F436720

General Info

Members Datasets Scaffolds Average Seq Length
408 264 359 483

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10089789|Ga0157378_100897892
Length 523
Sequence VKLSQFHLTFRVSRFTTILLKIISSVYLKNPFAMHKLTYLACLFLLAACSKNKVANETRTTTTDTSFSIDGKKVVVYTTADSTQLRLSATDTLSFADFDQPLETQASIFIDPSHTFQTFLGIGGALTDASAETFAKLPADKQKEVLQAYYDKDKGIGYTIGRTNINSCDFSSDTYTYVTDGDKELKSFNLAHDQKFKIPLIKKAMEAAGGKINLFVSPWSPPAWMKDNNDMLHGGKLKPEFYESWANYYVKFIQGYEKEGIPVWGLTVQNEPMAKQTWESCMYTAEDEKNFIKNSLGPTLQKNNLSDKKLIGWDHNRDLLYQRASSLLNDPDAAKYLWGIGFHWYEEWNGGRQYSNVELVHETFPDKNLMFTEGCNFPFSWQTFDNWKWGENYGENMIHDFNNGAVAWTDWNILLDETGGPNHVGNFCFAPIHAKTKEGTLHYMNSYYYIGHLSKFIRPGAKRIISSANRVQLLTTAFKNPDGKLSVVIMNPTGQKFSYRMYIGKKAVEATSLPHSISTLVVE

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
6 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
7 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
8 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
9 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
20 2738541278 Niastella sp. CF465 Isolate Unclassified
21 2738541283 Pedobacter sp. OK701 Isolate Unclassified
22 2738541302 Pedobacter sp. CF074 Isolate Unclassified
23 2739367651 Pedobacter sp. OK291 Isolate Unclassified
24 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
25 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
26 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
27 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
28 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
29 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
30 2818991437 Pedobacter terrae 518 Isolate Unclassified
31 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
32 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
33 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
34 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
35 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
38 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
39 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
40 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
41 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
42 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
43 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
44 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
45 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
46 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
47 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
48 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
49 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
250 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
251 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
252 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
257 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
258 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.99
Metatranscriptomes 0
Isolates 12.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 9.8
Nodule 0.49
Rhizoplane 0.25
Rhizosphere 75.49
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000817 3300002738 Bacteria 13585
2 JGI25157J39369_1000029 3300002741 Bacteria 146928
3 JGI25152J39213_1000128 3300002773 Bacteria 51965
4 JGI25150J39212_1000021 3300002774 Bacteria 133190
5 JGI25151J46595_10000078 3300003187 Bacteria 133190
6 JGI25153J46596_10000057 3300003215 Bacteria 133190
7 rootH1_10078411 3300003316 Bacteria 3560
8 rootH2_10041652 3300003320 Bacteria 8568
9 rootH2_10051986 3300003320 Bacteria 10715
10 rootH2_10054626 3300003320 Bacteria 4175
11 rootH1_10109720 3300003323 Bacteria 3443
12 rootH1_10110668 3300003323 Bacteria 14790
13 rootH1_10340325 3300003323 Unclassified 2464
14 Ga0055535_1005498 3300003761 Bacteria 2759
15 Ga0055542_1002086 3300003762 Bacteria 7444
16 Ga0055526_1003574 3300003771 Bacteria 9781
17 Ga0055536_1000009 3300003781 Bacteria 311572
18 Ga0055534_1011826 3300003784 Bacteria 1756
19 Ga0055528_1000694 3300003790 Bacteria 23961
20 Ga0055530_10001763 3300003791 Bacteria 15122
21 Ga0055530_10002396 3300003791 Bacteria 12131
22 Ga0065165_1000017 3300005262 Bacteria 278286
23 Ga0065714_10064467 3300005288 Bacteria 63317
24 Ga0065714_10083938 3300005288 Bacteria 2224
25 Ga0065707_10109826 3300005295 Bacteria 2454
26 Ga0070676_10023649 3300005328 Bacteria 3455
27 Ga0070683_100000385 3300005329 Bacteria 30659
28 Ga0070683_100005596 3300005329 Bacteria 10494
29 Ga0070683_100054689 3300005329 Bacteria 3702
30 Ga0070683_100059576 3300005329 Bacteria 3547
31 Ga0070677_10042078 3300005333 Bacteria 1807
32 Ga0068869_100003261 3300005334 Bacteria 9915
33 Ga0068869_100004654 3300005334 Bacteria 8559
34 Ga0068869_100022690 3300005334 Bacteria 4328
35 Ga0070666_10056461 3300005335 Bacteria 2651
36 Ga0070682_100001578 3300005337 Bacteria 12715
37 Ga0068868_100021099 3300005338 Bacteria 4904
38 Ga0068868_100034728 3300005338 Bacteria 3894
39 Ga0068868_100128595 3300005338 Bacteria 2071
40 Ga0070689_100001880 3300005340 Bacteria 13550
41 Ga0070689_100004250 3300005340 Bacteria 9651
42 Ga0070689_100020892 3300005340 Bacteria 4866
43 Ga0070661_100000521 3300005344 Bacteria 29488
44 Ga0070661_100008647 3300005344 Bacteria 7043
45 Ga0070661_100048783 3300005344 Bacteria 3100
46 Ga0070675_100071963 3300005354 Bacteria 2870
47 Ga0070671_100004285 3300005355 Bacteria 11287
48 Ga0070688_100015878 3300005365 Bacteria 4293
49 Ga0070659_100011491 3300005366 Bacteria 6549
50 Ga0070709_10000002 3300005434 Bacteria 322903
51 Ga0070663_100034542 3300005455 Bacteria 3502
52 Ga0070662_100005116 3300005457 Bacteria 8360
53 Ga0070662_100017037 3300005457 Bacteria 4889
54 Ga0070662_100040895 3300005457 Bacteria 3303
55 Ga0070662_100135170 3300005457 Bacteria 1905
56 Ga0070681_10020260 3300005458 Bacteria 6667
57 Ga0070698_100034668 3300005471 Bacteria 5223
58 Ga0070679_100056276 3300005530 Bacteria 3919
59 Ga0070684_100009989 3300005535 Bacteria 7504
60 Ga0068853_100003579 3300005539 Bacteria 11897
61 Ga0068853_100015944 3300005539 Bacteria 6177
62 Ga0068853_100111846 3300005539 Bacteria 2427
63 Ga0070672_100069123 3300005543 Bacteria 2803
64 Ga0070686_100097647 3300005544 Bacteria 1978
65 Ga0070695_100087025 3300005545 Bacteria 2078
66 Ga0070704_100121556 3300005549 Bacteria 2007
67 Ga0070664_100161713 3300005564 Unclassified 1981
68 Ga0070664_100211906 3300005564 Bacteria 1732
69 Ga0068857_100000097 3300005577 Bacteria 51356
70 Ga0068857_100007787 3300005577 Bacteria 9233
71 Ga0068857_100016176 3300005577 Bacteria 6532
72 Ga0068857_100042955 3300005577 Bacteria 4010
73 Ga0068854_100064645 3300005578 Bacteria 2658
74 Ga0068854_100120281 3300005578 Bacteria 1993
75 Ga0068856_100010911 3300005614 Bacteria 8818
76 Ga0068856_100128478 3300005614 Bacteria 2538
77 Ga0068852_100072587 3300005616 Bacteria 3025
78 Ga0068859_100067483 3300005617 Bacteria 3611
79 Ga0068864_100017282 3300005618 Bacteria 6012
80 Ga0068864_100037093 3300005618 Bacteria 4158
81 Ga0068864_100041783 3300005618 Unclassified 3921
82 Ga0068864_100059799 3300005618 Bacteria 3298
83 Ga0068866_10043294 3300005718 Bacteria 2246
84 Ga0068861_100023691 3300005719 Bacteria 4431
85 Ga0068870_10007053 3300005840 Bacteria 4990
86 Ga0068863_100126815 3300005841 Bacteria 2435
87 Ga0068858_100013636 3300005842 Bacteria 7671
88 Ga0068860_100060071 3300005843 Bacteria 3614
89 Ga0068860_100275521 3300005843 Bacteria 1643
90 Ga0081539_10010948 3300005985 Bacteria 7274
91 Ga0081539_10063336 3300005985 Bacteria 2018
92 Ga0070716_100094212 3300006173 Bacteria 1820
93 Ga0097621_100027966 3300006237 Bacteria 4439
94 Ga0097621_100123789 3300006237 Bacteria 2195
95 Ga0068871_100004751 3300006358 Bacteria 9495
96 Ga0068871_100052722 3300006358 Bacteria 3295
97 Ga0075434_100017821 3300006871 Bacteria 6850
98 Ga0075434_100190425 3300006871 Bacteria 2071
99 Ga0097620_100067484 3300006931 Bacteria 3611
100 Ga0099824_1001461 3300006942 Bacteria 33284
101 Ga0105244_10000114 3300009036 Bacteria 84368
102 Ga0105244_10000175 3300009036 Bacteria 65097
103 Ga0105244_10044681 3300009036 Bacteria 2281
104 Ga0114129_10128189 3300009147 Bacteria 3487
105 Ga0105243_10000485 3300009148 Bacteria 40540
106 Ga0105243_10212497 3300009148 Bacteria 1704
107 Ga0105237_10000723 3300009545 Bacteria 45657
108 Ga0105238_10051469 3300009551 Bacteria 4143
109 Ga0105239_10008004 3300010375 Bacteria 12064
110 Ga0105239_10054783 3300010375 Bacteria 4375
111 Ga0105246_10088068 3300011119 Bacteria 2230
112 Ga0157373_10000036 3300013100 Bacteria 122723
113 Ga0157370_10000241 3300013104 Bacteria 69817
114 Ga0157370_10004936 3300013104 Bacteria 15098
115 Ga0157370_10024727 3300013104 Bacteria 5947
116 Ga0157370_10052720 3300013104 Bacteria 3883
117 Ga0157370_10078822 3300013104 Bacteria 3102
118 Ga0157370_10118746 3300013104 Bacteria 2470
119 Ga0157369_10001697 3300013105 Bacteria 26845
120 Ga0157374_10004107 3300013296 Bacteria 12225
121 Ga0157374_10021600 3300013296 Bacteria 5730
122 Ga0157374_10108044 3300013296 Unclassified 2674
123 Ga0157378_10040834 3300013297 Bacteria 4115
124 Ga0157378_10044033 3300013297 Bacteria 3962
125 Ga0157378_10089789 3300013297 Bacteria 2792
126 Ga0163162_10001345 3300013306 Bacteria 22882
127 Ga0163162_10001661 3300013306 Bacteria 20854
128 Ga0163162_10056079 3300013306 Bacteria 3969
129 Ga0163162_10065353 3300013306 Bacteria 3684
130 Ga0163162_10141245 3300013306 Bacteria 2522
131 Ga0157372_10065658 3300013307 Bacteria 4075
132 Ga0157375_10005733 3300013308 Bacteria 10806
133 Ga0157375_10009721 3300013308 Bacteria 8454
134 Ga0157375_10056849 3300013308 Bacteria 3865
135 Ga0157375_10203077 3300013308 Bacteria 2138
136 Ga0163163_10026797 3300014325 Bacteria 5513
137 Ga0157380_10000613 3300014326 Bacteria 21981
138 Ga0182008_10000039 3300014497 Bacteria 124930
139 Ga0182008_10000460 3300014497 Bacteria 31080
140 Ga0157377_10091790 3300014745 Bacteria 1794
141 Ga0157376_10107161 3300014969 Bacteria 2453
142 Ga0182006_1000011 3300015261 Bacteria 408647
143 Ga0182006_1000178 3300015261 Bacteria 66897
144 Ga0182006_1001691 3300015261 Bacteria 12905
145 Ga0183373_1003 3300015682 Bacteria 558813
146 Ga0163161_10000108 3300017792 Bacteria 78805
147 Ga0163161_10000955 3300017792 Bacteria 22177
148 Ga0163161_10002830 3300017792 Bacteria 12308
149 Ga0213876_10000366 3300021384 Bacteria 38521
150 Ga0209258_100333 3300025242 Bacteria 70926
151 Ga0207425_1000004 3300025245 Bacteria 1092421
152 Ga0209646_1000111 3300025246 Bacteria 155786
153 Ga0209026_1000054 3300025250 Bacteria 242508
154 Ga0209026_1000549 3300025250 Bacteria 25871
155 Ga0209026_1002350 3300025250 Bacteria 7158
156 Ga0209677_100105 3300025253 Bacteria 89277
157 Ga0209148_1000129 3300025254 Bacteria 175720
158 Ga0209759_1000043 3300025256 Bacteria 242513
159 Ga0209129_1000048 3300025258 Bacteria 270192
160 Ga0209455_1008118 3300025272 Bacteria 2886
161 Ga0209673_1000083 3300025273 Bacteria 216509
162 Ga0209675_1000367 3300025291 Bacteria 38392
163 Ga0209676_1000001 3300025292 Bacteria 1852142
164 Ga0209025_1000009 3300025294 Bacteria 1092561
165 Ga0209564_1004329 3300025295 Bacteria 8760
166 Ga0209758_1000010 3300025297 Bacteria 1092782
167 Ga0209758_1001318 3300025297 Bacteria 30178
168 Ga0209050_1000018 3300025298 Bacteria 723263
169 Ga0209050_1000273 3300025298 Bacteria 110451
170 Ga0207426_1001089 3300025302 Bacteria 25231
171 Ga0209257_1000308 3300025304 Bacteria 105012
172 Ga0207655_1003241 3300025728 Bacteria 12217
173 Ga0207643_10004031 3300025908 Bacteria 7904
174 Ga0207707_10038616 3300025912 Unclassified 4172
175 Ga0207695_10143104 3300025913 Bacteria 2338
176 Ga0207671_10001233 3300025914 Bacteria 30228
177 Ga0207657_10087213 3300025919 Bacteria 2611
178 Ga0207649_10004109 3300025920 Bacteria 7920
179 Ga0207659_10005427 3300025926 Bacteria 7726
180 Ga0207706_10030830 3300025933 Bacteria 4781
181 Ga0207706_10031447 3300025933 Bacteria 4728
182 Ga0207706_10067305 3300025933 Bacteria 3151
183 Ga0207686_10121091 3300025934 Bacteria 1781
184 Ga0207709_10000557 3300025935 Bacteria 31848
185 Ga0207670_10002959 3300025936 Bacteria 8969
186 Ga0207670_10004439 3300025936 Bacteria 7556
187 Ga0207691_10040969 3300025940 Bacteria 4279
188 Ga0207689_10001853 3300025942 Bacteria 20012
189 Ga0207689_10013102 3300025942 Bacteria 7079
190 Ga0207689_10040094 3300025942 Bacteria 3877
191 Ga0207689_10135752 3300025942 Bacteria 2026
192 Ga0207661_10002647 3300025944 Bacteria 12320
193 Ga0207661_10010507 3300025944 Bacteria 6666
194 Ga0207661_10086751 3300025944 Bacteria 2598
195 Ga0207661_10139618 3300025944 Bacteria 2084
196 Ga0207679_10021439 3300025945 Bacteria 4381
197 Ga0207679_10023164 3300025945 Bacteria 4241
198 Ga0207679_10064718 3300025945 Bacteria 2734
199 Ga0207667_10093176 3300025949 Bacteria 3111
200 Ga0207712_10040251 3300025961 Bacteria 3206
201 Ga0207712_10115543 3300025961 Bacteria 2020
202 Ga0207640_10004558 3300025981 Bacteria 7522
203 Ga0207640_10043984 3300025981 Bacteria 2858
204 Ga0207677_10080756 3300026023 Bacteria 2331
205 Ga0207703_10093405 3300026035 Bacteria 2534
206 Ga0207678_10018265 3300026067 Bacteria 6158
207 Ga0207702_10000376 3300026078 Bacteria 50989
208 Ga0207702_10041188 3300026078 Bacteria 3873
209 Ga0207641_10128449 3300026088 Bacteria 2272
210 Ga0207648_10116830 3300026089 Bacteria 2344
211 Ga0207676_10007689 3300026095 Bacteria 7657
212 Ga0207674_10009743 3300026116 Bacteria 10944
213 Ga0207674_10014698 3300026116 Bacteria 8632
214 Ga0207674_10038778 3300026116 Bacteria 4942
215 Ga0207674_10148780 3300026116 Bacteria 2299
216 Ga0207683_10001848 3300026121 Bacteria 18723
217 Ga0265319_1006597 3300028563 Bacteria 5355
218 Ga0265336_10000006 3300028666 Bacteria 348453
219 Ga0265336_10018486 3300028666 Bacteria 2258
220 Ga0307515_10000007 3300028794 Bacteria 719669
221 Ga0265324_10032195 3300029957 Bacteria 1833
222 Ga0307511_10001876 3300030521 Bacteria 22065
223 Ga0265332_10002104 3300031238 Bacteria 10309
224 Ga0265327_10000127 3300031251 Bacteria 166247
225 Ga0265327_10015613 3300031251 Bacteria 4887
226 Ga0265316_10134734 3300031344 Bacteria 1859
227 Ga0307513_10062773 3300031456 Bacteria 3925
228 Ga0307408_100000497 3300031548 Bacteria 34174
229 Ga0307508_10000677 3300031616 Bacteria 40943
230 Ga0307516_10002738 3300031730 Bacteria 23246
231 Ga0307405_10000031 3300031731 Bacteria 99176
232 Ga0307406_10082637 3300031901 Bacteria 2140
233 Ga0307407_10000036 3300031903 Bacteria 76457
234 Ga0307407_10030043 3300031903 Bacteria 2927
235 Ga0307412_10000012 3300031911 Bacteria 404180
236 Ga0307412_10000353 3300031911 Bacteria 28551
237 Ga0307412_10018587 3300031911 Bacteria 4187
238 Ga0307412_10087352 3300031911 Bacteria 2172
239 Ga0307416_100000007 3300032002 Bacteria 433284
240 Ga0307416_100000033 3300032002 Bacteria 156736
241 Ga0307414_10020645 3300032004 Bacteria 4110
242 Ga0307414_10124633 3300032004 Bacteria 1988
243 Ga0307507_10000071 3300033179 Bacteria 158391
244 Ga0373955_0033535 3300035172 Unclassified 2705
245 Ga0316584_0080369 3300036712 Bacteria 2442
246 Ga0373925_0106600 3300037068 Bacteria 2161
247 Ga0395900_0122723 3300037418 Bacteria 2665
248 Ga0436365_0603740 3300039437 Bacteria 61917
249 Ga0439465_0001960 3300041413 Bacteria 6750
250 Ga0439465_0003437 3300041413 Bacteria 5166
251 Ga0439445_0001428 3300042004 Bacteria 5187
252 Ga0439449_0014970 3300042007 Bacteria 2914
253 Ga0451577_0000044 3300042876 Bacteria 329357
254 Ga0451577_0000943 3300042876 Bacteria 42647
255 Ga0451577_0003129 3300042876 Bacteria 18667
256 Ga0451577_0003816 3300042876 Bacteria 16402
257 Ga0451577_0021567 3300042876 Bacteria 5893
258 Ga0466972_0000009 3300044658 Bacteria 256374
259 Ga0466972_0003760 3300044658 Bacteria 7550
260 Ga0453683_0000183 3300044673 Bacteria 86894
261 Ga0453683_0000311 3300044673 Bacteria 61262
262 Ga0453683_0001586 3300044673 Bacteria 19209
263 Ga0453683_0002945 3300044673 Bacteria 12814
264 Ga0453683_0010526 3300044673 Bacteria 6125
265 Ga0453683_0010728 3300044673 Bacteria 6066
266 Ga0453683_0085355 3300044673 Bacteria 1978
267 Ga0453684_0000661 3300044712 Bacteria 123767
268 Ga0453684_0001039 3300044712 Bacteria 88840
269 Ga0453684_0001154 3300044712 Bacteria 82455
270 Ga0453684_0001483 3300044712 Bacteria 66171
271 Ga0453684_0003340 3300044712 Bacteria 36413
272 Ga0453684_0006265 3300044712 Bacteria 22778
273 Ga0453684_0006891 3300044712 Bacteria 21318
274 Ga0453684_0010046 3300044712 Bacteria 16283
275 Ga0453684_0014940 3300044712 Bacteria 12342
276 Ga0453684_0018285 3300044712 Bacteria 10771
277 Ga0453684_0039894 3300044712 Bacteria 6386
278 Ga0453684_0052321 3300044712 Bacteria 5342
279 Ga0453684_0084263 3300044712 Bacteria 3954
280 Ga0453684_0168326 3300044712 Bacteria 2585
281 Ga0453684_0236899 3300044712 Bacteria 2104
282 Ga0451576_0000047 3300045051 Bacteria 329357
283 Ga0451576_0000283 3300045051 Bacteria 124222
284 Ga0451576_0001065 3300045051 Bacteria 50428
285 Ga0451576_0001534 3300045051 Bacteria 38886
286 Ga0451576_0001892 3300045051 Bacteria 33597
287 Ga0451576_0011780 3300045051 Bacteria 9903
288 Ga0451576_0043522 3300045051 Bacteria 4737
289 Ga0451576_0065945 3300045051 Bacteria 3769
290 Ga0451576_0211354 3300045051 Bacteria 2026
291 Ga0495627_000003 3300046453 Bacteria 704557
292 Ga0495638_0067323 3300046460 Bacteria 2199
293 Ga0495596_0001180 3300046500 Bacteria 15303
294 Ga0495606_0004470 3300046507 Bacteria 13940
295 Ga0495610_0000001 3300046512 Bacteria 1620061
296 Ga0495610_0000064 3300046512 Bacteria 125922
297 Ga0495610_0005260 3300046512 Bacteria 9261
298 Ga0495616_0018238 3300046513 Bacteria 3856
299 Ga0495618_0032228 3300046514 Unclassified 3282
300 Ga0495628_0025438 3300046516 Bacteria 4836
301 Ga0495630_0015501 3300046517 Bacteria 5566
302 Ga0495632_0021049 3300046519 Bacteria 3520
303 Ga0495643_0000794 3300046522 Bacteria 34957
304 Ga0495643_0010594 3300046522 Bacteria 5664
305 Ga0495663_0000075 3300046525 Bacteria 45194
306 Ga0495663_0001443 3300046525 Bacteria 7507
307 Ga0495654_0000001 3300046530 Bacteria 1513197
308 Ga0495609_0000083 3300046538 Bacteria 115045
309 Ga0495633_0000008 3300046558 Bacteria 301830
310 Ga0495668_0002556 3300046616 Bacteria 14798
311 Ga0495625_0023815 3300046660 Bacteria 4672
312 Ga0495625_0081490 3300046660 Bacteria 2252
313 Ga0495613_0071922 3300046689 Unclassified 2521
314 Ga0495671_0018463 3300046692 Bacteria 3701
315 Ga0495686_0000102 3300047472 Bacteria 177525
316 Ga0495686_0000118 3300047472 Bacteria 165897
317 Ga0495686_0014276 3300047472 Bacteria 5472
318 Ga0496102_0018278 3300048905 Bacteria 6159
319 Ga0496116_0000012 3300048919 Bacteria 611365
320 Ga0496117_0000050 3300048920 Bacteria 292727
321 Ga0496118_0000044 3300048921 Bacteria 283524
322 Ga0496119_0000002 3300048922 Bacteria 738385
323 Ga0496122_0000386 3300048925 Bacteria 93777
324 Ga0496122_0000412 3300048925 Bacteria 90921
325 Ga0496122_0001104 3300048925 Bacteria 46663
326 Ga0496122_0001883 3300048925 Bacteria 31781
327 Ga0496122_0008926 3300048925 Bacteria 10667
328 Ga0496123_0001375 3300048926 Bacteria 34102
329 Ga0496123_0001863 3300048926 Bacteria 27648
330 Ga0496123_0002630 3300048926 Bacteria 21752
331 Ga0496123_0015111 3300048926 Bacteria 6352
332 Ga0496123_0021250 3300048926 Bacteria 5049
333 Ga0496125_0001218 3300048928 Bacteria 38631
334 Ga0496125_0007974 3300048928 Bacteria 11185
335 Ga0496125_0040342 3300048928 Bacteria 4006
336 Ga0496126_0005440 3300048929 Bacteria 14522
337 Ga0501296_001919 3300049519 Bacteria 2126
338 Ga0501032_0032053 3300049569 Bacteria 3602
339 Ga0501043_0143673 3300049579 Bacteria 1868
340 Ga0501047_0077237 3300049581 Bacteria 3204
341 Ga0501047_0090057 3300049581 Bacteria 2945
342 Ga0501243_003311 3300049675 Bacteria 2379
343 Ga0501251_002929 3300049681 Bacteria 1680
344 Ga0501241_000013 3300049758 Bacteria 104728
345 Ga0501269_000311 3300049766 Bacteria 13021
346 Ga0501035_0014771 3300049822 Bacteria 7211
347 Ga0501044_0019470 3300049823 Bacteria 7259
348 Ga0501044_0046532 3300049823 Bacteria 4490
349 nmdc:mga05p37_8508_c1 3300050507 Bacteria 12125
350 Ga0500578_0000280 3300053086 Bacteria 62943
351 Ga0500644_0000217 3300053088 Bacteria 33352
352 Ga0500646_0004764 3300053090 Bacteria 3434
353 Ga0500583_0000035 3300053092 Bacteria 96248
354 Ga0500583_0046658 3300053092 Bacteria 1993
355 Ga0500568_0003469 3300053139 Bacteria 8770
356 Ga0500616_0009404 3300053153 Bacteria 5948
357 Ga0500622_0003534 3300053156 Bacteria 10355
358 Ga0500634_0017200 3300053161 Bacteria 3870
359 Ga0500636_0052941 3300053177 Bacteria 2383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049681 Ga0501251_002929 Ga0501251_002929_345_1625 426
2 3300044712 Ga0453684_0052321 Ga0453684_0052321_3149_4570 428
3 3300049579 Ga0501043_0143673 Ga0501043_0143673_30_1331 429
4 3300044712 Ga0453684_0014940 Ga0453684_0014940_6016_7338 436
5 iso_pu_bacteria 2511231000 2511234399 436
6 3300003323 rootH1_10340325 rootH1_103403252 449
7 3300005549 Ga0070704_100121556 Ga0070704_1001215562 449
8 3300005340 Ga0070689_100001880 Ga0070689_1000018804 453
9 3300041413 Ga0439465_0001960 Ga0439465_0001960_616_2019 453
10 3300046453 Ga0495627_000003 Ga0495627_000003_499870_501273 453
11 3300046530 Ga0495654_0000001 Ga0495654_0000001_615144_616547 453
12 3300046558 Ga0495633_0000008 Ga0495633_0000008_39444_40847 453
13 3300047472 Ga0495686_0014276 Ga0495686_0014276_420_1823 453
14 3300049766 Ga0501269_000311 Ga0501269_000311_1047_2450 453
15 3300049822 Ga0501035_0014771 Ga0501035_0014771_5808_7196 453
16 3300014326 Ga0157380_10000613 Ga0157380_100006134 455
17 3300042007 Ga0439449_0014970 Ga0439449_0014970_179_1645 455
18 3300003320 rootH2_10051986 rootH2_100519864 456
19 3300006871 Ga0075434_100190425 Ga0075434_1001904252 458
20 3300017792 Ga0163161_10000108 Ga0163161_100001083 458
21 3300013104 Ga0157370_10024727 Ga0157370_100247273 459
22 3300046512 Ga0495610_0000064 Ga0495610_0000064_35698_37164 459
23 3300013104 Ga0157370_10078822 Ga0157370_100788222 460
24 3300025250 Ga0209026_1002350 Ga0209026_10023503 460
25 iso_pu_bacteria 2582581278 2585142604 460
26 iso_pu_bacteria 2582581281 2585159838 460
27 iso_pu_bacteria 2582581282 2585164034 460
28 iso_pu_bacteria 2585428060 2587748049 460
29 iso_pu_bacteria 2585428061 2587752602 460
30 iso_pu_bacteria 2585428095 2587866653 460
31 iso_pu_bacteria 2585428115 2587943039 460
32 iso_pu_bacteria 2585428182 2588208511 460
33 iso_pu_bacteria 2585428183 2588212990 460
34 iso_pu_bacteria 2585428184 2588219580 460
35 iso_pu_bacteria 2585428187 2588233609 460
36 iso_pu_bacteria 2588253712 2588446263 460
37 iso_pu_bacteria 2588254257 2590611700 460
38 iso_pu_bacteria 2728369107 2729201677 460
39 iso_pu_bacteria 2738541276 2738713827 460
40 iso_pu_bacteria 2739367874 2740057446 460
41 iso_pu_bacteria 2751185877 2753672866 460
42 iso_pu_bacteria 2772190705 2772603468 460
43 iso_pu_bacteria 2775506739 2775673040 460
44 iso_pu_bacteria 2816332188 2816872645 460
45 iso_pu_bacteria 2842083920 2842084039 460
46 iso_pu_bacteria 2871720351 2871721821 460
47 iso_pu_bacteria 2889290771 2889291998 460
48 iso_pu_bacteria 2905999023 2906000952 460
49 iso_pu_bacteria 2919097161 2919099457 460
50 iso_pu_bacteria 2919399522 2919402744 460
51 iso_pu_bacteria 2945924605 2945927474 460
52 iso_pu_bacteria 2946019816 2946021238 460
53 iso_pu_bacteria 2977243572 2977246291 460
54 iso_pu_bacteria 2984572630 2984575794 460
55 iso_pu_bacteria 2984606641 2984609250 460
56 iso_pu_bacteria 2993372514 2993373652 460
57 iso_pu_bacteria 2993480792 2993484330 460
58 3300013296 Ga0157374_10021600 Ga0157374_100216003 461
59 3300013306 Ga0163162_10001345 Ga0163162_100013458 461
60 iso_pu_bacteria 2738541283 2738755565 461
61 3300049519 Ga0501296_001919 Ga0501296_001919_437_1891 462
62 iso_pu_bacteria 2738541278 2738725155 462
63 3300005545 Ga0070695_100087025 Ga0070695_1000870252 463
64 3300031251 Ga0265327_10000127 Ga0265327_1000012738 463
65 3300003320 rootH2_10054626 rootH2_100546262 464
66 3300003323 rootH1_10109720 rootH1_101097203 464
67 3300003784 Ga0055534_1011826 Ga0055534_10118261 464
68 3300005288 Ga0065714_10083938 Ga0065714_100839381 464
69 3300005329 Ga0070683_100000385 Ga0070683_10000038517 464
70 3300005337 Ga0070682_100001578 Ga0070682_1000015784 464
71 3300005539 Ga0068853_100003579 Ga0068853_1000035794 464
72 3300005614 Ga0068856_100128478 Ga0068856_1001284782 464
73 3300005618 Ga0068864_100017282 Ga0068864_1000172821 464
74 3300005840 Ga0068870_10007053 Ga0068870_100070535 464
75 3300005841 Ga0068863_100126815 Ga0068863_1001268152 464
76 3300005843 Ga0068860_100275521 Ga0068860_1002755211 464
77 3300009036 Ga0105244_10000114 Ga0105244_1000011449 464
78 3300009148 Ga0105243_10000485 Ga0105243_1000048525 464
79 3300009551 Ga0105238_10051469 Ga0105238_100514693 464
80 3300010375 Ga0105239_10054783 Ga0105239_100547832 464
81 3300013100 Ga0157373_10000036 Ga0157373_1000003617 464
82 3300013104 Ga0157370_10004936 Ga0157370_100049362 464
83 3300013104 Ga0157370_10052720 Ga0157370_100527202 464
84 3300013308 Ga0157375_10005733 Ga0157375_100057332 464
85 3300013308 Ga0157375_10203077 Ga0157375_102030772 464
86 3300014497 Ga0182008_10000039 Ga0182008_1000003983 464
87 3300015261 Ga0182006_1000011 Ga0182006_1000011100 464
88 3300017792 Ga0163161_10002830 Ga0163161_100028308 464
89 3300025291 Ga0209675_1000367 Ga0209675_100036715 464
90 3300025728 Ga0207655_1003241 Ga0207655_10032416 464
91 3300025908 Ga0207643_10004031 Ga0207643_100040315 464
92 3300025913 Ga0207695_10143104 Ga0207695_101431042 464
93 3300025935 Ga0207709_10000557 Ga0207709_100005574 464
94 3300025936 Ga0207670_10004439 Ga0207670_100044394 464
95 3300025944 Ga0207661_10010507 Ga0207661_1001050710 464
96 3300026078 Ga0207702_10041188 Ga0207702_100411883 464
97 3300026088 Ga0207641_10128449 Ga0207641_101284491 464
98 3300026095 Ga0207676_10007689 Ga0207676_100076895 464
99 3300030521 Ga0307511_10001876 Ga0307511_100018766 464
100 3300031730 Ga0307516_10002738 Ga0307516_100027385 464
101 3300031911 Ga0307412_10000012 Ga0307412_10000012353 464
102 3300031911 Ga0307412_10000353 Ga0307412_1000035313 464
103 3300031911 Ga0307412_10018587 Ga0307412_100185872 464
104 3300032002 Ga0307416_100000033 Ga0307416_100000033144 464
105 3300032004 Ga0307414_10124633 Ga0307414_101246332 464
106 3300042004 Ga0439445_0001428 Ga0439445_0001428_991_2430 464
107 3300046500 Ga0495596_0001180 Ga0495596_0001180_9116_10555 464
108 3300046507 Ga0495606_0004470 Ga0495606_0004470_7917_9398 464
109 3300046512 Ga0495610_0000001 Ga0495610_0000001_1301902_1303341 464
110 3300046519 Ga0495632_0021049 Ga0495632_0021049_975_2414 464
111 3300046522 Ga0495643_0010594 Ga0495643_0010594_1733_3172 464
112 3300046525 Ga0495663_0000075 Ga0495663_0000075_12342_13781 464
113 3300046538 Ga0495609_0000083 Ga0495609_0000083_62458_63897 464
114 3300046660 Ga0495625_0023815 Ga0495625_0023815_1393_2832 464
115 3300047472 Ga0495686_0000102 Ga0495686_0000102_113100_114527 464
116 3300047472 Ga0495686_0000118 Ga0495686_0000118_1890_3329 464
117 3300048905 Ga0496102_0018278 Ga0496102_0018278_3944_5383 464
118 3300048919 Ga0496116_0000012 Ga0496116_0000012_90722_92161 464
119 3300048920 Ga0496117_0000050 Ga0496117_0000050_28033_29472 464
120 3300048921 Ga0496118_0000044 Ga0496118_0000044_263283_264722 464
121 3300048922 Ga0496119_0000002 Ga0496119_0000002_265461_266900 464
122 3300048925 Ga0496122_0000386 Ga0496122_0000386_46889_48328 464
123 3300048925 Ga0496122_0000412 Ga0496122_0000412_34872_36344 464
124 3300048925 Ga0496122_0001104 Ga0496122_0001104_28548_29987 464
125 3300048925 Ga0496122_0008926 Ga0496122_0008926_9089_10528 464
126 3300048926 Ga0496123_0001375 Ga0496123_0001375_450_1889 464
127 3300048926 Ga0496123_0002630 Ga0496123_0002630_11479_12918 464
128 3300048926 Ga0496123_0021250 Ga0496123_0021250_44_1516 464
129 3300048928 Ga0496125_0001218 Ga0496125_0001218_1791_3230 464
130 3300048928 Ga0496125_0007974 Ga0496125_0007974_678_2117 464
131 3300048928 Ga0496125_0040342 Ga0496125_0040342_354_1793 464
132 3300048929 Ga0496126_0005440 Ga0496126_0005440_13060_14499 464
133 3300049758 Ga0501241_000013 Ga0501241_000013_62211_63740 464
134 iso_pu_bacteria 2585428045 2587678411 464
135 iso_pu_bacteria 2585428185 2588224109 464
136 iso_pu_bacteria 2588254255 2590600557 464
137 iso_pu_bacteria 2765235839 2765572367 464
138 3300005295 Ga0065707_10109826 Ga0065707_101098262 465
139 3300009545 Ga0105237_10000723 Ga0105237_1000072311 465
140 3300013104 Ga0157370_10000241 Ga0157370_1000024113 465
141 3300014497 Ga0182008_10000460 Ga0182008_1000046020 465
142 3300015261 Ga0182006_1000178 Ga0182006_100017810 465
143 3300017792 Ga0163161_10000955 Ga0163161_100009556 465
144 3300025914 Ga0207671_10001233 Ga0207671_1000123312 465
145 3300028794 Ga0307515_10000007 Ga0307515_1000000772 465
146 3300044673 Ga0453683_0085355 Ga0453683_0085355_451_1875 465
147 3300044712 Ga0453684_0084263 Ga0453684_0084263_986_2410 465
148 3300046460 Ga0495638_0067323 Ga0495638_0067323_600_2042 465
149 3300048925 Ga0496122_0001883 Ga0496122_0001883_29176_30609 465
150 3300048926 Ga0496123_0001863 Ga0496123_0001863_9684_11117 465
151 iso_pu_bacteria 2738541302 2738856051 465
152 iso_pu_bacteria 2818991437 2819547948 465
153 iso_pu_bacteria 2842722452 2842726403 465
154 iso_pu_bacteria 2842909656 2842910653 465
155 iso_pu_bacteria 2849281842 2849284585 465
156 iso_pu_bacteria 2881359912 2881363967 465
157 iso_pu_bacteria 2954016120 2954018223 465
158 3300013104 Ga0157370_10118746 Ga0157370_101187462 467
159 3300021384 Ga0213876_10000366 Ga0213876_1000036613 467
160 3300039437 Ga0436365_0603740 Ga0436365_0603740_20197_21687 467
161 3300042876 Ga0451577_0021567 Ga0451577_0021567_245_1687 467
162 3300049569 Ga0501032_0032053 Ga0501032_0032053_1699_3141 467
163 3300049823 Ga0501044_0019470 Ga0501044_0019470_376_1818 467
164 3300003771 Ga0055526_1003574 Ga0055526_10035742 468
165 3300003790 Ga0055528_1000694 Ga0055528_10006947 468
166 3300003791 Ga0055530_10002396 Ga0055530_100023969 468
167 3300005262 Ga0065165_1000017 Ga0065165_1000017118 468
168 3300025273 Ga0209673_1000083 Ga0209673_1000083110 468
169 3300025295 Ga0209564_1004329 Ga0209564_10043293 468
170 3300025297 Ga0209758_1001318 Ga0209758_100131814 468
171 3300025298 Ga0209050_1000273 Ga0209050_100027324 468
172 3300025302 Ga0207426_1001089 Ga0207426_10010897 468
173 3300031616 Ga0307508_10000677 Ga0307508_1000067718 468
174 3300044712 Ga0453684_0001483 Ga0453684_0001483_7756_9207 468
175 3300046616 Ga0495668_0002556 Ga0495668_0002556_7965_9416 468
176 iso_pu_bacteria 2739367651 2739588976 468
177 iso_pu_bacteria 2945997725 2946000971 468
178 3300003781 Ga0055536_1000009 Ga0055536_1000009125 469
179 3300003791 Ga0055530_10001763 Ga0055530_100017635 469
180 3300005288 Ga0065714_10064467 Ga0065714_1006446728 469
181 3300005328 Ga0070676_10023649 Ga0070676_100236493 469
182 3300005334 Ga0068869_100004654 Ga0068869_1000046543 469
183 3300005338 Ga0068868_100034728 Ga0068868_1000347282 469
184 3300005434 Ga0070709_10000002 Ga0070709_10000002103 469
185 3300005458 Ga0070681_10020260 Ga0070681_100202604 469
186 3300005471 Ga0070698_100034668 Ga0070698_1000346682 469
187 3300005530 Ga0070679_100056276 Ga0070679_1000562762 469
188 3300005719 Ga0068861_100023691 Ga0068861_1000236912 469
189 3300005985 Ga0081539_10063336 Ga0081539_100633362 469
190 3300006173 Ga0070716_100094212 Ga0070716_1000942121 469
191 3300006237 Ga0097621_100027966 Ga0097621_1000279661 469
192 3300006358 Ga0068871_100052722 Ga0068871_1000527222 469
193 3300006942 Ga0099824_1001461 Ga0099824_100146110 469
194 3300009036 Ga0105244_10000175 Ga0105244_1000017519 469
195 3300009036 Ga0105244_10044681 Ga0105244_100446812 469
196 3300009147 Ga0114129_10128189 Ga0114129_101281892 469
197 3300013297 Ga0157378_10044033 Ga0157378_100440332 469
198 3300013306 Ga0163162_10065353 Ga0163162_100653532 469
199 3300015261 Ga0182006_1001691 Ga0182006_10016913 469
200 3300015682 Ga0183373_1003 Ga0183373_1003142 469
201 3300025292 Ga0209676_1000001 Ga0209676_10000011226 469
202 3300025298 Ga0209050_1000018 Ga0209050_1000018358 469
203 3300025912 Ga0207707_10038616 Ga0207707_100386164 469
204 3300025942 Ga0207689_10013102 Ga0207689_100131023 469
205 3300026089 Ga0207648_10116830 Ga0207648_101168302 469
206 3300028563 Ga0265319_1006597 Ga0265319_10065973 469
207 3300031251 Ga0265327_10015613 Ga0265327_100156135 469
208 3300031731 Ga0307405_10000031 Ga0307405_1000003125 469
209 3300031901 Ga0307406_10082637 Ga0307406_100826372 469
210 3300031903 Ga0307407_10000036 Ga0307407_1000003630 469
211 3300031903 Ga0307407_10030043 Ga0307407_100300432 469
212 3300031911 Ga0307412_10087352 Ga0307412_100873521 469
213 3300032002 Ga0307416_100000007 Ga0307416_100000007207 469
214 3300037418 Ga0395900_0122723 Ga0395900_0122723_696_2180 469
215 3300042876 Ga0451577_0003816 Ga0451577_0003816_13913_15436 469
216 3300044673 Ga0453683_0002945 Ga0453683_0002945_8725_10179 469
217 3300044673 Ga0453683_0010526 Ga0453683_0010526_4246_5700 469
218 3300044673 Ga0453683_0010728 Ga0453683_0010728_426_1880 469
219 3300044712 Ga0453684_0000661 Ga0453684_0000661_18174_19697 469
220 3300044712 Ga0453684_0003340 Ga0453684_0003340_16195_17658 469
221 3300044712 Ga0453684_0006265 Ga0453684_0006265_9752_11206 469
222 3300044712 Ga0453684_0006891 Ga0453684_0006891_8195_9649 469
223 3300044712 Ga0453684_0010046 Ga0453684_0010046_8152_9675 469
224 3300044712 Ga0453684_0039894 Ga0453684_0039894_408_1862 469
225 3300045051 Ga0451576_0000283 Ga0451576_0000283_18174_19697 469
226 3300045051 Ga0451576_0001534 Ga0451576_0001534_17749_19203 469
227 3300045051 Ga0451576_0065945 Ga0451576_0065945_1398_2861 469
228 3300045051 Ga0451576_0211354 Ga0451576_0211354_414_1868 469
229 3300046512 Ga0495610_0005260 Ga0495610_0005260_4459_5925 469
230 3300050507 nmdc:mga05p37_8508_c1 nmdc:mga05p37_8508_c1_3019_4482 469
231 3300002773 JGI25152J39213_1000128 JGI25152J39213_10001288 470
232 3300002774 JGI25150J39212_1000021 JGI25150J39212_100002160 470
233 3300003187 JGI25151J46595_10000078 JGI25151J46595_1000007864 470
234 3300003215 JGI25153J46596_10000057 JGI25153J46596_1000005764 470
235 3300003320 rootH2_10041652 rootH2_100416525 470
236 3300005985 Ga0081539_10010948 Ga0081539_100109484 470
237 3300013306 Ga0163162_10056079 Ga0163162_100560793 470
238 3300013307 Ga0157372_10065658 Ga0157372_100656582 470
239 3300025245 Ga0207425_1000004 Ga0207425_100000462 470
240 3300025258 Ga0209129_1000048 Ga0209129_100004862 470
241 3300025294 Ga0209025_1000009 Ga0209025_100000962 470
242 3300025297 Ga0209758_1000010 Ga0209758_100001063 470
243 3300025304 Ga0209257_1000308 Ga0209257_1000308104 470
244 3300028666 Ga0265336_10018486 Ga0265336_100184862 470
245 3300031238 Ga0265332_10002104 Ga0265332_100021043 470
246 3300031456 Ga0307513_10062773 Ga0307513_100627733 470
247 3300031548 Ga0307408_100000497 Ga0307408_10000049721 470
248 3300042876 Ga0451577_0000943 Ga0451577_0000943_22465_23931 470
249 3300042876 Ga0451577_0003129 Ga0451577_0003129_12718_14184 470
250 3300044658 Ga0466972_0000009 Ga0466972_0000009_132804_134264 470
251 3300044658 Ga0466972_0003760 Ga0466972_0003760_115_1602 470
252 3300044673 Ga0453683_0000311 Ga0453683_0000311_17818_19284 470
253 3300044673 Ga0453683_0001586 Ga0453683_0001586_4092_5558 470
254 3300044712 Ga0453684_0001039 Ga0453684_0001039_22465_23931 470
255 3300044712 Ga0453684_0018285 Ga0453684_0018285_8057_9523 470
256 3300044712 Ga0453684_0168326 Ga0453684_0168326_266_1723 470
257 3300045051 Ga0451576_0001065 Ga0451576_0001065_22465_23931 470
258 3300045051 Ga0451576_0001892 Ga0451576_0001892_4377_5843 470
259 3300045051 Ga0451576_0043522 Ga0451576_0043522_1920_3386 470
260 3300046513 Ga0495616_0018238 Ga0495616_0018238_475_1917 470
261 3300046522 Ga0495643_0000794 Ga0495643_0000794_14207_15649 470
262 3300046660 Ga0495625_0081490 Ga0495625_0081490_547_1989 470
263 3300049581 Ga0501047_0077237 Ga0501047_0077237_44_1528 470
264 3300049581 Ga0501047_0090057 Ga0501047_0090057_167_1651 470
265 3300049823 Ga0501044_0046532 Ga0501044_0046532_2535_4019 470
266 3300053090 Ga0500646_0004764 Ga0500646_0004764_1397_2839 470
267 3300053092 Ga0500583_0000035 Ga0500583_0000035_50081_51538 470
268 3300053092 Ga0500583_0046658 Ga0500583_0046658_41_1498 470
269 3300053156 Ga0500622_0003534 Ga0500622_0003534_5517_6974 470
270 3300003316 rootH1_10078411 rootH1_100784112 471
271 3300003761 Ga0055535_1005498 Ga0055535_10054982 471
272 3300003762 Ga0055542_1002086 Ga0055542_10020862 471
273 3300005329 Ga0070683_100005596 Ga0070683_1000055964 471
274 3300005329 Ga0070683_100059576 Ga0070683_1000595762 471
275 3300005333 Ga0070677_10042078 Ga0070677_100420782 471
276 3300005334 Ga0068869_100003261 Ga0068869_1000032617 471
277 3300005334 Ga0068869_100022690 Ga0068869_1000226902 471
278 3300005335 Ga0070666_10056461 Ga0070666_100564611 471
279 3300005338 Ga0068868_100021099 Ga0068868_1000210992 471
280 3300005338 Ga0068868_100128595 Ga0068868_1001285952 471
281 3300005340 Ga0070689_100004250 Ga0070689_1000042501 471
282 3300005340 Ga0070689_100020892 Ga0070689_1000208923 471
283 3300005344 Ga0070661_100000521 Ga0070661_1000005215 471
284 3300005344 Ga0070661_100008647 Ga0070661_1000086475 471
285 3300005344 Ga0070661_100048783 Ga0070661_1000487832 471
286 3300005354 Ga0070675_100071963 Ga0070675_1000719633 471
287 3300005355 Ga0070671_100004285 Ga0070671_1000042852 471
288 3300005365 Ga0070688_100015878 Ga0070688_1000158784 471
289 3300005366 Ga0070659_100011491 Ga0070659_1000114911 471
290 3300005455 Ga0070663_100034542 Ga0070663_1000345421 471
291 3300005457 Ga0070662_100005116 Ga0070662_1000051164 471
292 3300005457 Ga0070662_100017037 Ga0070662_1000170372 471
293 3300005457 Ga0070662_100040895 Ga0070662_1000408953 471
294 3300005457 Ga0070662_100135170 Ga0070662_1001351701 471
295 3300005535 Ga0070684_100009989 Ga0070684_1000099895 471
296 3300005539 Ga0068853_100015944 Ga0068853_1000159442 471
297 3300005543 Ga0070672_100069123 Ga0070672_1000691232 471
298 3300005544 Ga0070686_100097647 Ga0070686_1000976471 471
299 3300005564 Ga0070664_100161713 Ga0070664_1001617132 471
300 3300005564 Ga0070664_100211906 Ga0070664_1002119061 471
301 3300005577 Ga0068857_100007787 Ga0068857_1000077872 471
302 3300005577 Ga0068857_100016176 Ga0068857_1000161764 471
303 3300005577 Ga0068857_100042955 Ga0068857_1000429553 471
304 3300005578 Ga0068854_100064645 Ga0068854_1000646452 471
305 3300005578 Ga0068854_100120281 Ga0068854_1001202812 471
306 3300005616 Ga0068852_100072587 Ga0068852_1000725872 471
307 3300005617 Ga0068859_100067483 Ga0068859_1000674834 471
308 3300005618 Ga0068864_100037093 Ga0068864_1000370932 471
309 3300005618 Ga0068864_100041783 Ga0068864_1000417832 471
310 3300005618 Ga0068864_100059799 Ga0068864_1000597995 471
311 3300005718 Ga0068866_10043294 Ga0068866_100432942 471
312 3300005842 Ga0068858_100013636 Ga0068858_1000136364 471
313 3300005843 Ga0068860_100060071 Ga0068860_1000600713 471
314 3300006237 Ga0097621_100123789 Ga0097621_1001237892 471
315 3300006358 Ga0068871_100004751 Ga0068871_1000047516 471
316 3300006871 Ga0075434_100017821 Ga0075434_1000178214 471
317 3300006931 Ga0097620_100067484 Ga0097620_1000674844 471
318 3300011119 Ga0105246_10088068 Ga0105246_100880682 471
319 3300013296 Ga0157374_10004107 Ga0157374_1000410710 471
320 3300013296 Ga0157374_10108044 Ga0157374_101080442 471
321 3300013297 Ga0157378_10040834 Ga0157378_100408342 471
322 3300013297 Ga0157378_10089789 Ga0157378_100897892 471
323 3300013306 Ga0163162_10001661 Ga0163162_100016613 471
324 3300013306 Ga0163162_10141245 Ga0163162_101412452 471
325 3300013308 Ga0157375_10009721 Ga0157375_100097212 471
326 3300013308 Ga0157375_10056849 Ga0157375_100568493 471
327 3300014325 Ga0163163_10026797 Ga0163163_100267973 471
328 3300014745 Ga0157377_10091790 Ga0157377_100917902 471
329 3300014969 Ga0157376_10107161 Ga0157376_101071612 471
330 3300025242 Ga0209258_100333 Ga0209258_10033355 471
331 3300025254 Ga0209148_1000129 Ga0209148_1000129144 471
332 3300025919 Ga0207657_10087213 Ga0207657_100872132 471
333 3300025920 Ga0207649_10004109 Ga0207649_100041094 471
334 3300025926 Ga0207659_10005427 Ga0207659_100054277 471
335 3300025933 Ga0207706_10030830 Ga0207706_100308302 471
336 3300025933 Ga0207706_10031447 Ga0207706_100314472 471
337 3300025933 Ga0207706_10067305 Ga0207706_100673052 471
338 3300025934 Ga0207686_10121091 Ga0207686_101210911 471
339 3300025936 Ga0207670_10002959 Ga0207670_100029593 471
340 3300025940 Ga0207691_10040969 Ga0207691_100409694 471
341 3300025942 Ga0207689_10001853 Ga0207689_1000185315 471
342 3300025942 Ga0207689_10040094 Ga0207689_100400942 471
343 3300025942 Ga0207689_10135752 Ga0207689_101357522 471
344 3300025944 Ga0207661_10002647 Ga0207661_100026477 471
345 3300025944 Ga0207661_10086751 Ga0207661_100867512 471
346 3300025944 Ga0207661_10139618 Ga0207661_101396182 471
347 3300025945 Ga0207679_10021439 Ga0207679_100214392 471
348 3300025945 Ga0207679_10023164 Ga0207679_100231643 471
349 3300025945 Ga0207679_10064718 Ga0207679_100647182 471
350 3300025961 Ga0207712_10040251 Ga0207712_100402512 471
351 3300025961 Ga0207712_10115543 Ga0207712_101155431 471
352 3300025981 Ga0207640_10043984 Ga0207640_100439842 471
353 3300026023 Ga0207677_10080756 Ga0207677_100807562 471
354 3300026035 Ga0207703_10093405 Ga0207703_100934052 471
355 3300026067 Ga0207678_10018265 Ga0207678_100182657 471
356 3300026116 Ga0207674_10014698 Ga0207674_100146982 471
357 3300026116 Ga0207674_10038778 Ga0207674_100387782 471
358 3300026116 Ga0207674_10148780 Ga0207674_101487802 471
359 3300026121 Ga0207683_10001848 Ga0207683_100018484 471
360 3300032004 Ga0307414_10020645 Ga0307414_100206452 471
361 3300035172 Ga0373955_0033535 Ga0373955_0033535_713_2185 471
362 3300037068 Ga0373925_0106600 Ga0373925_0106600_595_2067 471
363 3300041413 Ga0439465_0003437 Ga0439465_0003437_2952_4418 471
364 3300042876 Ga0451577_0000044 Ga0451577_0000044_57838_59307 471
365 3300044673 Ga0453683_0000183 Ga0453683_0000183_32004_33473 471
366 3300044712 Ga0453684_0001154 Ga0453684_0001154_23149_24618 471
367 3300044712 Ga0453684_0236899 Ga0453684_0236899_556_2028 471
368 3300045051 Ga0451576_0000047 Ga0451576_0000047_270051_271520 471
369 3300046514 Ga0495618_0032228 Ga0495618_0032228_227_1699 471
370 3300046516 Ga0495628_0025438 Ga0495628_0025438_1687_3159 471
371 3300046517 Ga0495630_0015501 Ga0495630_0015501_1618_3090 471
372 3300046525 Ga0495663_0001443 Ga0495663_0001443_5666_7132 471
373 3300046689 Ga0495613_0071922 Ga0495613_0071922_554_2026 471
374 3300046692 Ga0495671_0018463 Ga0495671_0018463_1317_2783 471
375 3300048926 Ga0496123_0015111 Ga0496123_0015111_2903_4369 471
376 3300049675 Ga0501243_003311 Ga0501243_003311_450_1904 471
377 3300053086 Ga0500578_0000280 Ga0500578_0000280_14931_16391 471
378 3300053088 Ga0500644_0000217 Ga0500644_0000217_18257_19687 471
379 3300053153 Ga0500616_0009404 Ga0500616_0009404_2328_3761 471
380 3300053161 Ga0500634_0017200 Ga0500634_0017200_1932_3362 471
381 3300053177 Ga0500636_0052941 Ga0500636_0052941_833_2263 471
382 3300025272 Ga0209455_1008118 Ga0209455_10081182 472
383 3300031344 Ga0265316_10134734 Ga0265316_101347342 472
384 3300036712 Ga0316584_0080369 Ga0316584_0080369_113_1594 472
385 3300053139 Ga0500568_0003469 Ga0500568_0003469_6465_7898 472
386 3300003323 rootH1_10110668 rootH1_101106686 473
387 3300009148 Ga0105243_10212497 Ga0105243_102124971 473
388 3300045051 Ga0451576_0011780 Ga0451576_0011780_7035_8525 473
389 3300002738 JGI25154J39366_1000817 JGI25154J39366_10008177 474
390 3300002741 JGI25157J39369_1000029 JGI25157J39369_100002969 474
391 3300005329 Ga0070683_100054689 Ga0070683_1000546892 474
392 3300005539 Ga0068853_100111846 Ga0068853_1001118462 474
393 3300005577 Ga0068857_100000097 Ga0068857_10000009710 474
394 3300005614 Ga0068856_100010911 Ga0068856_1000109114 474
395 3300010375 Ga0105239_10008004 Ga0105239_100080047 474
396 3300013105 Ga0157369_10001697 Ga0157369_100016971 474
397 3300025246 Ga0209646_1000111 Ga0209646_1000111109 474
398 3300025250 Ga0209026_1000054 Ga0209026_1000054118 474
399 3300025250 Ga0209026_1000549 Ga0209026_10005498 474
400 3300025253 Ga0209677_100105 Ga0209677_10010540 474
401 3300025256 Ga0209759_1000043 Ga0209759_1000043109 474
402 3300025949 Ga0207667_10093176 Ga0207667_100931762 474
403 3300025981 Ga0207640_10004558 Ga0207640_100045582 474
404 3300026078 Ga0207702_10000376 Ga0207702_1000037636 474
405 3300026116 Ga0207674_10009743 Ga0207674_1000974310 474
406 3300028666 Ga0265336_10000006 Ga0265336_10000006136 474
407 3300029957 Ga0265324_10032195 Ga0265324_100321952 474
408 3300033179 Ga0307507_10000071 Ga0307507_1000007149 474

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02055

Glyco_hydro_30

Glycosyl hydrolase family 30 TIM-barrel domain

119

457

0.94

PF17189

Glyco_hydro_30C

Glycosyl hydrolase family 30 beta sandwich domain

460

520

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wnw-assembly1.cif.gz_B the crystal structure of srfj from salmonella typhimurium 0.9551 24 474
2wnw-assembly1.cif.gz_B the crystal structure of srfj from salmonella typhimurium 0.9467 24 474
2xwd-assembly1.cif.gz_A x-ray structure of acid-beta-glucosidase with 5n,6o-(n'-(n-octyl)imino)nojirimycin in the active site 0.9437 23 472
6q1p-assembly2.cif.gz_B glucocerebrosidase in complex with pharmacological chaperone norimx8 0.942 23 472
6yv3-assembly1.cif.gz_AAA structure of recombinant human beta-glucocerebrosidase in complex with galacto-configured cyclophellitol aziridine inhibitor 0.9417 23 474
ID Description Score Start End Superfamily
af_Q9VCJ4_494_561_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9799 408 472 2.60.40.1180
2wnwB01 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9497 414 474 2.60.40.1180
2wnwB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9455 67 412 3.20.20.80
2wnwB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9428 67 412 3.20.20.80
af_G5ECR8_80_454_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9282 49 411 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7X7WQD0-F1-model_v4 Glycosyl hydrolase family 30 beta sandwich domain-containing protein 0.9922 381 472 GO:0004348
GO:0006680
GO:0016020
AF-A0A2W6RW51-F1-model_v4 Glycosyl hydrolase 0.991 381 472 GO:0004348
GO:0006680
GO:0016020
AF-A0A3C0HBR0-F1-model_v4 Glycosyl hydrolase family 30 beta sandwich domain-containing protein 0.9895 383 474 GO:0004348
GO:0006680
GO:0016020
AF-A0A7W4NNX6-F1-model_v4 deleted 0.9867 51 474
AF-A0A3C1YS78-F1-model_v4 Glycosyl hydrolase 0.9853 25 472 GO:0004348
GO:0006680
GO:0016020

Feature Viewer

pLDDT pTM Quality
91.22 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map