12288652 3300009176 Bacteria 587
166 Ga0105248_10054434 3300009177 Bacteria 4487
167 Ga0105248_10400705 3300009177 Unclassified 1545
168 Ga0105237_12059956 3300009545 Bacteria 579
169 Ga0105249_10501988 3300009553 Bacteria 1258
170 Ga0105249_11579240 3300009553 Bacteria 729
171 Ga0105249_11760156 3300009553 Unclassified 692
172 Ga0105249_12087639 3300009553 Bacteria 639
173 Ga0105249_13460769 3300009553 Bacteria 508
174 Ga0105246_10318427 3300011119 Bacteria 1263
175 Ga0157370_11127795 3300013104 Bacteria 708
176 Ga0157374_10717586 3300013296 Bacteria 1013
177 Ga0157374_12587068 3300013296 Bacteria 535
178 Ga0157378_10059486 3300013297 Bacteria 3409
179 Ga0157378_12409254 3300013297 Bacteria 578
180 Ga0163162_10544911 3300013306 Bacteria 1289
181 Ga0163162_11285785 3300013306 Bacteria 831
182 Ga0163162_11409575 3300013306 Unclassified 793
183 Ga0157372_10896141 3300013307 Bacteria 1029
184 Ga0157375_10672531 3300013308 Bacteria 1190
185 Ga0157375_10970115 3300013308 Bacteria 991
186 Ga0157375_13011973 3300013308 Unclassified 562
187 Ga0157380_10244430 3300014326 Bacteria 1620
188 Ga0157380_11148140 3300014326 Bacteria 818
189 Ga0157377_10121889 3300014745 Bacteria 1581
190 Ga0157377_10248112 3300014745 Bacteria 1152
191 Ga0163161_10666696 3300017792 Unclassified 863
192 Ga0163161_10876589 3300017792 Bacteria 759
193 Ga0207697_10080066 3300025315 Bacteria 1376
194 Ga0207653_10212252 3300025885 Bacteria 733
195 Ga0207682_10236634 3300025893 Unclassified 848
196 Ga0207642_10826675 3300025899 Bacteria 590
197 Ga0207642_10957028 3300025899 Unclassified 550
198 Ga0207688_10064238 3300025901 Bacteria 2072
199 Ga0207643_10119939 3300025908 Bacteria 1557
200 Ga0207684_10171063 3300025910 Bacteria 1873
201 Ga0207684_11147867 3300025910 Unclassified 645
202 Ga0207695_10186646 3300025913 Bacteria 1992
203 Ga0207660_10873005 3300025917 Unclassified 734
204 Ga0207662_10162984 3300025918 Bacteria 1425
205 Ga0207657_10231376 3300025919 Bacteria 1478
206 Ga0207646_10109566 3300025922 Bacteria 2477
207 Ga0207646_10895172 3300025922 Bacteria 787
208 Ga0207650_10678137 3300025925 Bacteria 870
209 Ga0207650_11322268 3300025925 Bacteria 613
210 Ga0207659_10081245 3300025926 Bacteria 2396
211 Ga0207664_10501068 3300025929 Bacteria 1087
212 Ga0207690_10207163 3300025932 Bacteria 1493
213 Ga0207706_10198101 3300025933 Bacteria 1761
214 Ga0207686_10560408 3300025934 Bacteria 894
215 Ga0207709_10840226 3300025935 Unclassified 743
216 Ga0207670_10927603 3300025936 Bacteria 730
217 Ga0207669_10071942 3300025937 Bacteria 2175
218 Ga0207669_10533039 3300025937 Bacteria 945
219 Ga0207704_10954753 3300025938 Unclassified 723
220 Ga0207691_10096394 3300025940 Bacteria 2645
221 Ga0207711_10406294 3300025941 Unclassified 1266
222 Ga0207689_10203686 3300025942 Unclassified 1634
223 Ga0207667_10205784 3300025949 Unclassified 2018
224 Ga0207651_10114349 3300025960 Bacteria 2032
225 Ga0207651_10282760 3300025960 Unclassified 1372
226 Ga0207712_10941657 3300025961 Bacteria 765
227 Ga0207668_10198714 3300025972 Bacteria 1595
228 Ga0207668_12004590 3300025972 Bacteria 521
229 Ga0207640_10556292 3300025981 Bacteria 965
230 Ga0207640_11030872 3300025981 Bacteria 725
231 Ga0207658_10404792 3300025986 Bacteria 1200
232 Ga0207703_12389170 3300026035 Bacteria 504
233 Ga0207678_10220672 3300026067 Bacteria 1623
234 Ga0207678_10854073 3300026067 Bacteria 804
235 Ga0207708_10409169 3300026075 Bacteria 1123
236 Ga0207708_10831920 3300026075 Unclassified 796
237 Ga0207641_10175575 3300026088 Bacteria 1959
238 Ga0207648_10022462 3300026089 Bacteria 5663
239 Ga0207676_10411350 3300026095 Bacteria 1266
240 Ga0207674_10625436 3300026116 Bacteria 1040
241 Ga0207675_100026411 3300026118 Bacteria 5406
242 Ga0207675_100081841 3300026118 Unclassified 3028
243 Ga0207675_100345692 3300026118 Unclassified 1457
244 Ga0207675_100347663 3300026118 Bacteria 1453
245 Ga0207675_100364772 3300026118 Bacteria 1418
246 Ga0207683_10103054 3300026121 Bacteria 2549
247 Ga0207683_10184169 3300026121 Bacteria 1894
248 Ga0207683_10633751 3300026121 Bacteria 990
249 Ga0207698_10894020 3300026142 Bacteria 895
250 Ga0209971_1047544 3300027682 Bacteria 1035
251 Ga0209974_10452251 3300027876 Unclassified 510
252 Ga0207428_10001821 3300027907 Bacteria 21821
253 Ga0207428_10002449 3300027907 Bacteria 18539
254 Ga0207428_10072705 3300027907 Bacteria 2699
255 Ga0207428_10294177 3300027907 Bacteria 1203
256 Ga0268265_10430004 3300028380 Bacteria 1228
257 Ga0268265_11816128 3300028380 Unclassified 616
258 Ga0268264_10396144 3300028381 Bacteria 1326
259 Ga0268264_10475356 3300028381 Unclassified 1215
260 Ga0268264_11249497 3300028381 Bacteria 752
261 Ga0265336_10250397 3300028666 Bacteria 526
262 Ga0265316_10162729 3300031344 Bacteria 1668
263 Ga0307408_100321787 3300031548 Bacteria 1303
264 Ga0307408_101027735 3300031548 Unclassified 761
265 Ga0265314_10020478 3300031711 Bacteria 5106
266 Ga0307405_10064180 3300031731 Bacteria 2333
267 Ga0307410_10241914 3300031852 Bacteria 1399
268 Ga0307409_100205697 3300031995 Bacteria 1765
269 Ga0307416_100093969 3300032002 Bacteria 2585
270 Ga0307416_102437057 3300032002 Bacteria 622
271 Ga0307411_10759495 3300032005 Bacteria 850
272 Ga0307415_102507126 3300032126 Bacteria 508
273 Ga0373926_0338289 3300035083 Unclassified 590
274 Ga0373934_0235962 3300035086 Unclassified 755
275 Ga0373923_0368355 3300035111 Bacteria 688
276 Ga0373939_0536835 3300035114 Bacteria 504
277 Ga0373945_0012325 3300035116 Unclassified 2838
278 Ga0373953_0368724 3300035117 Bacteria 630
279 Ga0373943_0022506 3300035170 Unclassified 2922
280 Ga0373955_0359128 3300035172 Unclassified 883
281 Ga0373961_0406949 3300035241 Bacteria 523
282 Ga0373962_0181941 3300035242 Bacteria 703
283 Ga0373935_0145349 3300035692 Bacteria 1605
284 Ga0373935_1476892 3300035692 Bacteria 509
285 Ga0373947_0140964 3300035725 Bacteria 1546
286 Ga0373925_0039070 3300037068 Unclassified 3511
287 Ga0373925_0698730 3300037068 Bacteria 836
288 Ga0395905_0907705 3300037471 Bacteria 784
289 Ga0395901_1381911 3300038443 Unclassified 663
290 Ga0439439_0216799 3300041406 Unclassified 560
291 Ga0439453_0004269 3300041408 Bacteria 2116
292 Ga0450917_014803 3300042120 Bacteria 654
293 Ga0450888_024441 3300042126 Bacteria 786
294 Ga0439435_0029339 3300042436 Bacteria 1484
295 Ga0439444_0192406 3300042437 Unclassified 511
296 Ga0439464_0245056 3300042439 Bacteria 578
297 Ga0439460_0009513 3300042461 Bacteria 2471
298 Ga0439460_0040166 3300042461 Bacteria 1370
299 Ga0451577_0034298 3300042876 Bacteria 4575
300 Ga0451577_0322115 3300042876 Bacteria 1402
301 Ga0453684_1065065 3300044712 Bacteria 856
302 Ga0451576_0258263 3300045051 Bacteria 1821
303 Ga0451576_0783828 3300045051 Bacteria 1001
304 Ga0466967_0307968 3300045976 Unclassified 1525
305 Ga0466967_1304370 3300045976 Bacteria 723
306 Ga0495584_0375194 3300046491 Bacteria 722
307 Ga0495608_0506533 3300046511 Bacteria 731
308 Ga0495598_0049762 3300046537 Bacteria 1257
309 Ga0495621_0019247 3300046539 Bacteria 2228
310 Ga0495656_0021972 3300046615 Unclassified 2492
311 Ga0495656_0300773 3300046615 Bacteria 822
312 Ga0495668_0426185 3300046616 Unclassified 730
313 Ga0495611_0513323 3300046648 Bacteria 544
314 Ga0495659_0558474 3300046664 Bacteria 505
315 Ga0495674_0201847 3300047319 Bacteria 1649
316 Ga0496100_1623015 3300048903 Unclassified 511
317 Ga0496102_0082685 3300048905 Bacteria 2962
318 Ga0496106_0094318 3300048909 Unclassified 2314
319 Ga0496106_1152204 3300048909 Bacteria 606
320 Ga0496109_0134446 3300048912 Bacteria 2310
321 Ga0496109_0306431 3300048912 Unclassified 1498
322 Ga0496112_0083573 3300048915 Bacteria 3158
323 Ga0496112_0088310 3300048915 Bacteria 3068
324 Ga0496112_0721979 3300048915 Unclassified 924
325 Ga0501297_028223 3300049520 Bacteria 735
326 Ga0501298_003345 3300049521 Bacteria 2484
327 Ga0501298_173734 3300049521 Bacteria 537
328 Ga0501300_037038 3300049523 Unclassified 729
329 Ga0501031_1089451 3300049568 Unclassified 510
330 Ga0501036_0075477 3300049572 Bacteria 2851
331 Ga0501040_0036798 3300049576 Bacteria 3324
332 Ga0501041_0100074 3300049577 Bacteria 1794
333 Ga0501042_0083708 3300049578 Bacteria 2287
334 Ga0501042_0840745 3300049578 Bacteria 668
335 Ga0501048_0482245 3300049582 Unclassified 889
336 Ga0501070_0768066 3300049586 Bacteria 759
337 Ga0501071_0649681 3300049587 Bacteria 811
338 Ga0501071_1104915 3300049587 Unclassified 613
339 Ga0501072_0249001 3300049588 Bacteria 1415
340 Ga0501072_0795777 3300049588 Unclassified 741
341 Ga0501074_0496063 3300049590 Bacteria 865
342 Ga0501075_0422445 3300049591 Bacteria 1016
343 Ga0501076_0206831 3300049592 Bacteria 1603
344 Ga0501076_0489077 3300049592 Unclassified 1014
345 Ga0501077_0566916 3300049593 Bacteria 729
346 Ga0501235_079672 3300049669 Unclassified 782
347 Ga0501249_004079 3300049679 Bacteria 2955
348 Ga0501259_014680 3300049688 Bacteria 1331
349 Ga0501225_0208752 3300049705 Bacteria 623
350 Ga0501079_0083952 3300049741 Bacteria 2464
351 Ga0501079_1091287 3300049741 Bacteria 629
352 Ga0501080_0063479 3300049742 Bacteria 3438
353 Ga0501081_0007113 3300049743 Bacteria 7272
354 Ga0501081_0946052 3300049743 Unclassified 650
355 Ga0501267_003583 3300049764 Bacteria 1422
356 Ga0501268_019177 3300049765 Unclassified 1156
357 Ga0501280_098450 3300049776 Bacteria 559
358 Ga0501045_0107337 3300049824 Bacteria 2069
359 nmdc:mga05p37_1633661_c1 3300050507 Bacteria 633
360 nmdc:mga05p37_184845_c1 3300050507 Bacteria 2534
361 nmdc:mga05p37_2382_c1 3300050507 Bacteria 21864
362 nmdc:mga05p37_320739_c1 3300050507 Bacteria 1834
363 nmdc:mga05p37_343885_c1 3300050507 Bacteria 1758
364 nmdc:mga05p37_363511_c1 3300050507 Bacteria 1701
365 nmdc:mga05p37_37138_c1 3300050507 Bacteria 5975
366 nmdc:mga05p37_447094_c1 3300050507 Bacteria 1497
367 nmdc:mga05p37_453871_c1 3300050507 Bacteria 1483
368 nmdc:mga05p37_5466_c1 3300050507 Bacteria 14916
369 nmdc:mga05p37_591278_c1 3300050507 Bacteria 1254
370 nmdc:mga05p37_794053_c1 3300050507 Unclassified 1037
371 nmdc:mga05p37_95427_c1 3300050507 Bacteria 3664
372 nmdc:mga05p37_970868_c1 3300050507 Bacteria 907
373 nmdc:mga09592_288787_c1 3300050508 Bacteria 1422
374 nmdc:mga09592_317195_c1 3300050508 Bacteria 1351
375 nmdc:mga09592_51451_c1 3300050508 Bacteria 3475
376 nmdc:mga09592_550050_c1 3300050508 Bacteria 991
377 nmdc:mga0qj67_244552_c1 3300050509 Bacteria 1456
378 nmdc:mga0qj67_46898_c1 3300050509 Unclassified 3412
379 nmdc:mga0qj67_90437_c1 3300050509 Bacteria 2459
380 nmdc:mga06r32_127475_c1 3300050510 Bacteria 2515
381 nmdc:mga08y16_162_c1 3300050511 Bacteria 58005
382 nmdc:mga08y16_25086_c1 3300050511 Bacteria 6289
383 nmdc:mga08y16_26185_c1 3300050511 Bacteria 6151
384 nmdc:mga08y16_542539_c1 3300050511 Bacteria 1178
385 nmdc:mga08y16_709879_c1 3300050511 Bacteria 1005
386 nmdc:mga0n895_1016146_c1 3300050512 Bacteria 810
387 nmdc:mga0n895_136269_c1 3300050512 Bacteria 2482
388 nmdc:mga0n895_1588761_c1 3300050512 Bacteria 619
389 nmdc:mga0n895_285115_c1 3300050512 Bacteria 1675
390 nmdc:mga0rr50_36941_c1 3300050513 Bacteria 3522
391 nmdc:mga0rr50_44298_c1 3300050513 Bacteria 3263
392 nmdc:mga0rr50_821540_c1 3300050513 Unclassified 793
393 nmdc:mga08x19_19162_c1 3300050514 Bacteria 4197
394 nmdc:mga08x19_30522_c1 3300050514 Bacteria 3387
395 nmdc:mga08x19_71963_c1 3300050514 Unclassified 2255
396 nmdc:mga0a205_139188_c1 3300050515 Bacteria 2328
397 nmdc:mga0a205_202123_c1 3300050515 Bacteria 1877
398 nmdc:mga0a205_4546_c1 3300050515 Bacteria 12451
399 nmdc:mga0a205_53787_c1 3300050515 Bacteria 3886
400 nmdc:mga0a205_55020_c1 3300050515 Bacteria 3843
401 nmdc:mga0a205_69065_c1 3300050515 Bacteria 3413
402 nmdc:mga0a205_892325_c1 3300050515 Bacteria 736
403 nmdc:mga0a205_9923_c1 3300050515 Bacteria 8734
404 Ga0495595_0124371 3300053084 Unclassified 1258
405 Ga0495619_0415845 3300053085 Unclassified 928
406 Ga0501084_0214819 3300054114 Bacteria 1623
407 Ga0501084_0825373 3300054114 Bacteria 780
408 Ga0587101_026434 3300059623 Unclassified 876
409 Ga0501082_0109154 3300060353 Bacteria 2395
410 JGI24751J29686_10061040
411 Ga0065712_10000181
412 Ga0065712_10330803
413 Ga0065712_10349959
414 Ga0065715_10028096
415 Ga0065715_10049701
416 Ga0065707_10004923
417 Ga0065707_10062221
418 Ga0065707_10347685
419 Ga0065707_10754520
420 Ga0065707_10761774
421 Ga0070683_101192479
422 Ga0070690_100158823
423 Ga0070670_100213566
424 Ga0070670_100857989
425 Ga0070670_101992766
426 Ga0070677_10131323
427 Ga0070677_10451236
428 Ga0068869_100071327
429 Ga0070680_101672182
430 Ga0068868_100867008
431 Ga0070689_101265854
432 Ga0070687_100423634
433 Ga0070668_100401832
434 Ga0070668_100404265
435 Ga0070668_100802109
436 Ga0070669_100198944
437 Ga0070675_100026997
438 Ga0070671_100284780
439 Ga0070674_100192016
440 Ga0070674_100786242
441 Ga0070674_100931078
442 Ga0070673_100008838
443 Ga0070673_100113729
444 Ga0070659_100506944
445 Ga0070667_100480146
446 Ga0070703_10221111
447 Ga0070709_10682010
448 Ga0070714_100044384
449 Ga0070713_101191247
450 Ga0070701_11165580
451 Ga0070700_100297238
452 Ga0070700_100606321
453 Ga0070694_100010746
454 Ga0070694_100698421
455 Ga0070708_100032674
456 Ga0070708_100960331
457 Ga0070708_101001166
458 Ga0070663_100455968
459 Ga0070663_100662767
460 Ga0070678_100576597
461 Ga0070678_100991929
462 Ga0070662_101519132
463 Ga0070681_10598666
464 Ga0068867_101164612
465 Ga0070685_10096806
466 Ga0070706_100772215
467 Ga0070706_101437283
468 Ga0070707_100097221
469 Ga0070698_100048722
470 Ga0070698_100310121
471 Ga0070698_100485185
472 Ga0070698_101298778
473 Ga0070699_100062353
474 Ga0070699_100541010
475 Ga0070699_100786783
476 Ga0070697_100173529
477 Ga0070697_101542201
478 Ga0070672_100029678
479 Ga0070672_100340515
480 Ga0070686_100321884
481 Ga0070686_100605209
482 Ga0070695_100001664
483 Ga0070696_100044427
484 Ga0070696_101373788
485 Ga0070704_101856045
486 Ga0070704_101876448
487 Ga0068855_100303104
488 Ga0068857_101769409
489 Ga0068854_100933118
490 Ga0068859_100178887
491 Ga0068859_102079260
492 Ga0068859_102290821
493 Ga0068864_100175171
494 Ga0068861_100083352
495 Ga0068861_100595778
496 Ga0068861_101056991
497 Ga0068870_10069636
498 Ga0068863_100222720
499 Ga0068858_100059840
500 Ga0068858_102568872
501 Ga0068860_100120185
502 Ga0068860_100721959
503 Ga0068860_100932548
504 Ga0068862_100183460
505 Ga0068862_100809704
506 Ga0081539_10323069
507 Ga0075432_10202504
508 Ga0075432_10205377
509 Ga0068871_100600328
510 Ga0075428_100611732
511 Ga0075428_100983059
512 Ga0075430_100032537
513 Ga0075430_100056709
514 Ga0075430_100144640
515 Ga0075430_100187541
516 Ga0075431_100003362
517 Ga0075431_100338925
518 Ga0075433_10000315
519 Ga0075433_10003764
520 Ga0075433_10004917
521 Ga0075433_10058934
522 Ga0075433_10182299
523 Ga0075433_10314823
524 Ga0075434_100001869
525 Ga0075434_100002387
526 Ga0075434_100064990
527 Ga0075434_100179776
528 Ga0075434_101042044
529 Ga0075429_100078581
530 Ga0075429_100150891
531 Ga0075429_100369129
532 Ga0075429_101136671
533 Ga0068865_100406109
534 Ga0068865_101187699
535 Ga0075436_100007465
536 Ga0075436_100024867
537 Ga0075436_100490598
538 Ga0097620_100178877
539 Ga0097620_102079917
540 Ga0097620_102290968
541 Ga0075435_100003794
542 Ga0075435_100169963
543 Ga0075435_100823494
544 Ga0075435_101421250
545 Ga0099794_10088836
546 Ga0105240_10089223
547 Ga0111539_10000057
548 Ga0111539_10001193
549 Ga0111539_10016607
550 Ga0111539_10069904
551 Ga0111539_10372391
552 Ga0111539_11401827
553 Ga0111539_11667159
554 Ga0111539_12059778
555 Ga0105245_10053457
556 Ga0105247_10023361
557 Ga0114129_10011661
558 Ga0114129_10053753
559 Ga0114129_10063340
560 Ga0114129_10063621
561 Ga0114129_10084188
562 Ga0114129_10141524
563 Ga0114129_10177705
564 Ga0114129_10311972
565 Ga0114129_11090484
566 Ga0114129_11353006
567 Ga0114129_11448222
568 Ga0114129_11535525
569 Ga0114129_11885921
570 Ga0114129_13171869
571 Ga0105243_10457546
572 Ga0105243_10548649
573 Ga0105241_11856417
574 Ga0105242_12288652
575 Ga0105248_10054434
576 Ga0105248_10400705
577 Ga0105237_12059956
578 Ga0105249_10501988
579 Ga0105249_11579240
580 Ga0105249_11760156
581 Ga0105249_12087639
582 Ga0105249_13460769
583 Ga0105246_10318427
584 Ga0157370_11127795
585 Ga0157374_10717586
586 Ga0157374_12587068
587 Ga0157378_10059486
588 Ga0157378_12409254
589 Ga0163162_10544911
590 Ga0163162_11285785
591 Ga0163162_11409575
592 Ga0157372_10896141
593 Ga0157375_10672531
594 Ga0157375_10970115
595 Ga0157375_13011973
596 Ga0157380_10244430
597 Ga0157380_11148140
598 Ga0157377_10121889
599 Ga0157377_10248112
600 Ga0163161_10666696
601 Ga0163161_10876589
602 Ga0207697_10080066
603 Ga0207653_10212252
604 Ga0207682_10236634
605 Ga0207642_10826675
606 Ga0207642_10957028
607 Ga0207688_10064238
608 Ga0207643_10119939
609 Ga0207684_10171063
610 Ga0207684_11147867
611 Ga0207695_10186646
612 Ga0207660_10873005
613 Ga0207662_10162984
614 Ga0207657_10231376
615 Ga0207646_10109566
616 Ga0207646_10895172
617 Ga0207650_10678137
618 Ga0207650_11322268
619 Ga0207659_10081245
620 Ga0207664_10501068
621 Ga0207690_10207163
622 Ga0207706_10198101
623 Ga0207686_10560408
624 Ga0207709_10840226
625 Ga0207670_10927603
626 Ga0207669_10071942
627 Ga0207669_10533039
628 Ga0207704_10954753
629 Ga0207691_10096394
630 Ga0207711_10406294
631 Ga0207689_10203686
632 Ga0207667_10205784
633 Ga0207651_10114349
634 Ga0207651_10282760
635 Ga0207712_10941657
636 Ga0207668_10198714
637 Ga0207668_12004590
638 Ga0207640_10556292
639 Ga0207640_11030872
640 Ga0207658_10404792
641 Ga0207703_12389170
642 Ga0207678_10220672
643 Ga0207678_10854073
644 Ga0207708_10409169
645 Ga0207708_10831920
646 Ga0207641_10175575
647 Ga0207648_10022462
648 Ga0207676_10411350
649 Ga0207674_10625436
650 Ga0207675_100026411
651 Ga0207675_100081841
652 Ga0207675_100345692
653 Ga0207675_100347663
654 Ga0207675_100364772
655 Ga0207683_10103054
656 Ga0207683_10184169
657 Ga0207683_10633751
658 Ga0207698_10894020
659 Ga0209971_1047544
660 Ga0209974_10452251
661 Ga0207428_10001821
662 Ga0207428_10002449
663 Ga0207428_10072705
664 Ga0207428_10294177
665 Ga0268265_10430004
666 Ga0268265_11816128
667 Ga0268264_10396144
668 Ga0268264_10475356
669 Ga0268264_11249497
670 Ga0265336_10250397
671 Ga0265316_10162729
672 Ga0307408_100321787
673 Ga0307408_101027735
674 Ga0265314_10020478
675 Ga0307405_10064180
676 Ga0307410_10241914
677 Ga0307409_100205697
678 Ga0307416_100093969
679 Ga0307416_102437057
680 Ga0307411_10759495
681 Ga0307415_102507126
682 Ga0373926_0338289
683 Ga0373934_0235962
684 Ga0373923_0368355
685 Ga0373939_0536835
686 Ga0373945_0012325
687 Ga0373953_0368724
688 Ga0373943_0022506
689 Ga0373955_0359128
690 Ga0373961_0406949
691 Ga0373962_0181941
692 Ga0373935_0145349
693 Ga0373935_1476892
694 Ga0373947_0140964
695 Ga0373925_0039070
696 Ga0373925_0698730
697 Ga0395905_0907705
698 Ga0395901_1381911
699 Ga0439439_0216799
700 Ga0439453_0004269
701 Ga0450917_014803
702 Ga0450888_024441
703 Ga0439435_0029339
704 Ga0439444_0192406
705 Ga0439464_0245056
706 Ga0439460_0009513
707 Ga0439460_0040166
708 Ga0451577_0034298
709 Ga0451577_0322115
710 Ga0453684_1065065
711 Ga0451576_0258263
712 Ga0451576_0783828
713 Ga0466967_0307968
714 Ga0466967_1304370
715 Ga0495584_0375194
716 Ga0495608_0506533
717 Ga0495598_0049762
718 Ga0495621_0019247
719 Ga0495656_0021972
720 Ga0495656_0300773
721 Ga0495668_0426185
722 Ga0495611_0513323
723 Ga0495659_0558474
724 Ga0495674_0201847
725 Ga0496100_1623015
726 Ga0496102_0082685
727 Ga0496106_0094318
728 Ga0496106_1152204
729 Ga0496109_0134446
730 Ga0496109_0306431
731 Ga0496112_0083573
732 Ga0496112_0088310
733 Ga0496112_0721979
734 Ga0501297_028223
735 Ga0501298_003345
736 Ga0501298_173734
737 Ga0501300_037038
738 Ga0501031_1089451
739 Ga0501036_0075477
740 Ga0501040_0036798
741 Ga0501041_0100074
742 Ga0501042_0083708
743 Ga0501042_0840745
744 Ga0501048_0482245
745 Ga0501070_0768066
746 Ga0501071_0649681
747 Ga0501071_1104915
748 Ga0501072_0249001
749 Ga0501072_0795777
750 Ga0501074_0496063
751 Ga0501075_0422445
752 Ga0501076_0206831
753 Ga0501076_0489077
754 Ga0501077_0566916
755 Ga0501235_079672
756 Ga0501249_004079
757 Ga0501259_014680
758 Ga0501225_0208752
759 Ga0501079_0083952
760 Ga0501079_1091287
761 Ga0501080_0063479
762 Ga0501081_0007113
763 Ga0501081_0946052
764 Ga0501267_003583
765 Ga0501268_019177
766 Ga0501280_098450
767 Ga0501045_0107337
768 nmdc:mga05p37_1633661_c1
769 nmdc:mga05p37_184845_c1
770 nmdc:mga05p37_2382_c1
771 nmdc:mga05p37_320739_c1
772 nmdc:mga05p37_343885_c1
773 nmdc:mga05p37_363511_c1
774 nmdc:mga05p37_37138_c1
775 nmdc:mga05p37_447094_c1
776 nmdc:mga05p37_453871_c1
777 nmdc:mga05p37_5466_c1
778 nmdc:mga05p37_591278_c1
779 nmdc:mga05p37_794053_c1
780 nmdc:mga05p37_95427_c1
781 nmdc:mga05p37_970868_c1
782 nmdc:mga09592_288787_c1
783 nmdc:mga09592_317195_c1
784 nmdc:mga09592_51451_c1
785 nmdc:mga09592_550050_c1
786 nmdc:mga0qj67_244552_c1
787 nmdc:mga0qj67_46898_c1
788 nmdc:mga0qj67_90437_c1
789 nmdc:mga06r32_127475_c1
790 nmdc:mga08y16_162_c1
791 nmdc:mga08y16_25086_c1
792 nmdc:mga08y16_26185_c1
793 nmdc:mga08y16_542539_c1
794 nmdc:mga08y16_709879_c1
795 nmdc:mga0n895_1016146_c1
796 nmdc:mga0n895_136269_c1
797 nmdc:mga0n895_1588761_c1
798 nmdc:mga0n895_285115_c1
799 nmdc:mga0rr50_36941_c1
800 nmdc:mga0rr50_44298_c1
801 nmdc:mga0rr50_821540_c1
802 nmdc:mga08x19_19162_c1
803 nmdc:mga08x19_30522_c1
804 nmdc:mga08x19_71963_c1
805 nmdc:mga0a205_139188_c1
806 nmdc:mga0a205_202123_c1
807 nmdc:mga0a205_4546_c1
808 nmdc:mga0a205_53787_c1
809 nmdc:mga0a205_55020_c1
810 nmdc:mga0a205_69065_c1
811 nmdc:mga0a205_892325_c1
812 nmdc:mga0a205_9923_c1
813 Ga0495595_0124371
814 Ga0495619_0415845
815 Ga0501084_0214819
816 Ga0501084_0825373
817 Ga0587101_026434
818 Ga0501082_0109154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

38

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgc-assembly1.cif.gz_A-2 crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 0.8789 2 114
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.8718 1 114
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.8573 1 114
4fgc-assembly1.cif.gz_A-2 crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 0.8572 2 114
5udg-assembly1.cif.gz_A mutant e97q crystal structure of bacillus subtilis quef with a disulfide cys 55-99 0.8438 2 114
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8595 1 114 3.30.1130.10
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8452 1 114 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8119 8 113 3.30.1130.10
1jkfB03 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.805 90 113 3.30.360.10
af_C7IZC4_3_119_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8038 89 112 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A523DJI9-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9124 3 114 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A2V7Y5Y6-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9124 5 113 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A317HQW4-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9118 3 111 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A2H6G2X2-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9114 7 114 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A1Z4BVU0-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9114 7 114 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Map