F436780

General Info

Members Datasets Scaffolds Average Seq Length
408 277 380 148

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0298875|Ga0436360_0298875_1395_1835
Length 146
Sequence MMRTVVIAGAFLLAAGAVMAQQDQVKATQAMMKGNGKNAGALAAMIKGEKPYDQATVDAALKQFADTAKKLPTLFPESIKGKTFDGDYQPTDKIWTDKAGFDEHIASFAKTVSEAKITDLDTLKATLPVIGKQCGGCHETFRVKKS

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
6 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
7 2791355199
8 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
9 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
10 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
11 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
12 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
13 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
14 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
15 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
16 2904699407
17 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
18 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
19 2922425934
20 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
21 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
22 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
23 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
24 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
25 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
185 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
256 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
260 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
261 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
264 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
265 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
268 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
269 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
273 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
276 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
277 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.6
Metatranscriptomes 2.22
Isolates 6.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.05
Nodule 4.41
Rhizoplane 6.86
Rhizosphere 71.08
Stem 0
Stem Tuber 0
Unclassified 7.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000519 3300003215 Bacteria 24283
2 Ga0006770J48903_1099431 3300003305 Bacteria 537
3 rootH1_10245263 3300003323 Bacteria 1829
4 Ga0007429J51699_1134367 3300003579 Bacteria 539
5 Ga0058859_11025294 3300004798 Bacteria 613
6 Ga0070666_10607810 3300005335 Bacteria 798
7 Ga0070680_100228789 3300005336 Bacteria 1570
8 Ga0070682_100127870 3300005337 Bacteria 1715
9 Ga0070682_100566001 3300005337 Bacteria 892
10 Ga0070660_100506404 3300005339 Bacteria 1005
11 Ga0070668_100198481 3300005347 Bacteria 1646
12 Ga0070668_100962052 3300005347 Bacteria 766
13 Ga0070669_100109394 3300005353 Bacteria 2095
14 Ga0070674_100347337 3300005356 Bacteria 1197
15 Ga0070673_101111514 3300005364 Bacteria 738
16 Ga0070659_100587127 3300005366 Bacteria 956
17 Ga0070659_101342085 3300005366 Bacteria 635
18 Ga0070667_101205082 3300005367 Bacteria 709
19 Ga0070667_101258106 3300005367 Bacteria 693
20 Ga0070709_10006323 3300005434 Bacteria 6448
21 Ga0070709_10039316 3300005434 Bacteria 2902
22 Ga0070714_100915174 3300005435 Bacteria 852
23 Ga0070713_100353607 3300005436 Bacteria 1363
24 Ga0070710_10335939 3300005437 Bacteria 996
25 Ga0070701_11308970 3300005438 Bacteria 518
26 Ga0070711_100005518 3300005439 Bacteria 7572
27 Ga0070711_100078247 3300005439 Bacteria 2349
28 Ga0070711_100905821 3300005439 Bacteria 753
29 Ga0070705_100800833 3300005440 Bacteria 750
30 Ga0070700_100120448 3300005441 Bacteria 1757
31 Ga0070663_100226745 3300005455 Bacteria 1469
32 Ga0070663_100554335 3300005455 Bacteria 961
33 Ga0070678_100008003 3300005456 Bacteria 6301
34 Ga0070662_100258020 3300005457 Bacteria 1403
35 Ga0070662_100377305 3300005457 Bacteria 1167
36 Ga0070681_10144607 3300005458 Bacteria 2307
37 Ga0070685_10573314 3300005466 Bacteria 809
38 Ga0070684_101137764 3300005535 Bacteria 734
39 Ga0068853_100835602 3300005539 Bacteria 883
40 Ga0070693_100018932 3300005547 Bacteria 3603
41 Ga0070693_100379533 3300005547 Bacteria 975
42 Ga0070693_100843595 3300005547 Bacteria 682
43 Ga0070665_100059377 3300005548 Bacteria 3834
44 Ga0070665_100337097 3300005548 Bacteria 1512
45 Ga0068855_101723657 3300005563 Bacteria 638
46 Ga0070664_100270043 3300005564 Bacteria 1532
47 Ga0068857_100038961 3300005577 Bacteria 4208
48 Ga0068857_101683227 3300005577 Bacteria 620
49 Ga0068856_100134332 3300005614 Bacteria 2479
50 Ga0068856_101562480 3300005614 Bacteria 673
51 Ga0070702_100518977 3300005615 Bacteria 878
52 Ga0068852_100117115 3300005616 Bacteria 2432
53 Ga0068859_100574097 3300005617 Bacteria 1221
54 Ga0068859_101309249 3300005617 Bacteria 798
55 Ga0068864_100146011 3300005618 Bacteria 2138
56 Ga0068864_100174493 3300005618 Bacteria 1961
57 Ga0068866_10378679 3300005718 Bacteria 907
58 Ga0068861_100174173 3300005719 Bacteria 1786
59 Ga0068851_10256359 3300005834 Bacteria 994
60 Ga0068870_10246962 3300005840 Bacteria 1105
61 Ga0068863_100085104 3300005841 Bacteria 2996
62 Ga0068863_101205762 3300005841 Bacteria 763
63 Ga0068858_100594174 3300005842 Bacteria 1073
64 Ga0068858_100633874 3300005842 Bacteria 1038
65 Ga0068858_101388424 3300005842 Bacteria 692
66 Ga0068860_100000724 3300005843 Bacteria 37558
67 Ga0068860_100231006 3300005843 Bacteria 1798
68 Ga0068862_100175029 3300005844 Bacteria 1923
69 Ga0068862_100966186 3300005844 Bacteria 841
70 Ga0081455_10056820 3300005937 Bacteria 3320
71 Ga0081455_10211221 3300005937 Bacteria 1446
72 Ga0081540_1004839 3300005983 Bacteria 10148
73 Ga0081540_1028522 3300005983 Bacteria 3133
74 Ga0081540_1217022 3300005983 Bacteria 683
75 Ga0070717_10862789 3300006028 Bacteria 824
76 Ga0075365_10129498 3300006038 Bacteria 1746
77 Ga0075368_10020457 3300006042 Bacteria 2507
78 Ga0075364_10095103 3300006051 Bacteria 1980
79 Ga0070716_100024139 3300006173 Bacteria 3234
80 Ga0070716_100342012 3300006173 Bacteria 1056
81 Ga0070716_100700053 3300006173 Bacteria 774
82 Ga0070712_100010182 3300006175 Bacteria 5924
83 Ga0070712_100058692 3300006175 Bacteria 2708
84 Ga0070712_100229220 3300006175 Bacteria 1474
85 Ga0075367_10043975 3300006178 Bacteria 2616
86 Ga0075369_10032489 3300006186 Bacteria 2208
87 Ga0075366_10292128 3300006195 Bacteria 997
88 Ga0075366_10307297 3300006195 Bacteria 970
89 Ga0097621_100148553 3300006237 Bacteria 2008
90 Ga0097621_102229800 3300006237 Bacteria 524
91 Ga0075370_10115902 3300006353 Bacteria 1557
92 Ga0075370_10268335 3300006353 Bacteria 1013
93 Ga0075433_10626292 3300006852 Bacteria 944
94 Ga0075434_100082783 3300006871 Bacteria 3206
95 Ga0075434_101140744 3300006871 Bacteria 792
96 Ga0075429_100436947 3300006880 Bacteria 1147
97 Ga0068865_100175876 3300006881 Bacteria 1645
98 Ga0068865_100336634 3300006881 Bacteria 1218
99 Ga0068865_100376669 3300006881 Bacteria 1157
100 Ga0097620_100574101 3300006931 Bacteria 1221
101 Ga0097620_100947405 3300006931 Bacteria 944
102 Ga0097620_101309246 3300006931 Bacteria 798
103 Ga0099824_1012951 3300006942 Bacteria 8862
104 Ga0075435_100844993 3300007076 Bacteria 798
105 Ga0099794_10199631 3300007265 Bacteria 1024
106 Ga0099795_10048255 3300007788 Bacteria 1541
107 Ga0105250_10097904 3300009092 Bacteria 1196
108 Ga0105240_10228842 3300009093 Bacteria 2162
109 Ga0111539_10230180 3300009094 Bacteria 2158
110 Ga0111539_11876009 3300009094 Bacteria 695
111 Ga0105245_10227708 3300009098 Bacteria 1802
112 Ga0105245_11446719 3300009098 Bacteria 738
113 Ga0105247_10349652 3300009101 Bacteria 1039
114 Ga0105243_11138876 3300009148 Bacteria 790
115 Ga0105243_11563500 3300009148 Bacteria 685
116 Ga0105241_10050216 3300009174 Bacteria 3179
117 Ga0105241_10051534 3300009174 Bacteria 3139
118 Ga0105241_10632798 3300009174 Bacteria 970
119 Ga0105241_11058338 3300009174 Bacteria 762
120 Ga0105242_10104392 3300009176 Bacteria 2406
121 Ga0105248_10177941 3300009177 Bacteria 2397
122 Ga0105248_11150174 3300009177 Bacteria 877
123 Ga0105237_10128850 3300009545 Bacteria 2525
124 Ga0105237_10149756 3300009545 Bacteria 2330
125 Ga0105237_10377060 3300009545 Bacteria 1423
126 Ga0105238_10292781 3300009551 Bacteria 1610
127 Ga0105238_11134714 3300009551 Bacteria 805
128 Ga0105249_10215871 3300009553 Bacteria 1885
129 Ga0105249_10330460 3300009553 Bacteria 1538
130 Ga0105239_10160891 3300010375 Bacteria 2508
131 Ga0105239_10192736 3300010375 Bacteria 2281
132 Ga0105239_10393942 3300010375 Bacteria 1567
133 Ga0105239_10682804 3300010375 Bacteria 1174
134 Ga0105246_10110230 3300011119 Bacteria 2021
135 Ga0105246_10110878 3300011119 Bacteria 2015
136 Ga0157371_10277720 3300013102 Bacteria 1210
137 Ga0157369_11153949 3300013105 Bacteria 791
138 Ga0157369_11657907 3300013105 Bacteria 650
139 Ga0157374_10043794 3300013296 Bacteria 4136
140 Ga0157378_10102389 3300013297 Bacteria 2616
141 Ga0157378_11818702 3300013297 Bacteria 657
142 Ga0163162_10215912 3300013306 Bacteria 2048
143 Ga0163162_10247567 3300013306 Bacteria 1914
144 Ga0163162_11646900 3300013306 Bacteria 732
145 Ga0157372_11198671 3300013307 Bacteria 877
146 Ga0157372_11478875 3300013307 Bacteria 783
147 Ga0157375_10591722 3300013308 Bacteria 1269
148 Ga0157375_11042442 3300013308 Bacteria 956
149 Ga0163163_10189477 3300014325 Bacteria 2105
150 Ga0163163_10288943 3300014325 Bacteria 1692
151 Ga0157380_10164370 3300014326 Bacteria 1932
152 Ga0157380_10346650 3300014326 Bacteria 1388
153 Ga0157380_11297463 3300014326 Bacteria 775
154 Ga0157377_10106874 3300014745 Bacteria 1677
155 Ga0157379_10106401 3300014968 Bacteria 2518
156 Ga0157379_10448244 3300014968 Bacteria 1191
157 Ga0157376_10298457 3300014969 Bacteria 1524
158 Ga0157376_10594117 3300014969 Bacteria 1101
159 Ga0157376_10856996 3300014969 Bacteria 924
160 Ga0157376_12411316 3300014969 Bacteria 566
161 Ga0163161_10303413 3300017792 Bacteria 1258
162 Ga0197907_11359267 3300020069 Bacteria 595
163 Ga0206356_10807111 3300020070 Bacteria 503
164 Ga0206352_11041977 3300020078 Bacteria 508
165 Ga0206354_11555323 3300020081 Bacteria 575
166 Ga0206353_10440187 3300020082 Bacteria 638
167 Ga0213874_10103659 3300021377 Bacteria 949
168 Ga0213876_10189044 3300021384 Bacteria 1095
169 Ga0213871_10058696 3300021441 Bacteria 1068
170 Ga0209758_1003548 3300025297 Bacteria 14034
171 Ga0207656_10076492 3300025321 Bacteria 1497
172 Ga0207682_10061116 3300025893 Bacteria 1577
173 Ga0207692_10388010 3300025898 Bacteria 868
174 Ga0207642_10318098 3300025899 Bacteria 908
175 Ga0207710_10141973 3300025900 Bacteria 1160
176 Ga0207688_10043030 3300025901 Bacteria 2514
177 Ga0207688_10073196 3300025901 Bacteria 1947
178 Ga0207688_10540177 3300025901 Bacteria 732
179 Ga0207680_10381882 3300025903 Bacteria 993
180 Ga0207680_10923888 3300025903 Bacteria 625
181 Ga0207647_10152001 3300025904 Bacteria 1353
182 Ga0207685_10196054 3300025905 Bacteria 946
183 Ga0207699_10032126 3300025906 Bacteria 2955
184 Ga0207699_10485638 3300025906 Bacteria 890
185 Ga0207645_10168790 3300025907 Bacteria 1433
186 Ga0207645_10237733 3300025907 Bacteria 1203
187 Ga0207643_10043760 3300025908 Bacteria 2527
188 Ga0207643_10074160 3300025908 Bacteria 1962
189 Ga0207654_10062873 3300025911 Bacteria 2177
190 Ga0207654_10633583 3300025911 Bacteria 765
191 Ga0207707_10029853 3300025912 Bacteria 4768
192 Ga0207707_10795527 3300025912 Bacteria 788
193 Ga0207671_10027083 3300025914 Bacteria 4288
194 Ga0207671_10225118 3300025914 Bacteria 1470
195 Ga0207671_10237099 3300025914 Bacteria 1432
196 Ga0207693_10012130 3300025915 Bacteria 6965
197 Ga0207693_10090390 3300025915 Bacteria 2400
198 Ga0207663_10034651 3300025916 Bacteria 3022
199 Ga0207663_10068491 3300025916 Bacteria 2279
200 Ga0207660_10773640 3300025917 Bacteria 783
201 Ga0207657_10064319 3300025919 Bacteria 3131
202 Ga0207652_10400614 3300025921 Bacteria 1238
203 Ga0207681_10112212 3300025923 Bacteria 1985
204 Ga0207681_10751499 3300025923 Bacteria 813
205 Ga0207659_10494457 3300025926 Bacteria 1035
206 Ga0207687_10014448 3300025927 Bacteria 5166
207 Ga0207687_10736581 3300025927 Bacteria 838
208 Ga0207700_10014358 3300025928 Bacteria 5188
209 Ga0207644_10104752 3300025931 Bacteria 2130
210 Ga0207706_10149978 3300025933 Bacteria 2050
211 Ga0207706_10250613 3300025933 Bacteria 1547
212 Ga0207686_10258473 3300025934 Bacteria 1276
213 Ga0207709_10131124 3300025935 Bacteria 1709
214 Ga0207709_11526304 3300025935 Bacteria 554
215 Ga0207670_10549759 3300025936 Bacteria 943
216 Ga0207704_10122971 3300025938 Bacteria 1780
217 Ga0207704_10389355 3300025938 Bacteria 1096
218 Ga0207704_10477255 3300025938 Bacteria 1000
219 Ga0207665_10032704 3300025939 Bacteria 3444
220 Ga0207665_10047876 3300025939 Bacteria 2868
221 Ga0207691_10063254 3300025940 Bacteria 3356
222 Ga0207711_10456892 3300025941 Bacteria 1189
223 Ga0207689_10069933 3300025942 Bacteria 2884
224 Ga0207689_10961209 3300025942 Bacteria 721
225 Ga0207679_10195873 3300025945 Bacteria 1684
226 Ga0207679_10798339 3300025945 Bacteria 860
227 Ga0207679_11775932 3300025945 Bacteria 564
228 Ga0207667_10278572 3300025949 Bacteria 1709
229 Ga0207651_10258341 3300025960 Bacteria 1429
230 Ga0207651_12138432 3300025960 Bacteria 502
231 Ga0207712_10508304 3300025961 Bacteria 1031
232 Ga0207712_10663039 3300025961 Bacteria 908
233 Ga0207712_10819453 3300025961 Bacteria 819
234 Ga0207668_10508460 3300025972 Bacteria 1037
235 Ga0207640_10452302 3300025981 Bacteria 1059
236 Ga0207703_10155774 3300026035 Bacteria 1996
237 Ga0207703_10709409 3300026035 Bacteria 957
238 Ga0207639_10383604 3300026041 Bacteria 1262
239 Ga0207678_10049127 3300026067 Bacteria 3646
240 Ga0207678_10103363 3300026067 Bacteria 2432
241 Ga0207678_10216031 3300026067 Bacteria 1641
242 Ga0207678_10545184 3300026067 Bacteria 1014
243 Ga0207708_10140103 3300026075 Bacteria 1896
244 Ga0207708_10296995 3300026075 Bacteria 1313
245 Ga0207702_10179159 3300026078 Bacteria 1950
246 Ga0207702_10953533 3300026078 Bacteria 851
247 Ga0207641_10253163 3300026088 Bacteria 1645
248 Ga0207648_10020385 3300026089 Bacteria 5971
249 Ga0207676_10035652 3300026095 Bacteria 3778
250 Ga0207676_10281792 3300026095 Bacteria 1509
251 Ga0207674_10020620 3300026116 Bacteria 7117
252 Ga0207674_10664788 3300026116 Bacteria 1006
253 Ga0207675_100161431 3300026118 Bacteria 2138
254 Ga0207675_101433798 3300026118 Bacteria 711
255 Ga0207683_10148862 3300026121 Bacteria 2112
256 Ga0207683_10357211 3300026121 Bacteria 1342
257 Ga0207683_10686145 3300026121 Bacteria 949
258 Ga0207683_10730151 3300026121 Bacteria 919
259 Ga0207698_10188789 3300026142 Bacteria 1833
260 Ga0209589_1000004 3300027357 Bacteria 578529
261 Ga0209489_100004 3300027361 Bacteria 578529
262 Ga0209700_100004 3300027363 Bacteria 578529
263 Ga0209179_1039099 3300027512 Bacteria 994
264 Ga0209588_1170886 3300027671 Bacteria 684
265 Ga0209813_10270240 3300027866 Bacteria 652
266 Ga0207428_10091995 3300027907 Bacteria 2354
267 Ga0268266_10065489 3300028379 Bacteria 3141
268 Ga0268266_10388486 3300028379 Bacteria 1318
269 Ga0268266_11123468 3300028379 Bacteria 760
270 Ga0268265_10189493 3300028380 Bacteria 1774
271 Ga0268265_10660998 3300028380 Bacteria 1005
272 Ga0268264_10000096 3300028381 Bacteria 230188
273 Ga0268264_10190754 3300028381 Bacteria 1868
274 Ga0268264_11064848 3300028381 Bacteria 816
275 Ga0307513_10729693 3300031456 Bacteria 696
276 Ga0307509_10313354 3300031507 Bacteria 1310
277 Ga0307415_100393543 3300032126 Bacteria 1181
278 Ga0307415_101478937 3300032126 Bacteria 649
279 Ga0316215_1006430 3300033544 Bacteria 1139
280 Ga0373936_0007451 3300035113 Bacteria 4115
281 Ga0373927_0420578 3300035695 Bacteria 882
282 Ga0373925_0142961 3300037068 Bacteria 1874
283 Ga0395899_0167934 3300037312 Bacteria 1547
284 Ga0436364_1403911 3300037853 Bacteria 1322
285 Ga0436365_0351413 3300039437 Bacteria 1722
286 Ga0436360_0096035 3300039438 Bacteria 1110
287 Ga0436360_0215507 3300039438 Bacteria 1297
288 Ga0436360_0298875 3300039438 Bacteria 2069
289 Ga0436361_0441757 3300039447 Bacteria 1008
290 Ga0436363_0161776 3300039450 Bacteria 1788
291 Ga0451802_1439403 3300041460 Bacteria 671
292 Ga0451805_122988 3300041461 Bacteria 693
293 Ga0451807_0439987 3300041486 Bacteria 1300
294 Ga0439458_0050704 3300042157 Bacteria 1024
295 Ga0466963_0059646 3300044694 Bacteria 2547
296 Ga0466967_0197355 3300045976 Bacteria 1904
297 Ga0466967_0618849 3300045976 Bacteria 1069
298 Ga0495664_0604394 3300046477 Bacteria 652
299 Ga0495584_0138168 3300046491 Bacteria 1237
300 Ga0495585_0154191 3300046492 Bacteria 1196
301 Ga0495596_0067129 3300046500 Bacteria 1394
302 Ga0495637_0128815 3300046520 Bacteria 968
303 Ga0495633_0128298 3300046558 Bacteria 1173
304 Ga0495656_0103296 3300046615 Bacteria 1321
305 Ga0495656_0163537 3300046615 Bacteria 1083
306 Ga0495670_0372993 3300046691 Bacteria 769
307 Ga0495589_0082231 3300046794 Bacteria 1566
308 Ga0495685_130274 3300047447 Bacteria 823
309 Ga0495686_0156797 3300047472 Bacteria 1333
310 Ga0496100_0553914 3300048903 Bacteria 890
311 Ga0496100_0673488 3300048903 Bacteria 806
312 Ga0496101_0135910 3300048904 Bacteria 1871
313 Ga0496101_0219551 3300048904 Bacteria 1475
314 Ga0496101_0411545 3300048904 Bacteria 1065
315 Ga0496102_0161576 3300048905 Bacteria 2107
316 Ga0496102_0651736 3300048905 Bacteria 976
317 Ga0496104_0031190 3300048907 Bacteria 4956
318 Ga0496104_0109853 3300048907 Bacteria 2643
319 Ga0496104_0574144 3300048907 Bacteria 1038
320 Ga0496105_0041941 3300048908 Bacteria 3772
321 Ga0496106_0177700 3300048909 Bacteria 1689
322 Ga0496106_0249784 3300048909 Bacteria 1418
323 Ga0496107_0989886 3300048910 Bacteria 610
324 Ga0496108_0036136 3300048911 Bacteria 4109
325 Ga0496108_0117895 3300048911 Bacteria 2275
326 Ga0496109_0033342 3300048912 Bacteria 4633
327 Ga0496110_0186629 3300048913 Bacteria 1883
328 Ga0496110_0211234 3300048913 Bacteria 1764
329 Ga0496110_1528347 3300048913 Bacteria 577
330 Ga0496111_0273822 3300048914 Bacteria 1252
331 Ga0496112_0222041 3300048915 Bacteria 1845
332 Ga0496113_0045724 3300048916 Bacteria 3248
333 Ga0496113_0193444 3300048916 Bacteria 1615
334 Ga0496118_0207818 3300048921 Bacteria 1152
335 Ga0496121_0067397 3300048924 Bacteria 2901
336 Ga0496121_0126289 3300048924 Bacteria 1922
337 Ga0496121_0276944 3300048924 Bacteria 1150
338 Ga0496125_0178154 3300048928 Bacteria 1420
339 Ga0496126_0083045 3300048929 Bacteria 2828
340 Ga0496126_0152544 3300048929 Bacteria 1979
341 Ga0496126_0153255 3300048929 Bacteria 1974
342 Ga0501042_0491580 3300049578 Bacteria 891
343 Ga0501047_0132583 3300049581 Bacteria 2372
344 Ga0501070_1429612 3300049586 Unclassified 525
345 nmdc:mga03683_321583_c1 3300050489 Bacteria 728
346 nmdc:mga00v17_312676_c1 3300050491 Bacteria 1021
347 nmdc:mga00v17_323323_c1 3300050491 Bacteria 1002
348 nmdc:mga06z11_63412_c1 3300050494 Bacteria 1934
349 nmdc:mga07m45_597070_c1 3300050496 Bacteria 638
350 nmdc:mga08y16_1542924_c1 3300050511 Bacteria 623
351 nmdc:mga08y16_427100_c1 3300050511 Bacteria 1354
352 nmdc:mga0n895_60990_c1 3300050512 Bacteria 3722
353 nmdc:mga0n895_73615_c1 3300050512 Bacteria 3392
354 nmdc:mga0rr50_156710_c1 3300050513 Bacteria 1845
355 nmdc:mga0a205_714997_c1 3300050515 Bacteria 851
356 Ga0500635_0062560 3300053080 Bacteria 1303
357 Ga0500647_0024710 3300053091 Bacteria 2827
358 Ga0500647_0149395 3300053091 Bacteria 1091
359 Ga0500566_0000131 3300053094 Bacteria 38186
360 Ga0500640_193158 3300053095 Bacteria 721
361 Ga0500557_000007 3300053105 Bacteria 136781
362 Ga0500572_055467 3300053111 Bacteria 1191
363 Ga0500595_056990 3300053119 Bacteria 1192
364 Ga0500597_195333 3300053120 Bacteria 852
365 Ga0500608_042801 3300053122 Bacteria 2174
366 Ga0500642_0000121 3300053130 Bacteria 35928
367 Ga0500559_0356564 3300053136 Bacteria 683
368 Ga0500585_253154 3300053144 Bacteria 558
369 Ga0500589_122587 3300053147 Bacteria 1098
370 Ga0500590_212348 3300053148 Bacteria 807
371 Ga0500604_0106463 3300053151 Bacteria 928
372 Ga0500630_129156 3300053159 Bacteria 1107
373 Ga0500638_068607 3300053162 Bacteria 1697
374 Ga0500639_000627 3300053163 Bacteria 17735
375 Ga0500639_105968 3300053163 Bacteria 1375
376 Ga0500636_0263099 3300053177 Bacteria 872
377 Ga0500637_0042506 3300053178 Bacteria 2570
378 Ga0500596_003688 3300053735 Bacteria 2878
379 Ga0500601_037243 3300053737 Bacteria 588
380 Ga0501084_0082978 3300054114 Bacteria 2690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100000724 Ga0068860_10000072415 136
2 3300028381 Ga0268264_10000096 Ga0268264_1000009653 136
3 3300041460 Ga0451802_1439403 Ga0451802_1439403_197_610 137
4 3300041461 Ga0451805_122988 Ga0451805_122988_43_456 137
5 3300041486 Ga0451807_0439987 Ga0451807_0439987_327_740 137
6 3300046477 Ga0495664_0604394 Ga0495664_0604394_228_641 137
7 3300009098 Ga0105245_11446719 Ga0105245_114467191 140
8 3300013297 Ga0157378_11818702 Ga0157378_118187021 140
9 3300014969 Ga0157376_12411316 Ga0157376_124113161 140
10 3300026118 Ga0207675_101433798 Ga0207675_1014337981 141
11 iso_pu_bacteria 2889033259 2889042048 143
12 3300005434 Ga0070709_10006323 Ga0070709_100063231 144
13 3300005436 Ga0070713_100353607 Ga0070713_1003536072 144
14 3300005437 Ga0070710_10335939 Ga0070710_103359392 144
15 3300005439 Ga0070711_100005518 Ga0070711_1000055186 144
16 3300049586 Ga0501070_1429612 Ga0501070_1429612_44_478 144
17 iso_pu_bacteria 2513237141 2513891821 144
18 iso_pu_bacteria 2513237145 2513921284 144
19 iso_pu_bacteria 2524023205 2524441768 144
20 iso_pu_bacteria 2524023228 2524536106 144
21 iso_pu_bacteria 2667528175 2671123480 144
22 iso_pu_bacteria 2744054633 2745075080 144
23 iso_pu_bacteria 2791355199 2793079416 144
24 iso_pu_bacteria 2824600985 2824607359 144
25 iso_pu_bacteria 2824609381 2824612405 144
26 iso_pu_bacteria 2824653114 2824659351 144
27 iso_pu_bacteria 2874612657 2874617759 144
28 iso_pu_bacteria 2881665667 2881673150 144
29 iso_pu_bacteria 2885409591 2885412810 144
30 iso_pu_bacteria 2888419890 2888422794 144
31 iso_pu_bacteria 2904699407 2904705293 144
32 iso_pu_bacteria 2906660503 2906661783 144
33 iso_pu_bacteria 2922386360 2922387349 144
34 iso_pu_bacteria 2922425934 2922428331 144
35 iso_pu_bacteria 2935630451 2935635832 144
36 iso_pu_bacteria 2935984226 2935987626 144
37 iso_pu_bacteria 2936055302 2936061945 144
38 iso_pu_bacteria 2941507105 2941512463 144
39 iso_pu_bacteria 2941515067 2941520164 144
40 iso_pu_bacteria 2941523033 2941528440 144
41 iso_pu_bacteria 8006984368 8006988683 144
42 iso_pu_bacteria 8006994254 8006994391 144
43 iso_pu_bacteria 8056689827 8056694735 144
44 3300006173 Ga0070716_100342012 Ga0070716_1003420122 145
45 3300006175 Ga0070712_100058692 Ga0070712_1000586922 145
46 3300025898 Ga0207692_10388010 Ga0207692_103880102 145
47 3300025906 Ga0207699_10032126 Ga0207699_100321261 145
48 3300025915 Ga0207693_10090390 Ga0207693_100903902 145
49 3300025916 Ga0207663_10068491 Ga0207663_100684912 145
50 3300025928 Ga0207700_10014358 Ga0207700_100143582 145
51 3300025939 Ga0207665_10047876 Ga0207665_100478762 145
52 3300053091 Ga0500647_0149395 Ga0500647_0149395_226_663 145
53 3300053105 Ga0500557_000007 Ga0500557_000007_2525_2962 145
54 3300053120 Ga0500597_195333 Ga0500597_195333_134_571 145
55 3300053130 Ga0500642_0000121 Ga0500642_0000121_32962_33399 145
56 3300053177 Ga0500636_0263099 Ga0500636_0263099_160_597 145
57 3300003323 rootH1_10245263 rootH1_102452633 146
58 3300005336 Ga0070680_100228789 Ga0070680_1002287892 146
59 3300005337 Ga0070682_100566001 Ga0070682_1005660011 146
60 3300005366 Ga0070659_100587127 Ga0070659_1005871271 146
61 3300005458 Ga0070681_10144607 Ga0070681_101446072 146
62 3300005547 Ga0070693_100018932 Ga0070693_1000189322 146
63 3300005563 Ga0068855_101723657 Ga0068855_1017236571 146
64 3300005614 Ga0068856_101562480 Ga0068856_1015624802 146
65 3300006237 Ga0097621_102229800 Ga0097621_1022298001 146
66 3300009093 Ga0105240_10228842 Ga0105240_102288422 146
67 3300009174 Ga0105241_10051534 Ga0105241_100515342 146
68 3300009551 Ga0105238_11134714 Ga0105238_111347141 146
69 3300010375 Ga0105239_10393942 Ga0105239_103939422 146
70 3300013307 Ga0157372_11198671 Ga0157372_111986711 146
71 3300013307 Ga0157372_11478875 Ga0157372_114788752 146
72 3300020069 Ga0197907_11359267 Ga0197907_113592671 146
73 3300020070 Ga0206356_10807111 Ga0206356_108071111 146
74 3300020078 Ga0206352_11041977 Ga0206352_110419771 146
75 3300020081 Ga0206354_11555323 Ga0206354_115553231 146
76 3300020082 Ga0206353_10440187 Ga0206353_104401871 146
77 3300025912 Ga0207707_10029853 Ga0207707_100298533 146
78 3300025912 Ga0207707_10795527 Ga0207707_107955271 146
79 3300025917 Ga0207660_10773640 Ga0207660_107736401 146
80 3300025921 Ga0207652_10400614 Ga0207652_104006142 146
81 3300025949 Ga0207667_10278572 Ga0207667_102785722 146
82 3300025981 Ga0207640_10452302 Ga0207640_104523022 146
83 3300035695 Ga0373927_0420578 Ga0373927_0420578_354_809 146
84 3300037068 Ga0373925_0142961 Ga0373925_0142961_912_1352 146
85 3300039438 Ga0436360_0298875 Ga0436360_0298875_1395_1835 146
86 3300042157 Ga0439458_0050704 Ga0439458_0050704_542_982 146
87 3300045976 Ga0466967_0197355 Ga0466967_0197355_730_1170 146
88 3300045976 Ga0466967_0618849 Ga0466967_0618849_278_718 146
89 3300048924 Ga0496121_0276944 Ga0496121_0276944_585_1025 146
90 3300049578 Ga0501042_0491580 Ga0501042_0491580_105_545 146
91 3300054114 Ga0501084_0082978 Ga0501084_0082978_2158_2598 146
92 3300003305 Ga0006770J48903_1099431 Ga0006770J48903_10994311 147
93 3300003579 Ga0007429J51699_1134367 Ga0007429J51699_11343671 147
94 3300006028 Ga0070717_10862789 Ga0070717_108627892 147
95 3300014969 Ga0157376_10856996 Ga0157376_108569962 147
96 3300021384 Ga0213876_10189044 Ga0213876_101890442 147
97 3300025893 Ga0207682_10061116 Ga0207682_100611162 147
98 3300031507 Ga0307509_10313354 Ga0307509_103133542 147
99 3300037312 Ga0395899_0167934 Ga0395899_0167934_792_1235 147
100 3300037853 Ga0436364_1403911 Ga0436364_1403911_678_1121 147
101 3300039437 Ga0436365_0351413 Ga0436365_0351413_900_1343 147
102 3300048913 Ga0496110_1528347 Ga0496110_1528347_52_495 147
103 3300049581 Ga0501047_0132583 Ga0501047_0132583_1721_2164 147
104 3300004798 Ga0058859_11025294 Ga0058859_110252941 148
105 3300005335 Ga0070666_10607810 Ga0070666_106078102 148
106 3300005347 Ga0070668_100198481 Ga0070668_1001984812 148
107 3300005353 Ga0070669_100109394 Ga0070669_1001093942 148
108 3300005356 Ga0070674_100347337 Ga0070674_1003473372 148
109 3300005367 Ga0070667_101258106 Ga0070667_1012581061 148
110 3300005434 Ga0070709_10039316 Ga0070709_100393161 148
111 3300005435 Ga0070714_100915174 Ga0070714_1009151741 148
112 3300005438 Ga0070701_11308970 Ga0070701_113089701 148
113 3300005439 Ga0070711_100078247 Ga0070711_1000782472 148
114 3300005439 Ga0070711_100905821 Ga0070711_1009058211 148
115 3300005440 Ga0070705_100800833 Ga0070705_1008008332 148
116 3300005441 Ga0070700_100120448 Ga0070700_1001204482 148
117 3300005455 Ga0070663_100554335 Ga0070663_1005543352 148
118 3300005456 Ga0070678_100008003 Ga0070678_1000080032 148
119 3300005457 Ga0070662_100258020 Ga0070662_1002580201 148
120 3300005457 Ga0070662_100377305 Ga0070662_1003773051 148
121 3300005466 Ga0070685_10573314 Ga0070685_105733141 148
122 3300005535 Ga0070684_101137764 Ga0070684_1011377641 148
123 3300005539 Ga0068853_100835602 Ga0068853_1008356022 148
124 3300005547 Ga0070693_100843595 Ga0070693_1008435951 148
125 3300005548 Ga0070665_100059377 Ga0070665_1000593775 148
126 3300005564 Ga0070664_100270043 Ga0070664_1002700433 148
127 3300005577 Ga0068857_100038961 Ga0068857_1000389612 148
128 3300005577 Ga0068857_101683227 Ga0068857_1016832271 148
129 3300005614 Ga0068856_100134332 Ga0068856_1001343322 148
130 3300005615 Ga0070702_100518977 Ga0070702_1005189771 148
131 3300005616 Ga0068852_100117115 Ga0068852_1001171152 148
132 3300005617 Ga0068859_100574097 Ga0068859_1005740972 148
133 3300005617 Ga0068859_101309249 Ga0068859_1013092492 148
134 3300005618 Ga0068864_100146011 Ga0068864_1001460112 148
135 3300005618 Ga0068864_100174493 Ga0068864_1001744932 148
136 3300005718 Ga0068866_10378679 Ga0068866_103786791 148
137 3300005719 Ga0068861_100174173 Ga0068861_1001741733 148
138 3300005834 Ga0068851_10256359 Ga0068851_102563591 148
139 3300005840 Ga0068870_10246962 Ga0068870_102469622 148
140 3300005841 Ga0068863_100085104 Ga0068863_1000851042 148
141 3300005841 Ga0068863_101205762 Ga0068863_1012057621 148
142 3300005842 Ga0068858_100594174 Ga0068858_1005941742 148
143 3300005842 Ga0068858_100633874 Ga0068858_1006338742 148
144 3300005843 Ga0068860_100231006 Ga0068860_1002310063 148
145 3300005844 Ga0068862_100175029 Ga0068862_1001750293 148
146 3300005844 Ga0068862_100966186 Ga0068862_1009661862 148
147 3300005937 Ga0081455_10211221 Ga0081455_102112212 148
148 3300005983 Ga0081540_1004839 Ga0081540_10048397 148
149 3300006038 Ga0075365_10129498 Ga0075365_101294983 148
150 3300006042 Ga0075368_10020457 Ga0075368_100204572 148
151 3300006051 Ga0075364_10095103 Ga0075364_100951032 148
152 3300006173 Ga0070716_100024139 Ga0070716_1000241392 148
153 3300006173 Ga0070716_100700053 Ga0070716_1007000531 148
154 3300006175 Ga0070712_100010182 Ga0070712_1000101823 148
155 3300006175 Ga0070712_100229220 Ga0070712_1002292201 148
156 3300006178 Ga0075367_10043975 Ga0075367_100439754 148
157 3300006186 Ga0075369_10032489 Ga0075369_100324892 148
158 3300006195 Ga0075366_10307297 Ga0075366_103072972 148
159 3300006237 Ga0097621_100148553 Ga0097621_1001485533 148
160 3300006353 Ga0075370_10115902 Ga0075370_101159021 148
161 3300006852 Ga0075433_10626292 Ga0075433_106262921 148
162 3300006871 Ga0075434_100082783 Ga0075434_1000827834 148
163 3300006871 Ga0075434_101140744 Ga0075434_1011407442 148
164 3300006881 Ga0068865_100175876 Ga0068865_1001758763 148
165 3300006881 Ga0068865_100376669 Ga0068865_1003766692 148
166 3300006931 Ga0097620_100574101 Ga0097620_1005741012 148
167 3300006931 Ga0097620_101309246 Ga0097620_1013092462 148
168 3300006942 Ga0099824_1012951 Ga0099824_10129516 148
169 3300007076 Ga0075435_100844993 Ga0075435_1008449931 148
170 3300007265 Ga0099794_10199631 Ga0099794_101996312 148
171 3300007788 Ga0099795_10048255 Ga0099795_100482552 148
172 3300009094 Ga0111539_10230180 Ga0111539_102301802 148
173 3300009094 Ga0111539_11876009 Ga0111539_118760092 148
174 3300009098 Ga0105245_10227708 Ga0105245_102277082 148
175 3300009101 Ga0105247_10349652 Ga0105247_103496522 148
176 3300009148 Ga0105243_11138876 Ga0105243_111388761 148
177 3300009148 Ga0105243_11563500 Ga0105243_115635001 148
178 3300009174 Ga0105241_10050216 Ga0105241_100502162 148
179 3300009174 Ga0105241_11058338 Ga0105241_110583381 148
180 3300009176 Ga0105242_10104392 Ga0105242_101043922 148
181 3300009177 Ga0105248_10177941 Ga0105248_101779412 148
182 3300009177 Ga0105248_11150174 Ga0105248_111501741 148
183 3300009545 Ga0105237_10128850 Ga0105237_101288502 148
184 3300009545 Ga0105237_10149756 Ga0105237_101497562 148
185 3300009551 Ga0105238_10292781 Ga0105238_102927812 148
186 3300009553 Ga0105249_10330460 Ga0105249_103304602 148
187 3300010375 Ga0105239_10160891 Ga0105239_101608913 148
188 3300010375 Ga0105239_10192736 Ga0105239_101927362 148
189 3300010375 Ga0105239_10682804 Ga0105239_106828041 148
190 3300011119 Ga0105246_10110230 Ga0105246_101102303 148
191 3300011119 Ga0105246_10110878 Ga0105246_101108783 148
192 3300013102 Ga0157371_10277720 Ga0157371_102777203 148
193 3300013105 Ga0157369_11153949 Ga0157369_111539492 148
194 3300013105 Ga0157369_11657907 Ga0157369_116579071 148
195 3300013296 Ga0157374_10043794 Ga0157374_100437942 148
196 3300013297 Ga0157378_10102389 Ga0157378_101023892 148
197 3300013306 Ga0163162_10215912 Ga0163162_102159122 148
198 3300013306 Ga0163162_10247567 Ga0163162_102475672 148
199 3300013308 Ga0157375_10591722 Ga0157375_105917222 148
200 3300014325 Ga0163163_10189477 Ga0163163_101894772 148
201 3300014325 Ga0163163_10288943 Ga0163163_102889433 148
202 3300014326 Ga0157380_10164370 Ga0157380_101643703 148
203 3300014326 Ga0157380_10346650 Ga0157380_103466502 148
204 3300014745 Ga0157377_10106874 Ga0157377_101068742 148
205 3300014968 Ga0157379_10106401 Ga0157379_101064012 148
206 3300014968 Ga0157379_10448244 Ga0157379_104482442 148
207 3300014969 Ga0157376_10298457 Ga0157376_102984572 148
208 3300021377 Ga0213874_10103659 Ga0213874_101036592 148
209 3300021441 Ga0213871_10058696 Ga0213871_100586962 148
210 3300025321 Ga0207656_10076492 Ga0207656_100764922 148
211 3300025899 Ga0207642_10318098 Ga0207642_103180981 148
212 3300025900 Ga0207710_10141973 Ga0207710_101419732 148
213 3300025901 Ga0207688_10043030 Ga0207688_100430302 148
214 3300025901 Ga0207688_10073196 Ga0207688_100731963 148
215 3300025903 Ga0207680_10923888 Ga0207680_109238881 148
216 3300025904 Ga0207647_10152001 Ga0207647_101520012 148
217 3300025906 Ga0207699_10485638 Ga0207699_104856382 148
218 3300025907 Ga0207645_10168790 Ga0207645_101687902 148
219 3300025907 Ga0207645_10237733 Ga0207645_102377332 148
220 3300025908 Ga0207643_10043760 Ga0207643_100437602 148
221 3300025908 Ga0207643_10074160 Ga0207643_100741602 148
222 3300025911 Ga0207654_10062873 Ga0207654_100628733 148
223 3300025914 Ga0207671_10027083 Ga0207671_100270834 148
224 3300025914 Ga0207671_10225118 Ga0207671_102251182 148
225 3300025915 Ga0207693_10012130 Ga0207693_100121304 148
226 3300025916 Ga0207663_10034651 Ga0207663_100346512 148
227 3300025919 Ga0207657_10064319 Ga0207657_100643192 148
228 3300025923 Ga0207681_10112212 Ga0207681_101122122 148
229 3300025923 Ga0207681_10751499 Ga0207681_107514991 148
230 3300025926 Ga0207659_10494457 Ga0207659_104944572 148
231 3300025927 Ga0207687_10014448 Ga0207687_100144482 148
232 3300025931 Ga0207644_10104752 Ga0207644_101047521 148
233 3300025933 Ga0207706_10149978 Ga0207706_101499782 148
234 3300025933 Ga0207706_10250613 Ga0207706_102506132 148
235 3300025934 Ga0207686_10258473 Ga0207686_102584731 148
236 3300025935 Ga0207709_11526304 Ga0207709_115263042 148
237 3300025938 Ga0207704_10122971 Ga0207704_101229712 148
238 3300025938 Ga0207704_10389355 Ga0207704_103893552 148
239 3300025939 Ga0207665_10032704 Ga0207665_100327042 148
240 3300025940 Ga0207691_10063254 Ga0207691_100632544 148
241 3300025941 Ga0207711_10456892 Ga0207711_104568921 148
242 3300025942 Ga0207689_10069933 Ga0207689_100699332 148
243 3300025942 Ga0207689_10961209 Ga0207689_109612091 148
244 3300025945 Ga0207679_10195873 Ga0207679_101958732 148
245 3300025945 Ga0207679_10798339 Ga0207679_107983392 148
246 3300025960 Ga0207651_10258341 Ga0207651_102583412 148
247 3300025961 Ga0207712_10508304 Ga0207712_105083042 148
248 3300025961 Ga0207712_10819453 Ga0207712_108194532 148
249 3300025972 Ga0207668_10508460 Ga0207668_105084602 148
250 3300026035 Ga0207703_10155774 Ga0207703_101557742 148
251 3300026035 Ga0207703_10709409 Ga0207703_107094091 148
252 3300026041 Ga0207639_10383604 Ga0207639_103836042 148
253 3300026067 Ga0207678_10049127 Ga0207678_100491275 148
254 3300026067 Ga0207678_10103363 Ga0207678_101033631 148
255 3300026075 Ga0207708_10296995 Ga0207708_102969952 148
256 3300026078 Ga0207702_10179159 Ga0207702_101791593 148
257 3300026078 Ga0207702_10953533 Ga0207702_109535331 148
258 3300026088 Ga0207641_10253163 Ga0207641_102531632 148
259 3300026095 Ga0207676_10035652 Ga0207676_100356522 148
260 3300026095 Ga0207676_10281792 Ga0207676_102817922 148
261 3300026116 Ga0207674_10020620 Ga0207674_100206207 148
262 3300026116 Ga0207674_10664788 Ga0207674_106647882 148
263 3300026118 Ga0207675_100161431 Ga0207675_1001614313 148
264 3300026121 Ga0207683_10148862 Ga0207683_101488622 148
265 3300026121 Ga0207683_10686145 Ga0207683_106861452 148
266 3300026142 Ga0207698_10188789 Ga0207698_101887892 148
267 3300027357 Ga0209589_1000004 Ga0209589_100000440 148
268 3300027361 Ga0209489_100004 Ga0209489_10000440 148
269 3300027363 Ga0209700_100004 Ga0209700_10000440 148
270 3300027512 Ga0209179_1039099 Ga0209179_10390992 148
271 3300027671 Ga0209588_1170886 Ga0209588_11708861 148
272 3300027866 Ga0209813_10270240 Ga0209813_102702401 148
273 3300027907 Ga0207428_10091995 Ga0207428_100919952 148
274 3300028379 Ga0268266_10065489 Ga0268266_100654894 148
275 3300028379 Ga0268266_10388486 Ga0268266_103884862 148
276 3300028380 Ga0268265_10189493 Ga0268265_101894932 148
277 3300028380 Ga0268265_10660998 Ga0268265_106609982 148
278 3300028381 Ga0268264_10190754 Ga0268264_101907542 148
279 3300028381 Ga0268264_11064848 Ga0268264_110648481 148
280 3300031456 Ga0307513_10729693 Ga0307513_107296931 148
281 3300032126 Ga0307415_100393543 Ga0307415_1003935432 148
282 3300033544 Ga0316215_1006430 Ga0316215_10064302 148
283 3300035113 Ga0373936_0007451 Ga0373936_0007451_2929_3375 148
284 3300039438 Ga0436360_0096035 Ga0436360_0096035_178_633 148
285 3300039438 Ga0436360_0215507 Ga0436360_0215507_584_1030 148
286 3300039447 Ga0436361_0441757 Ga0436361_0441757_301_747 148
287 3300039450 Ga0436363_0161776 Ga0436363_0161776_378_824 148
288 3300044694 Ga0466963_0059646 Ga0466963_0059646_1507_1956 148
289 3300048903 Ga0496100_0673488 Ga0496100_0673488_249_695 148
290 3300048904 Ga0496101_0135910 Ga0496101_0135910_1200_1646 148
291 3300048904 Ga0496101_0411545 Ga0496101_0411545_65_511 148
292 3300048905 Ga0496102_0161576 Ga0496102_0161576_1388_1834 148
293 3300048905 Ga0496102_0651736 Ga0496102_0651736_246_692 148
294 3300048907 Ga0496104_0031190 Ga0496104_0031190_3663_4109 148
295 3300048907 Ga0496104_0109853 Ga0496104_0109853_1869_2315 148
296 3300048908 Ga0496105_0041941 Ga0496105_0041941_2435_2881 148
297 3300048909 Ga0496106_0177700 Ga0496106_0177700_444_890 148
298 3300048910 Ga0496107_0989886 Ga0496107_0989886_83_529 148
299 3300048911 Ga0496108_0036136 Ga0496108_0036136_3350_3796 148
300 3300048911 Ga0496108_0117895 Ga0496108_0117895_1011_1457 148
301 3300048912 Ga0496109_0033342 Ga0496109_0033342_2701_3147 148
302 3300048913 Ga0496110_0186629 Ga0496110_0186629_223_669 148
303 3300048913 Ga0496110_0211234 Ga0496110_0211234_665_1111 148
304 3300048914 Ga0496111_0273822 Ga0496111_0273822_483_929 148
305 3300048915 Ga0496112_0222041 Ga0496112_0222041_344_790 148
306 3300048916 Ga0496113_0045724 Ga0496113_0045724_1975_2421 148
307 3300048916 Ga0496113_0193444 Ga0496113_0193444_382_828 148
308 3300048921 Ga0496118_0207818 Ga0496118_0207818_575_1021 148
309 3300048924 Ga0496121_0067397 Ga0496121_0067397_1294_1740 148
310 3300048924 Ga0496121_0126289 Ga0496121_0126289_363_809 148
311 3300048928 Ga0496125_0178154 Ga0496125_0178154_728_1174 148
312 3300048929 Ga0496126_0083045 Ga0496126_0083045_1075_1521 148
313 3300048929 Ga0496126_0152544 Ga0496126_0152544_1420_1866 148
314 3300048929 Ga0496126_0153255 Ga0496126_0153255_886_1332 148
315 3300050489 nmdc:mga03683_321583_c1 nmdc:mga03683_321583_c1_93_539 148
316 3300050491 nmdc:mga00v17_312676_c1 nmdc:mga00v17_312676_c1_362_808 148
317 3300050491 nmdc:mga00v17_323323_c1 nmdc:mga00v17_323323_c1_98_544 148
318 3300050494 nmdc:mga06z11_63412_c1 nmdc:mga06z11_63412_c1_887_1333 148
319 3300050496 nmdc:mga07m45_597070_c1 nmdc:mga07m45_597070_c1_75_521 148
320 3300050511 nmdc:mga08y16_1542924_c1 nmdc:mga08y16_1542924_c1_29_475 148
321 3300050511 nmdc:mga08y16_427100_c1 nmdc:mga08y16_427100_c1_560_1099 148
322 3300050512 nmdc:mga0n895_60990_c1 nmdc:mga0n895_60990_c1_591_1037 148
323 3300050512 nmdc:mga0n895_73615_c1 nmdc:mga0n895_73615_c1_2836_3282 148
324 3300050513 nmdc:mga0rr50_156710_c1 nmdc:mga0rr50_156710_c1_73_519 148
325 3300050515 nmdc:mga0a205_714997_c1 nmdc:mga0a205_714997_c1_86_532 148
326 3300053080 Ga0500635_0062560 Ga0500635_0062560_79_525 148
327 3300053091 Ga0500647_0024710 Ga0500647_0024710_1670_2116 148
328 3300053094 Ga0500566_0000131 Ga0500566_0000131_3295_3741 148
329 3300053095 Ga0500640_193158 Ga0500640_193158_156_602 148
330 3300053111 Ga0500572_055467 Ga0500572_055467_553_999 148
331 3300053119 Ga0500595_056990 Ga0500595_056990_38_484 148
332 3300053122 Ga0500608_042801 Ga0500608_042801_73_519 148
333 3300053136 Ga0500559_0356564 Ga0500559_0356564_157_603 148
334 3300053144 Ga0500585_253154 Ga0500585_253154_81_527 148
335 3300053148 Ga0500590_212348 Ga0500590_212348_298_744 148
336 3300053159 Ga0500630_129156 Ga0500630_129156_58_504 148
337 3300053162 Ga0500638_068607 Ga0500638_068607_994_1440 148
338 3300053163 Ga0500639_000627 Ga0500639_000627_16555_17001 148
339 3300053163 Ga0500639_105968 Ga0500639_105968_14_460 148
340 3300053178 Ga0500637_0042506 Ga0500637_0042506_1748_2194 148
341 3300053735 Ga0500596_003688 Ga0500596_003688_1213_1659 148
342 3300053737 Ga0500601_037243 Ga0500601_037243_62_508 148
343 3300003215 JGI25153J46596_10000519 JGI25153J46596_1000051912 149
344 3300005337 Ga0070682_100127870 Ga0070682_1001278702 149
345 3300005339 Ga0070660_100506404 Ga0070660_1005064042 149
346 3300005347 Ga0070668_100962052 Ga0070668_1009620521 149
347 3300005364 Ga0070673_101111514 Ga0070673_1011115141 149
348 3300005366 Ga0070659_101342085 Ga0070659_1013420851 149
349 3300005367 Ga0070667_101205082 Ga0070667_1012050821 149
350 3300005455 Ga0070663_100226745 Ga0070663_1002267452 149
351 3300005547 Ga0070693_100379533 Ga0070693_1003795332 149
352 3300005548 Ga0070665_100337097 Ga0070665_1003370972 149
353 3300005842 Ga0068858_101388424 Ga0068858_1013884241 149
354 3300005937 Ga0081455_10056820 Ga0081455_100568201 149
355 3300005983 Ga0081540_1028522 Ga0081540_10285222 149
356 3300005983 Ga0081540_1217022 Ga0081540_12170221 149
357 3300006195 Ga0075366_10292128 Ga0075366_102921281 149
358 3300006353 Ga0075370_10268335 Ga0075370_102683351 149
359 3300006880 Ga0075429_100436947 Ga0075429_1004369472 149
360 3300006881 Ga0068865_100336634 Ga0068865_1003366342 149
361 3300006931 Ga0097620_100947405 Ga0097620_1009474052 149
362 3300009092 Ga0105250_10097904 Ga0105250_100979042 149
363 3300009174 Ga0105241_10632798 Ga0105241_106327981 149
364 3300009545 Ga0105237_10377060 Ga0105237_103770602 149
365 3300009553 Ga0105249_10215871 Ga0105249_102158713 149
366 3300013306 Ga0163162_11646900 Ga0163162_116469002 149
367 3300013308 Ga0157375_11042442 Ga0157375_110424422 149
368 3300014326 Ga0157380_11297463 Ga0157380_112974632 149
369 3300014969 Ga0157376_10594117 Ga0157376_105941172 149
370 3300017792 Ga0163161_10303413 Ga0163161_103034132 149
371 3300025297 Ga0209758_1003548 Ga0209758_10035486 149
372 3300025901 Ga0207688_10540177 Ga0207688_105401771 149
373 3300025903 Ga0207680_10381882 Ga0207680_103818821 149
374 3300025905 Ga0207685_10196054 Ga0207685_101960541 149
375 3300025911 Ga0207654_10633583 Ga0207654_106335831 149
376 3300025914 Ga0207671_10237099 Ga0207671_102370992 149
377 3300025927 Ga0207687_10736581 Ga0207687_107365812 149
378 3300025935 Ga0207709_10131124 Ga0207709_101311242 149
379 3300025936 Ga0207670_10549759 Ga0207670_105497591 149
380 3300025938 Ga0207704_10477255 Ga0207704_104772552 149
381 3300025945 Ga0207679_11775932 Ga0207679_117759321 149
382 3300025960 Ga0207651_12138432 Ga0207651_121384321 149
383 3300025961 Ga0207712_10663039 Ga0207712_106630392 149
384 3300026067 Ga0207678_10216031 Ga0207678_102160312 149
385 3300026067 Ga0207678_10545184 Ga0207678_105451842 149
386 3300026075 Ga0207708_10140103 Ga0207708_101401031 149
387 3300026089 Ga0207648_10020385 Ga0207648_100203857 149
388 3300026121 Ga0207683_10357211 Ga0207683_103572111 149
389 3300026121 Ga0207683_10730151 Ga0207683_107301512 149
390 3300028379 Ga0268266_11123468 Ga0268266_111234682 149
391 3300032126 Ga0307415_101478937 Ga0307415_1014789372 149
392 3300046491 Ga0495584_0138168 Ga0495584_0138168_565_1014 149
393 3300046492 Ga0495585_0154191 Ga0495585_0154191_212_661 149
394 3300046500 Ga0495596_0067129 Ga0495596_0067129_743_1192 149
395 3300046520 Ga0495637_0128815 Ga0495637_0128815_57_506 149
396 3300046558 Ga0495633_0128298 Ga0495633_0128298_435_884 149
397 3300046615 Ga0495656_0103296 Ga0495656_0103296_246_695 149
398 3300046615 Ga0495656_0163537 Ga0495656_0163537_434_883 149
399 3300046691 Ga0495670_0372993 Ga0495670_0372993_105_554 149
400 3300046794 Ga0495589_0082231 Ga0495589_0082231_1089_1538 149
401 3300047447 Ga0495685_130274 Ga0495685_130274_51_500 149
402 3300047472 Ga0495686_0156797 Ga0495686_0156797_866_1315 149
403 3300048903 Ga0496100_0553914 Ga0496100_0553914_118_567 149
404 3300048904 Ga0496101_0219551 Ga0496101_0219551_1004_1453 149
405 3300048907 Ga0496104_0574144 Ga0496104_0574144_411_860 149
406 3300048909 Ga0496106_0249784 Ga0496106_0249784_494_943 149
407 3300053147 Ga0500589_122587 Ga0500589_122587_81_530 149
408 3300053151 Ga0500604_0106463 Ga0500604_0106463_292_741 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01322

Cytochrom_C_2

Cytochrome C'

23

142

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mqv-assembly1.cif.gz_A crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli 0.9184 24 146
1a7v-assembly2.cif.gz_B cytochrome c' from rhodopseudomonas palustris 0.9171 24 148
1mqv-assembly2.cif.gz_B crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli 0.9039 24 146
1mqv-assembly1.cif.gz_A crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli 0.8902 24 146
1a7v-assembly2.cif.gz_B cytochrome c' from rhodopseudomonas palustris 0.8897 24 148
ID Description Score Start End Superfamily
1a7vB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9171 24 148 1.20.120.10
1mqvB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9039 24 146 1.20.120.10
1a7vB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.8897 24 148 1.20.120.10
1mqvB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.8768 24 146 1.20.120.10
2ccyA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.8763 21 148 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A160UG50-F1-model_v4 deleted 0.9705 31 148
AF-A0A160UG50-F1-model_v4 deleted 0.9546 31 148
AF-P00150-F1-model_v4 Cytochrome c-556 (Cytochrome c556) 0.9332 1 148 GO:0005506
GO:0009055
GO:0020037
GO:0022900
GO:0042597
AF-A0A1W6ZTJ1-F1-model_v4 Cytochrome c domain-containing protein 0.9307 10 147 GO:0005506
GO:0009055
GO:0016020
GO:0020037
GO:0022900
AF-P00150-F1-model_v4 Cytochrome c-556 (Cytochrome c556) 0.9271 1 148 GO:0005506
GO:0009055
GO:0020037
GO:0022900
GO:0042597

Feature Viewer

pLDDT pTM Quality
88.47 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map