F436848

General Info

Members Datasets Scaffolds Average Seq Length
408 208 816 273

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0158331|Ga0500578_0158331_364_1272
Length 297
Sequence MSMTSTPHQHLTPAAEQARPPEPGGERGLPPPRAHAEASGARSAADAEVILECRDLSVGYDQPILEHVDLSIHRGEIVVLLGGSGCGKSTMLRTIIGLKPPIAGEICVFGQSMYELSPDERNRLLRRTGTAFQQDALFGSMTIEDNVALPLRELTKLPAAVICEMVRLRLALVGLDGMAHRMPSEISGGQRKRAALARASILDPELVFCDEPSAGLDPVVAAGIDETLLRFRAALGITLVVVTHELESIRTIADRAVMFAHGGILAAGTVDELSGSSVPEVHGFFHRVADPPAGTAS

Samples

Sample ID Description Type Environment
1 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
103 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
104 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
208 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 2.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 2.7
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 15.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500578_0158331 3300053086 Bacteria 1407
2 Ga0068869_100002966 3300005334 Bacteria 10307
3 Ga0068868_100038815 3300005338 Bacteria 3696
4 Ga0070689_100653578 3300005340 Bacteria 915
5 Ga0070671_100000257 3300005355 Bacteria 35516
6 Ga0070688_100089308 3300005365 Bacteria 2011
7 Ga0070709_10013034 3300005434 Bacteria 4666
8 Ga0070709_10037382 3300005434 Bacteria 2964
9 Ga0070709_10183725 3300005434 Bacteria 1470
10 Ga0070714_100030917 3300005435 Bacteria 4462
11 Ga0070714_100034937 3300005435 Bacteria 4210
12 Ga0070714_100325947 3300005435 Bacteria 1437
13 Ga0070714_100463448 3300005435 Bacteria 1205
14 Ga0070713_100005744 3300005436 Bacteria 8522
15 Ga0070713_100007699 3300005436 Bacteria 7581
16 Ga0070713_100022953 3300005436 Bacteria 4831
17 Ga0070713_100139253 3300005436 Bacteria 2148
18 Ga0070710_10077032 3300005437 Unclassified 1937
19 Ga0070710_10381326 3300005437 Bacteria 940
20 Ga0070711_100063346 3300005439 Unclassified 2580
21 Ga0070711_100228195 3300005439 Bacteria 1451
22 Ga0070711_100308966 3300005439 Bacteria 1260
23 Ga0070705_100001969 3300005440 Bacteria 10501
24 Ga0070700_100386067 3300005441 Bacteria 1049
25 Ga0070694_100004181 3300005444 Bacteria 8672
26 Ga0070694_100036203 3300005444 Bacteria 3268
27 Ga0070708_100001956 3300005445 Bacteria 15904
28 Ga0070708_100103617 3300005445 Unclassified 2609
29 Ga0070708_100284352 3300005445 Bacteria 1557
30 Ga0070708_100498503 3300005445 Bacteria 1149
31 Ga0070708_100748952 3300005445 Bacteria 919
32 Ga0070678_100000592 3300005456 Bacteria 17801
33 Ga0068867_100353270 3300005459 Bacteria 1227
34 Ga0068867_100586423 3300005459 Bacteria 970
35 Ga0070706_100004767 3300005467 Bacteria 13005
36 Ga0070706_100036651 3300005467 Bacteria 4530
37 Ga0070707_100004132 3300005468 Bacteria 13612
38 Ga0070707_100092349 3300005468 Bacteria 2931
39 Ga0070707_100129094 3300005468 Unclassified 2457
40 Ga0070707_100250955 3300005468 Bacteria 1722
41 Ga0070698_100000286 3300005471 Bacteria 51545
42 Ga0070698_100009114 3300005471 Bacteria 10656
43 Ga0070698_100093991 3300005471 Bacteria 2978
44 Ga0070699_100022029 3300005518 Bacteria 5489
45 Ga0070699_100179175 3300005518 Unclassified 1880
46 Ga0070679_100004782 3300005530 Bacteria 12488
47 Ga0070679_100315872 3300005530 Bacteria 1512
48 Ga0070697_100002229 3300005536 Bacteria 14862
49 Ga0070697_100047753 3300005536 Bacteria 3471
50 Ga0070697_100097516 3300005536 Bacteria 2439
51 Ga0070697_100107270 3300005536 Bacteria 2324
52 Ga0070697_100178643 3300005536 Bacteria 1799
53 Ga0068853_100222891 3300005539 Bacteria 1723
54 Ga0070686_100257951 3300005544 Bacteria 1276
55 Ga0070695_100002277 3300005545 Bacteria 10994
56 Ga0070695_100187985 3300005545 Bacteria 1468
57 Ga0070696_100000725 3300005546 Bacteria 21101
58 Ga0070696_100105306 3300005546 Bacteria 2026
59 Ga0070693_100000383 3300005547 Bacteria 20139
60 Ga0070665_100110820 3300005548 Unclassified 2747
61 Ga0070665_100654821 3300005548 Bacteria 1063
62 Ga0070704_100000356 3300005549 Bacteria 20762
63 Ga0070704_100045823 3300005549 Bacteria 3045
64 Ga0070704_100183394 3300005549 Bacteria 1676
65 Ga0068855_100129828 3300005563 Bacteria 2879
66 Ga0068859_100084053 3300005617 Bacteria 3227
67 Ga0068859_100272634 3300005617 Unclassified 1784
68 Ga0068859_100343757 3300005617 Bacteria 1586
69 Ga0068864_100063028 3300005618 Bacteria 3213
70 Ga0068864_100184182 3300005618 Bacteria 1911
71 Ga0068861_100222495 3300005719 Unclassified 1596
72 Ga0068863_100059206 3300005841 Bacteria 3624
73 Ga0068863_100195630 3300005841 Bacteria 1944
74 Ga0068863_100280922 3300005841 Bacteria 1613
75 Ga0068863_100819399 3300005841 Unclassified 929
76 Ga0068858_100006201 3300005842 Bacteria 11656
77 Ga0068860_100009764 3300005843 Bacteria 9530
78 Ga0068862_100069114 3300005844 Bacteria 3048
79 Ga0070717_10002171 3300006028 Bacteria 13756
80 Ga0070717_10016657 3300006028 Bacteria 5704
81 Ga0070717_10040544 3300006028 Bacteria 3793
82 Ga0070717_10064408 3300006028 Bacteria 3045
83 Ga0070717_10067995 3300006028 Bacteria 2965
84 Ga0070717_10071324 3300006028 Bacteria 2898
85 Ga0070715_10033998 3300006163 Unclassified 2087
86 Ga0070716_100000173 3300006173 Bacteria 25361
87 Ga0070716_100216525 3300006173 Unclassified 1284
88 Ga0070716_100277909 3300006173 Bacteria 1154
89 Ga0070712_100046158 3300006175 Unclassified 3011
90 Ga0070712_100150689 3300006175 Unclassified 1785
91 Ga0070712_100477153 3300006175 Bacteria 1042
92 Ga0097621_100345524 3300006237 Bacteria 1322
93 Ga0068871_100271643 3300006358 Bacteria 1481
94 Ga0075433_10390672 3300006852 Bacteria 1228
95 Ga0075434_100150300 3300006871 Bacteria 2349
96 Ga0075429_100045499 3300006880 Bacteria 3819
97 Ga0068865_100007610 3300006881 Bacteria 6670
98 Ga0075436_100003687 3300006914 Bacteria 10499
99 Ga0075436_100005800 3300006914 Bacteria 8480
100 Ga0097620_100084053 3300006931 Bacteria 3227
101 Ga0097620_100272626 3300006931 Unclassified 1784
102 Ga0097620_100343777 3300006931 Bacteria 1586
103 Ga0075435_100068366 3300007076 Bacteria 2894
104 Ga0099794_10007794 3300007265 Bacteria 4421
105 Ga0099794_10013639 3300007265 Bacteria 3543
106 Ga0099794_10028060 3300007265 Bacteria 2615
107 Ga0099794_10030750 3300007265 Bacteria 2509
108 Ga0099794_10044840 3300007265 Bacteria 2114
109 Ga0099794_10044989 3300007265 Bacteria 2111
110 Ga0099794_10045429 3300007265 Bacteria 2102
111 Ga0099794_10101979 3300007265 Bacteria 1433
112 Ga0099794_10118107 3300007265 Bacteria 1332
113 Ga0099794_10123224 3300007265 Bacteria 1305
114 Ga0099794_10218381 3300007265 Bacteria 979
115 Ga0099795_10087303 3300007788 Bacteria 1204
116 Ga0105240_10026307 3300009093 Bacteria 7634
117 Ga0105240_10293350 3300009093 Bacteria 1863
118 Ga0111539_10001228 3300009094 Bacteria 34139
119 Ga0111539_10012487 3300009094 Bacteria 10646
120 Ga0105245_10048966 3300009098 Bacteria 3782
121 Ga0105242_10211695 3300009176 Unclassified 1728
122 Ga0105242_10358823 3300009176 Bacteria 1348
123 Ga0105248_10030869 3300009177 Bacteria 5987
124 Ga0105248_10213549 3300009177 Bacteria 2174
125 Ga0105237_10345471 3300009545 Unclassified 1492
126 Ga0105239_10263440 3300010375 Bacteria 1937
127 Ga0105239_10340290 3300010375 Bacteria 1693
128 Ga0157370_10044740 3300013104 Bacteria 4252
129 Ga0157374_10001539 3300013296 Bacteria 19431
130 Ga0157374_10009005 3300013296 Bacteria 8562
131 Ga0157374_10106610 3300013296 Bacteria 2692
132 Ga0157374_10150742 3300013296 Bacteria 2261
133 Ga0157378_10000071 3300013297 Bacteria 91313
134 Ga0157378_10005895 3300013297 Bacteria 10731
135 Ga0157378_10042523 3300013297 Bacteria 4033
136 Ga0163162_10029489 3300013306 Bacteria 5430
137 Ga0157375_10009298 3300013308 Bacteria 8626
138 Ga0157375_10019445 3300013308 Bacteria 6176
139 Ga0157375_10023692 3300013308 Bacteria 5669
140 Ga0157375_10243417 3300013308 Bacteria 1958
141 Ga0157379_10222619 3300014968 Bacteria 1710
142 Ga0157379_10436684 3300014968 Bacteria 1207
143 Ga0213874_10011973 3300021377 Bacteria 2213
144 Ga0228598_1001896 3300024227 Bacteria 4553
145 Ga0228598_1009700 3300024227 Bacteria 1925
146 Ga0228598_1009963 3300024227 Bacteria 1897
147 Ga0207647_10004847 3300025904 Bacteria 9951
148 Ga0207685_10109358 3300025905 Bacteria 1195
149 Ga0207699_10019335 3300025906 Bacteria 3630
150 Ga0207699_10079429 3300025906 Bacteria 2029
151 Ga0207699_10099299 3300025906 Unclassified 1844
152 Ga0207684_10033761 3300025910 Bacteria 4351
153 Ga0207684_10320773 3300025910 Bacteria 1335
154 Ga0207695_10068272 3300025913 Bacteria 3642
155 Ga0207695_10215382 3300025913 Bacteria 1830
156 Ga0207671_10019534 3300025914 Bacteria 5179
157 Ga0207693_10191482 3300025915 Bacteria 1609
158 Ga0207663_10215612 3300025916 Bacteria 1394
159 Ga0207663_10386527 3300025916 Bacteria 1067
160 Ga0207662_10234529 3300025918 Bacteria 1199
161 Ga0207652_10029217 3300025921 Bacteria 4607
162 Ga0207646_10000122 3300025922 Bacteria 105908
163 Ga0207646_10186496 3300025922 Bacteria 1874
164 Ga0207646_10279348 3300025922 Bacteria 1509
165 Ga0207687_10072005 3300025927 Bacteria 2471
166 Ga0207700_10012263 3300025928 Bacteria 5518
167 Ga0207700_10016688 3300025928 Bacteria 4886
168 Ga0207700_10046890 3300025928 Bacteria 3200
169 Ga0207700_10058894 3300025928 Bacteria 2903
170 Ga0207664_10043424 3300025929 Bacteria 3515
171 Ga0207644_10000059 3300025931 Bacteria 79212
172 Ga0207686_10430545 3300025934 Unclassified 1011
173 Ga0207670_10578795 3300025936 Bacteria 920
174 Ga0207669_10268974 3300025937 Bacteria 1279
175 Ga0207704_10036422 3300025938 Bacteria 2831
176 Ga0207665_10000021 3300025939 Bacteria 111867
177 Ga0207665_10016970 3300025939 Bacteria 4781
178 Ga0207665_10177440 3300025939 Bacteria 1541
179 Ga0207665_10273191 3300025939 Bacteria 1256
180 Ga0207689_10001570 3300025942 Bacteria 21642
181 Ga0207689_10076773 3300025942 Bacteria 2746
182 Ga0207651_10297524 3300025960 Bacteria 1341
183 Ga0207668_10085772 3300025972 Bacteria 2299
184 Ga0207677_10011504 3300026023 Bacteria 5051
185 Ga0207703_10015099 3300026035 Bacteria 6028
186 Ga0207703_10322623 3300026035 Bacteria 1415
187 Ga0207703_10568789 3300026035 Bacteria 1070
188 Ga0207639_10292545 3300026041 Bacteria 1437
189 Ga0207708_10003940 3300026075 Bacteria 10927
190 Ga0207641_10083703 3300026088 Bacteria 2775
191 Ga0207641_10335507 3300026088 Bacteria 1437
192 Ga0207641_10745830 3300026088 Bacteria 966
193 Ga0207648_10354558 3300026089 Bacteria 1323
194 Ga0207675_100228171 3300026118 Unclassified 1796
195 Ga0207675_100560749 3300026118 Bacteria 1142
196 Ga0207683_10001759 3300026121 Bacteria 19167
197 Ga0207683_10355305 3300026121 Bacteria 1345
198 Ga0209588_1003453 3300027671 Bacteria 4387
199 Ga0209588_1003961 3300027671 Bacteria 4142
200 Ga0209588_1007523 3300027671 Bacteria 3207
201 Ga0209588_1010459 3300027671 Bacteria 2790
202 Ga0209588_1037012 3300027671 Bacteria 1570
203 Ga0209588_1051875 3300027671 Bacteria 1326
204 Ga0209588_1083609 3300027671 Bacteria 1031
205 Ga0209588_1096665 3300027671 Bacteria 951
206 Ga0207428_10015205 3300027907 Bacteria 6660
207 Ga0265354_1000802 3300028016 Bacteria 5105
208 Ga0265356_1000561 3300028017 Bacteria 6589
209 Ga0265357_1000483 3300028023 Bacteria 2337
210 Ga0268266_10307218 3300028379 Bacteria 1481
211 Ga0268266_10340646 3300028379 Bacteria 1407
212 Ga0268265_10050197 3300028380 Bacteria 3142
213 Ga0268265_10379502 3300028380 Bacteria 1300
214 Ga0268264_10052683 3300028381 Bacteria 3393
215 Ga0268264_10159226 3300028381 Bacteria 2032
216 Ga0307517_10113355 3300028786 Bacteria 2047
217 Ga0307515_10002135 3300028794 Bacteria 43365
218 Ga0265338_10011394 3300028800 Bacteria 10278
219 Ga0265338_10011509 3300028800 Bacteria 10208
220 Ga0265338_10045501 3300028800 Unclassified 4034
221 Ga0265338_10313026 3300028800 Bacteria 1138
222 Ga0265762_1013595 3300030760 Bacteria 1466
223 Ga0265770_1003346 3300030878 Bacteria 2178
224 Ga0265760_10000111 3300031090 Bacteria 20806
225 Ga0265760_10000135 3300031090 Bacteria 18506
226 Ga0265760_10001014 3300031090 Bacteria 8139
227 Ga0265760_10005001 3300031090 Bacteria 3794
228 Ga0265760_10009231 3300031090 Bacteria 2818
229 Ga0265760_10030888 3300031090 Bacteria 1579
230 Ga0265760_10033811 3300031090 Bacteria 1511
231 Ga0265325_10005747 3300031241 Bacteria 7621
232 Ga0265325_10092764 3300031241 Bacteria 1486
233 Ga0265339_10115336 3300031249 Bacteria 1386
234 Ga0265331_10006530 3300031250 Bacteria 6881
235 Ga0265316_10032516 3300031344 Unclassified 4257
236 Ga0265316_10060441 3300031344 Bacteria 2945
237 Ga0307513_10004506 3300031456 Bacteria 18579
238 Ga0307509_10000175 3300031507 Bacteria 100922
239 Ga0265314_10018214 3300031711 Bacteria 5482
240 Ga0316576_10003310 3300031727 Bacteria 9407
241 Ga0316576_10098195 3300031727 Bacteria 2187
242 Ga0307516_10029076 3300031730 Bacteria 5589
243 Ga0307516_10105320 3300031730 Bacteria 2632
244 Ga0307406_10002187 3300031901 Bacteria 10639
245 Ga0316212_1003494 3300033547 Bacteria 2271
246 Ga0373934_0009971 3300035086 Bacteria 3564
247 Ga0373923_0055527 3300035111 Unclassified 1670
248 Ga0373954_0014015 3300035118 Bacteria 3574
249 Ga0373954_0031347 3300035118 Unclassified 2454
250 Ga0373954_0119196 3300035118 Unclassified 1280
251 Ga0373956_0016605 3300035119 Unclassified 3093
252 Ga0373957_0034935 3300035120 Unclassified 1865
253 Ga0373955_0000867 3300035172 Bacteria 12957
254 Ga0373955_0005350 3300035172 Bacteria 5765
255 Ga0373955_0165282 3300035172 Bacteria 1308
256 Ga0373961_0000182 3300035241 Bacteria 30239
257 Ga0373924_0023915 3300035410 Unclassified 2403
258 Ga0373935_0055057 3300035692 Unclassified 2534
259 Ga0373927_0125252 3300035695 Bacteria 1677
260 Ga0373927_0332657 3300035695 Unclassified 1000
261 Ga0373933_0000036 3300035724 Bacteria 81168
262 Ga0373933_0119763 3300035724 Unclassified 1648
263 Ga0373947_0026606 3300035725 Unclassified 3383
264 Ga0373937_0000001 3300036401 Bacteria 478903
265 Ga0373937_0008995 3300036401 Bacteria 8672
266 Ga0373937_0011795 3300036401 Bacteria 7670
267 Ga0373937_0135499 3300036401 Unclassified 2302
268 Ga0373937_0301858 3300036401 Unclassified 1513
269 Ga0316584_0001563 3300036712 Bacteria 13869
270 Ga0373925_0016089 3300037068 Bacteria 5417
271 Ga0373925_0274099 3300037068 Bacteria 1358
272 Ga0395899_0096437 3300037312 Bacteria 2138
273 Ga0395900_0201313 3300037418 Bacteria 2014
274 Ga0395901_0085081 3300038443 Bacteria 3306
275 Ga0395901_0491423 3300038443 Bacteria 1250
276 Ga0436365_0044124 3300039437 Bacteria 1167
277 Ga0436360_1126341 3300039438 Bacteria 7339
278 Ga0436361_0167638 3300039447 Bacteria 6206
279 Ga0436363_0195567 3300039450 Bacteria 3951
280 Ga0436363_1055340 3300039450 Unclassified 1868
281 Ga0451793_1832275 3300041452 Bacteria 1367
282 Ga0451577_0039791 3300042876 Bacteria 4223
283 Ga0451577_0180515 3300042876 Bacteria 1903
284 Ga0451577_0425675 3300042876 Bacteria 1205
285 Ga0453683_0001860 3300044673 Bacteria 17302
286 Ga0453683_0032271 3300044673 Bacteria 3305
287 Ga0453683_0092355 3300044673 Bacteria 1897
288 Ga0453684_0004368 3300044712 Bacteria 29984
289 Ga0453684_0125766 3300044712 Bacteria 3086
290 Ga0453684_0427420 3300044712 Bacteria 1478
291 Ga0451576_0049459 3300045051 Bacteria 4411
292 Ga0495651_0000153 3300046462 Bacteria 50701
293 Ga0495651_0001957 3300046462 Bacteria 15925
294 Ga0495651_0002571 3300046462 Bacteria 14032
295 Ga0495651_0024402 3300046462 Bacteria 4704
296 Ga0495651_0137132 3300046462 Unclassified 1778
297 Ga0495651_0160857 3300046462 Bacteria 1609
298 Ga0495653_0001135 3300046463 Bacteria 20499
299 Ga0495653_0038860 3300046463 Unclassified 3733
300 Ga0495653_0054824 3300046463 Bacteria 3045
301 Ga0495653_0141539 3300046463 Bacteria 1691
302 Ga0495580_0113642 3300046472 Bacteria 1881
303 Ga0495580_0186661 3300046472 Unclassified 1431
304 Ga0495580_0242258 3300046472 Unclassified 1236
305 Ga0495580_0348094 3300046472 Bacteria 1004
306 Ga0495582_0215308 3300046473 Unclassified 1099
307 Ga0495582_0253236 3300046473 Unclassified 1010
308 Ga0495664_0004634 3300046477 Bacteria 7521
309 Ga0495594_0255154 3300046499 Bacteria 999
310 Ga0495608_0013256 3300046511 Bacteria 5719
311 Ga0495608_0099324 3300046511 Unclassified 1877
312 Ga0495618_0080451 3300046514 Bacteria 2079
313 Ga0495628_0001293 3300046516 Bacteria 22948
314 Ga0495628_0045164 3300046516 Bacteria 3504
315 Ga0495630_0006476 3300046517 Bacteria 8334
316 Ga0495630_0025713 3300046517 Bacteria 4354
317 Ga0495630_0064398 3300046517 Unclassified 2754
318 Ga0495652_0010313 3300046529 Bacteria 8466
319 Ga0495652_0063325 3300046529 Unclassified 3114
320 Ga0495652_0108576 3300046529 Unclassified 2236
321 Ga0495665_0006670 3300046531 Bacteria 6227
322 Ga0495640_0076214 3300046533 Bacteria 2238
323 Ga0495586_0033936 3300046535 Unclassified 2739
324 Ga0495587_0000253 3300046536 Bacteria 38702
325 Ga0495587_0002064 3300046536 Bacteria 13412
326 Ga0495587_0002767 3300046536 Bacteria 11706
327 Ga0495587_0047730 3300046536 Unclassified 2538
328 Ga0495587_0062172 3300046536 Bacteria 2187
329 Ga0495645_0021363 3300046543 Unclassified 4679
330 Ga0495667_0145727 3300046559 Unclassified 1525
331 Ga0495667_0208733 3300046559 Unclassified 1248
332 Ga0495634_0009665 3300046642 Bacteria 7100
333 Ga0495657_0001294 3300046675 Bacteria 21754
334 Ga0495599_0044427 3300046678 Unclassified 2786
335 Ga0495623_0011818 3300046679 Bacteria 5656
336 Ga0495623_0021182 3300046679 Bacteria 4200
337 Ga0495623_0021524 3300046679 Unclassified 4164
338 Ga0495646_0005774 3300046680 Bacteria 7849
339 Ga0495624_0008693 3300046690 Bacteria 7070
340 Ga0495624_0067663 3300046690 Unclassified 2228
341 Ga0495604_0002582 3300047317 Bacteria 14508
342 Ga0495604_0015768 3300047317 Bacteria 6030
343 Ga0495604_0047668 3300047317 Bacteria 3337
344 Ga0495604_0056412 3300047317 Bacteria 3024
345 Ga0495604_0123507 3300047317 Unclassified 1870
346 Ga0495674_0017618 3300047319 Bacteria 6650
347 Ga0495674_0127885 3300047319 Bacteria 2142
348 Ga0495674_0373773 3300047319 Bacteria 1154
349 Ga0495676_0090392 3300047321 Unclassified 2292
350 Ga0495680_0000715 3300047322 Bacteria 37324
351 Ga0495680_0009166 3300047322 Bacteria 8929
352 Ga0495680_0017484 3300047322 Bacteria 6121
353 Ga0495680_0200406 3300047322 Bacteria 1432
354 Ga0495675_0000572 3300047444 Bacteria 23725
355 Ga0495675_0000841 3300047444 Bacteria 18768
356 Ga0495675_0007673 3300047444 Bacteria 6655
357 Ga0495675_0099289 3300047444 Bacteria 1823
358 Ga0495684_0003445 3300047471 Bacteria 12387
359 Ga0495684_0027675 3300047471 Unclassified 4354
360 Ga0495684_0044805 3300047471 Unclassified 3386
361 Ga0495686_0011189 3300047472 Bacteria 6331
362 Ga0495593_0027033 3300047673 Unclassified 3162
363 Ga0495602_0000448 3300048088 Bacteria 38588
364 Ga0495602_0013139 3300048088 Bacteria 8471
365 Ga0495602_0066191 3300048088 Bacteria 3115
366 Ga0495602_0094587 3300048088 Unclassified 2469
367 Ga0495602_0106771 3300048088 Unclassified 2284
368 Ga0495602_0204607 3300048088 Unclassified 1503
369 Ga0496102_0013553 3300048905 Bacteria 7065
370 Ga0496102_0544603 3300048905 Unclassified 1083
371 Ga0496103_0119238 3300048906 Bacteria 1680
372 Ga0496104_0107373 3300048907 Bacteria 2675
373 Ga0496105_0166319 3300048908 Bacteria 1809
374 Ga0496112_0037985 3300048915 Bacteria 4701
375 Ga0496112_0139145 3300048915 Bacteria 2397
376 Ga0496112_0318412 3300048915 Bacteria 1500
377 Ga0496115_0295969 3300048918 Bacteria 1327
378 Ga0496115_0359844 3300048918 Unclassified 1186
379 Ga0501047_0038178 3300049581 Bacteria 4645
380 Ga0501227_005479 3300049665 Bacteria 2716
381 Ga0501080_0309838 3300049742 Bacteria 1431
382 Ga0501044_0195107 3300049823 Bacteria 1985
383 nmdc:mga09592_30448_c1 3300050508 Bacteria 4490
384 nmdc:mga08y16_462865_c1 3300050511 Bacteria 1292
385 nmdc:mga08y16_58264_c1 3300050511 Bacteria 4036
386 nmdc:mga08y16_9400_c1 3300050511 Bacteria 10253
387 nmdc:mga0n895_11720_c1 3300050512 Bacteria 7836
388 nmdc:mga0n895_145188_c1 3300050512 Bacteria 2402
389 nmdc:mga0n895_7286_c1 3300050512 Bacteria 9479
390 nmdc:mga0rr50_166598_c1 3300050513 Bacteria 1792
391 nmdc:mga0rr50_222583_c1 3300050513 Bacteria 1559
392 nmdc:mga0rr50_39565_c1 3300050513 Bacteria 3421
393 nmdc:mga0rr50_46870_c2 3300050513 Bacteria 1413
394 nmdc:mga08x19_1083_c1 3300050514 Bacteria 16976
395 nmdc:mga08x19_138602_c1 3300050514 Bacteria 1642
396 nmdc:mga08x19_153452_c1 3300050514 Bacteria 1561
397 nmdc:mga08x19_9834_c1 3300050514 Bacteria 5731
398 nmdc:mga0a205_348643_c1 3300050515 Bacteria 1348
399 Ga0495601_0044266 3300053077 Bacteria 2798
400 Ga0495612_0091989 3300053078 Bacteria 1285
401 Ga0500635_0005775 3300053080 Bacteria 3270
402 Ga0495619_0023584 3300053085 Bacteria 3946
403 Ga0495619_0067457 3300053085 Unclassified 2389
404 Ga0500566_0005172 3300053094 Bacteria 7771
405 Ga0500597_078239 3300053120 Bacteria 1434
406 Ga0500568_0017965 3300053139 Bacteria 3109
407 Ga0500585_041116 3300053144 Bacteria 1631
408 Ga0500603_001780 3300053150 Bacteria 4844
409 Ga0500578_0158331
410 Ga0068869_100002966
411 Ga0068868_100038815
412 Ga0070689_100653578
413 Ga0070671_100000257
414 Ga0070688_100089308
415 Ga0070709_10013034
416 Ga0070709_10037382
417 Ga0070709_10183725
418 Ga0070714_100030917
419 Ga0070714_100034937
420 Ga0070714_100325947
421 Ga0070714_100463448
422 Ga0070713_100005744
423 Ga0070713_100007699
424 Ga0070713_100022953
425 Ga0070713_100139253
426 Ga0070710_10077032
427 Ga0070710_10381326
428 Ga0070711_100063346
429 Ga0070711_100228195
430 Ga0070711_100308966
431 Ga0070705_100001969
432 Ga0070700_100386067
433 Ga0070694_100004181
434 Ga0070694_100036203
435 Ga0070708_100001956
436 Ga0070708_100103617
437 Ga0070708_100284352
438 Ga0070708_100498503
439 Ga0070708_100748952
440 Ga0070678_100000592
441 Ga0068867_100353270
442 Ga0068867_100586423
443 Ga0070706_100004767
444 Ga0070706_100036651
445 Ga0070707_100004132
446 Ga0070707_100092349
447 Ga0070707_100129094
448 Ga0070707_100250955
449 Ga0070698_100000286
450 Ga0070698_100009114
451 Ga0070698_100093991
452 Ga0070699_100022029
453 Ga0070699_100179175
454 Ga0070679_100004782
455 Ga0070679_100315872
456 Ga0070697_100002229
457 Ga0070697_100047753
458 Ga0070697_100097516
459 Ga0070697_100107270
460 Ga0070697_100178643
461 Ga0068853_100222891
462 Ga0070686_100257951
463 Ga0070695_100002277
464 Ga0070695_100187985
465 Ga0070696_100000725
466 Ga0070696_100105306
467 Ga0070693_100000383
468 Ga0070665_100110820
469 Ga0070665_100654821
470 Ga0070704_100000356
471 Ga0070704_100045823
472 Ga0070704_100183394
473 Ga0068855_100129828
474 Ga0068859_100084053
475 Ga0068859_100272634
476 Ga0068859_100343757
477 Ga0068864_100063028
478 Ga0068864_100184182
479 Ga0068861_100222495
480 Ga0068863_100059206
481 Ga0068863_100195630
482 Ga0068863_100280922
483 Ga0068863_100819399
484 Ga0068858_100006201
485 Ga0068860_100009764
486 Ga0068862_100069114
487 Ga0070717_10002171
488 Ga0070717_10016657
489 Ga0070717_10040544
490 Ga0070717_10064408
491 Ga0070717_10067995
492 Ga0070717_10071324
493 Ga0070715_10033998
494 Ga0070716_100000173
495 Ga0070716_100216525
496 Ga0070716_100277909
497 Ga0070712_100046158
498 Ga0070712_100150689
499 Ga0070712_100477153
500 Ga0097621_100345524
501 Ga0068871_100271643
502 Ga0075433_10390672
503 Ga0075434_100150300
504 Ga0075429_100045499
505 Ga0068865_100007610
506 Ga0075436_100003687
507 Ga0075436_100005800
508 Ga0097620_100084053
509 Ga0097620_100272626
510 Ga0097620_100343777
511 Ga0075435_100068366
512 Ga0099794_10007794
513 Ga0099794_10013639
514 Ga0099794_10028060
515 Ga0099794_10030750
516 Ga0099794_10044840
517 Ga0099794_10044989
518 Ga0099794_10045429
519 Ga0099794_10101979
520 Ga0099794_10118107
521 Ga0099794_10123224
522 Ga0099794_10218381
523 Ga0099795_10087303
524 Ga0105240_10026307
525 Ga0105240_10293350
526 Ga0111539_10001228
527 Ga0111539_10012487
528 Ga0105245_10048966
529 Ga0105242_10211695
530 Ga0105242_10358823
531 Ga0105248_10030869
532 Ga0105248_10213549
533 Ga0105237_10345471
534 Ga0105239_10263440
535 Ga0105239_10340290
536 Ga0157370_10044740
537 Ga0157374_10001539
538 Ga0157374_10009005
539 Ga0157374_10106610
540 Ga0157374_10150742
541 Ga0157378_10000071
542 Ga0157378_10005895
543 Ga0157378_10042523
544 Ga0163162_10029489
545 Ga0157375_10009298
546 Ga0157375_10019445
547 Ga0157375_10023692
548 Ga0157375_10243417
549 Ga0157379_10222619
550 Ga0157379_10436684
551 Ga0213874_10011973
552 Ga0228598_1001896
553 Ga0228598_1009700
554 Ga0228598_1009963
555 Ga0207647_10004847
556 Ga0207685_10109358
557 Ga0207699_10019335
558 Ga0207699_10079429
559 Ga0207699_10099299
560 Ga0207684_10033761
561 Ga0207684_10320773
562 Ga0207695_10068272
563 Ga0207695_10215382
564 Ga0207671_10019534
565 Ga0207693_10191482
566 Ga0207663_10215612
567 Ga0207663_10386527
568 Ga0207662_10234529
569 Ga0207652_10029217
570 Ga0207646_10000122
571 Ga0207646_10186496
572 Ga0207646_10279348
573 Ga0207687_10072005
574 Ga0207700_10012263
575 Ga0207700_10016688
576 Ga0207700_10046890
577 Ga0207700_10058894
578 Ga0207664_10043424
579 Ga0207644_10000059
580 Ga0207686_10430545
581 Ga0207670_10578795
582 Ga0207669_10268974
583 Ga0207704_10036422
584 Ga0207665_10000021
585 Ga0207665_10016970
586 Ga0207665_10177440
587 Ga0207665_10273191
588 Ga0207689_10001570
589 Ga0207689_10076773
590 Ga0207651_10297524
591 Ga0207668_10085772
592 Ga0207677_10011504
593 Ga0207703_10015099
594 Ga0207703_10322623
595 Ga0207703_10568789
596 Ga0207639_10292545
597 Ga0207708_10003940
598 Ga0207641_10083703
599 Ga0207641_10335507
600 Ga0207641_10745830
601 Ga0207648_10354558
602 Ga0207675_100228171
603 Ga0207675_100560749
604 Ga0207683_10001759
605 Ga0207683_10355305
606 Ga0209588_1003453
607 Ga0209588_1003961
608 Ga0209588_1007523
609 Ga0209588_1010459
610 Ga0209588_1037012
611 Ga0209588_1051875
612 Ga0209588_1083609
613 Ga0209588_1096665
614 Ga0207428_10015205
615 Ga0265354_1000802
616 Ga0265356_1000561
617 Ga0265357_1000483
618 Ga0268266_10307218
619 Ga0268266_10340646
620 Ga0268265_10050197
621 Ga0268265_10379502
622 Ga0268264_10052683
623 Ga0268264_10159226
624 Ga0307517_10113355
625 Ga0307515_10002135
626 Ga0265338_10011394
627 Ga0265338_10011509
628 Ga0265338_10045501
629 Ga0265338_10313026
630 Ga0265762_1013595
631 Ga0265770_1003346
632 Ga0265760_10000111
633 Ga0265760_10000135
634 Ga0265760_10001014
635 Ga0265760_10005001
636 Ga0265760_10009231
637 Ga0265760_10030888
638 Ga0265760_10033811
639 Ga0265325_10005747
640 Ga0265325_10092764
641 Ga0265339_10115336
642 Ga0265331_10006530
643 Ga0265316_10032516
644 Ga0265316_10060441
645 Ga0307513_10004506
646 Ga0307509_10000175
647 Ga0265314_10018214
648 Ga0316576_10003310
649 Ga0316576_10098195
650 Ga0307516_10029076
651 Ga0307516_10105320
652 Ga0307406_10002187
653 Ga0316212_1003494
654 Ga0373934_0009971
655 Ga0373923_0055527
656 Ga0373954_0014015
657 Ga0373954_0031347
658 Ga0373954_0119196
659 Ga0373956_0016605
660 Ga0373957_0034935
661 Ga0373955_0000867
662 Ga0373955_0005350
663 Ga0373955_0165282
664 Ga0373961_0000182
665 Ga0373924_0023915
666 Ga0373935_0055057
667 Ga0373927_0125252
668 Ga0373927_0332657
669 Ga0373933_0000036
670 Ga0373933_0119763
671 Ga0373947_0026606
672 Ga0373937_0000001
673 Ga0373937_0008995
674 Ga0373937_0011795
675 Ga0373937_0135499
676 Ga0373937_0301858
677 Ga0316584_0001563
678 Ga0373925_0016089
679 Ga0373925_0274099
680 Ga0395899_0096437
681 Ga0395900_0201313
682 Ga0395901_0085081
683 Ga0395901_0491423
684 Ga0436365_0044124
685 Ga0436360_1126341
686 Ga0436361_0167638
687 Ga0436363_0195567
688 Ga0436363_1055340
689 Ga0451793_1832275
690 Ga0451577_0039791
691 Ga0451577_0180515
692 Ga0451577_0425675
693 Ga0453683_0001860
694 Ga0453683_0032271
695 Ga0453683_0092355
696 Ga0453684_0004368
697 Ga0453684_0125766
698 Ga0453684_0427420
699 Ga0451576_0049459
700 Ga0495651_0000153
701 Ga0495651_0001957
702 Ga0495651_0002571
703 Ga0495651_0024402
704 Ga0495651_0137132
705 Ga0495651_0160857
706 Ga0495653_0001135
707 Ga0495653_0038860
708 Ga0495653_0054824
709 Ga0495653_0141539
710 Ga0495580_0113642
711 Ga0495580_0186661
712 Ga0495580_0242258
713 Ga0495580_0348094
714 Ga0495582_0215308
715 Ga0495582_0253236
716 Ga0495664_0004634
717 Ga0495594_0255154
718 Ga0495608_0013256
719 Ga0495608_0099324
720 Ga0495618_0080451
721 Ga0495628_0001293
722 Ga0495628_0045164
723 Ga0495630_0006476
724 Ga0495630_0025713
725 Ga0495630_0064398
726 Ga0495652_0010313
727 Ga0495652_0063325
728 Ga0495652_0108576
729 Ga0495665_0006670
730 Ga0495640_0076214
731 Ga0495586_0033936
732 Ga0495587_0000253
733 Ga0495587_0002064
734 Ga0495587_0002767
735 Ga0495587_0047730
736 Ga0495587_0062172
737 Ga0495645_0021363
738 Ga0495667_0145727
739 Ga0495667_0208733
740 Ga0495634_0009665
741 Ga0495657_0001294
742 Ga0495599_0044427
743 Ga0495623_0011818
744 Ga0495623_0021182
745 Ga0495623_0021524
746 Ga0495646_0005774
747 Ga0495624_0008693
748 Ga0495624_0067663
749 Ga0495604_0002582
750 Ga0495604_0015768
751 Ga0495604_0047668
752 Ga0495604_0056412
753 Ga0495604_0123507
754 Ga0495674_0017618
755 Ga0495674_0127885
756 Ga0495674_0373773
757 Ga0495676_0090392
758 Ga0495680_0000715
759 Ga0495680_0009166
760 Ga0495680_0017484
761 Ga0495680_0200406
762 Ga0495675_0000572
763 Ga0495675_0000841
764 Ga0495675_0007673
765 Ga0495675_0099289
766 Ga0495684_0003445
767 Ga0495684_0027675
768 Ga0495684_0044805
769 Ga0495686_0011189
770 Ga0495593_0027033
771 Ga0495602_0000448
772 Ga0495602_0013139
773 Ga0495602_0066191
774 Ga0495602_0094587
775 Ga0495602_0106771
776 Ga0495602_0204607
777 Ga0496102_0013553
778 Ga0496102_0544603
779 Ga0496103_0119238
780 Ga0496104_0107373
781 Ga0496105_0166319
782 Ga0496112_0037985
783 Ga0496112_0139145
784 Ga0496112_0318412
785 Ga0496115_0295969
786 Ga0496115_0359844
787 Ga0501047_0038178
788 Ga0501227_005479
789 Ga0501080_0309838
790 Ga0501044_0195107
791 nmdc:mga09592_30448_c1
792 nmdc:mga08y16_462865_c1
793 nmdc:mga08y16_58264_c1
794 nmdc:mga08y16_9400_c1
795 nmdc:mga0n895_11720_c1
796 nmdc:mga0n895_145188_c1
797 nmdc:mga0n895_7286_c1
798 nmdc:mga0rr50_166598_c1
799 nmdc:mga0rr50_222583_c1
800 nmdc:mga0rr50_39565_c1
801 nmdc:mga0rr50_46870_c2
802 nmdc:mga08x19_1083_c1
803 nmdc:mga08x19_138602_c1
804 nmdc:mga08x19_153452_c1
805 nmdc:mga08x19_9834_c1
806 nmdc:mga0a205_348643_c1
807 Ga0495601_0044266
808 Ga0495612_0091989
809 Ga0500635_0005775
810 Ga0495619_0023584
811 Ga0495619_0067457
812 Ga0500566_0005172
813 Ga0500597_078239
814 Ga0500568_0017965
815 Ga0500585_041116
816 Ga0500603_001780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

65

214

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9794 1 239
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9761 1 239
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9751 1 239
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9656 1 239
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9539 4 227
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9885 4 239 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9846 1 244 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 1 244 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9603 1 218 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 2 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C0VK17-F1-model_v4 ABC transporter ATP-binding protein 0.9858 1 243 GO:0005524
GO:0016887
AF-A0A847F754-F1-model_v4 ATP-binding cassette domain-containing protein 0.9837 118 243 GO:0005524
GO:0016887
AF-A0A2E7BRA8-F1-model_v4 ABC transporter ATP-binding protein 0.9813 4 241 GO:0005524
GO:0016887
AF-A0A4Q3QM40-F1-model_v4 deleted 0.975 1 200
AF-A0A7X7JNE1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9732 24 241 GO:0005524
GO:0016887

Map