F436372

General Info

Members Datasets Scaffolds Average Seq Length
407 243 814 142

Family's Representative Sequence

Representative Sequence 3300003163|Ga0006759J45824_1119392|Ga0006759J45824_11193921
Length 151
Sequence MPYPEYLIAPMRGEMTDMGARELRTAAAVDDVVKNSQGVVMMVVNSVCGCAAGKARPGIAQALQHKNRPDVLATVFAGADIEATDRARQYFSGYAPSSPSIGLLRDGKLVYMMERSQIETRNAEMIADELVRAFDQYCASTTEEKVGEQAR

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 3.19
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 18.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1119392 3300003163 Unclassified 505
2 MRS1b_contig_5040160 2162886011 Unclassified 833
3 Ga0065714_10034441 3300005288 Unclassified 1133
4 Ga0065714_10123687 3300005288 Bacteria 1319
5 Ga0065712_10025332 3300005290 Bacteria 1426
6 Ga0065712_10068037 3300005290 Bacteria 16419
7 Ga0065712_10154637 3300005290 Unclassified 1342
8 Ga0065715_10001526 3300005293 Bacteria 7560
9 Ga0065707_10007052 3300005295 Bacteria 3978
10 Ga0065707_10133227 3300005295 Bacteria 1861
11 Ga0065707_10225768 3300005295 Unclassified 1182
12 Ga0065707_10495937 3300005295 Bacteria 761
13 Ga0070676_10106969 3300005328 Bacteria 1736
14 Ga0070683_100004153 3300005329 Bacteria 11863
15 Ga0070670_100001952 3300005331 Bacteria 16908
16 Ga0070670_100021791 3300005331 Bacteria 5510
17 Ga0070670_100047094 3300005331 Bacteria 3709
18 Ga0070670_100060957 3300005331 Bacteria 3239
19 Ga0070677_10169335 3300005333 Bacteria 1031
20 Ga0068869_100007679 3300005334 Bacteria 6907
21 Ga0068869_100290687 3300005334 Bacteria 1317
22 Ga0068869_100484616 3300005334 Bacteria 1030
23 Ga0070666_10523283 3300005335 Unclassified 861
24 Ga0070680_100183374 3300005336 Bacteria 1763
25 Ga0070680_100567588 3300005336 Unclassified 973
26 Ga0070682_100100107 3300005337 Bacteria 1912
27 Ga0070682_101312303 3300005337 Unclassified 615
28 Ga0068868_100912234 3300005338 Bacteria 799
29 Ga0068868_101134808 3300005338 Bacteria 720
30 Ga0070660_100015656 3300005339 Bacteria 5481
31 Ga0070689_100207866 3300005340 Bacteria 1601
32 Ga0070689_101423007 3300005340 Bacteria 627
33 Ga0070687_100269137 3300005343 Unclassified 1067
34 Ga0070661_100005421 3300005344 Bacteria 8798
35 Ga0070669_100000886 3300005353 Bacteria 21777
36 Ga0070669_100589048 3300005353 Bacteria 931
37 Ga0070669_101912803 3300005353 Bacteria 518
38 Ga0070675_100447094 3300005354 Unclassified 1159
39 Ga0070675_100891769 3300005354 Bacteria 815
40 Ga0070671_100031933 3300005355 Bacteria 4353
41 Ga0070673_100208016 3300005364 Bacteria 1688
42 Ga0070688_100325534 3300005365 Bacteria 1118
43 Ga0070688_100427916 3300005365 Unclassified 985
44 Ga0070688_100562626 3300005365 Bacteria 868
45 Ga0070688_100878457 3300005365 Bacteria 706
46 Ga0070659_100179997 3300005366 Bacteria 1735
47 Ga0070659_100206715 3300005366 Bacteria 1617
48 Ga0070659_100890679 3300005366 Bacteria 777
49 Ga0070667_100062392 3300005367 Bacteria 3157
50 Ga0070667_100791422 3300005367 Unclassified 880
51 Ga0070709_10096294 3300005434 Bacteria 1962
52 Ga0070714_100015180 3300005435 Bacteria 6194
53 Ga0070711_100502102 3300005439 Bacteria 1000
54 Ga0070705_100578084 3300005440 Bacteria 866
55 Ga0070705_100958823 3300005440 Unclassified 692
56 Ga0070700_100071646 3300005441 Bacteria 2213
57 Ga0070700_101577312 3300005441 Unclassified 560
58 Ga0070700_101664045 3300005441 Bacteria 547
59 Ga0070708_100492684 3300005445 Bacteria 1156
60 Ga0070708_101726046 3300005445 Unclassified 582
61 Ga0070663_100247364 3300005455 Bacteria 1410
62 Ga0070662_100191142 3300005457 Bacteria 1619
63 Ga0070681_10282275 3300005458 Bacteria 1571
64 Ga0070681_10323880 3300005458 Unclassified 1451
65 Ga0068867_100668575 3300005459 Bacteria 913
66 Ga0068867_101477175 3300005459 Bacteria 632
67 Ga0070685_10663864 3300005466 Unclassified 757
68 Ga0070706_100036465 3300005467 Bacteria 4541
69 Ga0070698_100020863 3300005471 Bacteria 6866
70 Ga0070699_100047918 3300005518 Bacteria 3698
71 Ga0070679_101653620 3300005530 Bacteria 588
72 Ga0070684_100002281 3300005535 Bacteria 14131
73 Ga0068853_101198613 3300005539 Unclassified 733
74 Ga0070672_100636098 3300005543 Bacteria 931
75 Ga0070686_100827491 3300005544 Unclassified 748
76 Ga0070696_100070440 3300005546 Unclassified 2460
77 Ga0070696_100882403 3300005546 Bacteria 741
78 Ga0070693_100037390 3300005547 Bacteria 2707
79 Ga0070704_100033327 3300005549 Bacteria 3481
80 Ga0070704_100432707 3300005549 Bacteria 1129
81 Ga0070704_101097483 3300005549 Bacteria 723
82 Ga0070704_101566069 3300005549 Bacteria 607
83 Ga0070704_101984455 3300005549 Bacteria 540
84 Ga0070664_100000148 3300005564 Bacteria 48402
85 Ga0070664_100046006 3300005564 Bacteria 3686
86 Ga0070664_100772585 3300005564 Bacteria 897
87 Ga0070664_101828591 3300005564 Bacteria 576
88 Ga0068857_100008157 3300005577 Bacteria 9043
89 Ga0068857_100089784 3300005577 Bacteria 2750
90 Ga0068857_100173021 3300005577 Unclassified 1963
91 Ga0068857_100638711 3300005577 Bacteria 1008
92 Ga0068854_100324223 3300005578 Bacteria 1253
93 Ga0068854_101152917 3300005578 Bacteria 693
94 Ga0068852_101604265 3300005616 Bacteria 673
95 Ga0068859_100110000 3300005617 Bacteria 2817
96 Ga0068859_100739631 3300005617 Bacteria 1073
97 Ga0068859_101653790 3300005617 Bacteria 707
98 Ga0068864_100204932 3300005618 Unclassified 1814
99 Ga0068861_100135349 3300005719 Bacteria 2004
100 Ga0068863_100680191 3300005841 Bacteria 1022
101 Ga0068863_101728675 3300005841 Bacteria 635
102 Ga0068858_100430149 3300005842 Bacteria 1270
103 Ga0068862_100078583 3300005844 Bacteria 2859
104 Ga0068862_100237046 3300005844 Bacteria 1657
105 Ga0068862_101161590 3300005844 Bacteria 769
106 Ga0070717_11098647 3300006028 Bacteria 724
107 Ga0075368_10015324 3300006042 Bacteria 2843
108 Ga0075368_10220835 3300006042 Unclassified 805
109 Ga0075364_10082029 3300006051 Bacteria 2133
110 Ga0097621_100811891 3300006237 Bacteria 867
111 Ga0068871_100772639 3300006358 Bacteria 884
112 Ga0075428_101216109 3300006844 Bacteria 794
113 Ga0075430_101561968 3300006846 Bacteria 542
114 Ga0075433_10006514 3300006852 Bacteria 9237
115 Ga0075433_10167455 3300006852 Unclassified 1955
116 Ga0075433_10198786 3300006852 Bacteria 1782
117 Ga0075433_10535405 3300006852 Bacteria 1030
118 Ga0075433_10777608 3300006852 Bacteria 837
119 Ga0075434_100005095 3300006871 Bacteria 11930
120 Ga0075434_100380017 3300006871 Unclassified 1433
121 Ga0075434_100862706 3300006871 Bacteria 921
122 Ga0075434_101404264 3300006871 Bacteria 708
123 Ga0075434_101986022 3300006871 Bacteria 587
124 Ga0097620_100110006 3300006931 Bacteria 2817
125 Ga0097620_100739576 3300006931 Bacteria 1073
126 Ga0097620_101654210 3300006931 Bacteria 707
127 Ga0075435_100180887 3300007076 Bacteria 1782
128 Ga0075435_100554598 3300007076 Unclassified 995
129 Ga0075435_100788047 3300007076 Unclassified 827
130 Ga0105240_10128465 3300009093 Unclassified 3043
131 Ga0105240_11934568 3300009093 Bacteria 613
132 Ga0111539_10001302 3300009094 Bacteria 33331
133 Ga0111539_10006177 3300009094 Bacteria 15462
134 Ga0111539_10068036 3300009094 Bacteria 4204
135 Ga0111539_10254072 3300009094 Bacteria 2047
136 Ga0111539_10420343 3300009094 Bacteria 1557
137 Ga0111539_10428796 3300009094 Bacteria 1540
138 Ga0111539_11286058 3300009094 Unclassified 849
139 Ga0111539_12033572 3300009094 Bacteria 666
140 Ga0111539_12583451 3300009094 Bacteria 589
141 Ga0105245_10488238 3300009098 Bacteria 1246
142 Ga0105245_10672837 3300009098 Bacteria 1067
143 Ga0105247_10060335 3300009101 Unclassified 2350
144 Ga0105247_10390623 3300009101 Bacteria 989
145 Ga0114129_10000513 3300009147 Bacteria 47473
146 Ga0105241_10117338 3300009174 Unclassified 2139
147 Ga0105241_10238039 3300009174 Bacteria 1538
148 Ga0105242_10970998 3300009176 Bacteria 855
149 Ga0105248_10020806 3300009177 Bacteria 7268
150 Ga0105248_10024953 3300009177 Bacteria 6644
151 Ga0105248_10300664 3300009177 Bacteria 1807
152 Ga0105237_10131214 3300009545 Unclassified 2500
153 Ga0105249_11372175 3300009553 Bacteria 779
154 Ga0105239_11223828 3300010375 Unclassified 865
155 Ga0105246_10056156 3300011119 Bacteria 2720
156 Ga0105246_10271585 3300011119 Unclassified 1356
157 Ga0157373_10040638 3300013100 Bacteria 3327
158 Ga0157374_10304353 3300013296 Bacteria 1577
159 Ga0157378_10112734 3300013297 Bacteria 2495
160 Ga0157378_11119047 3300013297 Bacteria 825
161 Ga0163162_11357606 3300013306 Unclassified 808
162 Ga0163162_11549101 3300013306 Bacteria 755
163 Ga0157372_10807573 3300013307 Bacteria 1090
164 Ga0157372_11337037 3300013307 Bacteria 827
165 Ga0157372_11435385 3300013307 Unclassified 795
166 Ga0163163_10008515 3300014325 Bacteria 9116
167 Ga0163163_10146702 3300014325 Bacteria 2404
168 Ga0163163_10257021 3300014325 Bacteria 1798
169 Ga0157380_10033669 3300014326 Bacteria 3947
170 Ga0157380_10920096 3300014326 Bacteria 902
171 Ga0157377_10065191 3300014745 Bacteria 2091
172 Ga0157379_11432524 3300014968 Bacteria 670
173 Ga0157376_11039862 3300014969 Bacteria 843
174 Ga0163161_11108292 3300017792 Bacteria 681
175 Ga0206355_1105545 3300020076 Bacteria 762
176 Ga0207697_10023165 3300025315 Bacteria 2542
177 Ga0207710_10043632 3300025900 Bacteria 1995
178 Ga0207710_10198899 3300025900 Bacteria 989
179 Ga0207680_10614573 3300025903 Unclassified 778
180 Ga0207645_10116831 3300025907 Bacteria 1730
181 Ga0207684_10010505 3300025910 Bacteria 8146
182 Ga0207684_10104607 3300025910 Bacteria 2421
183 Ga0207684_10954400 3300025910 Bacteria 719
184 Ga0207654_10474848 3300025911 Bacteria 880
185 Ga0207707_10520534 3300025912 Bacteria 1013
186 Ga0207663_10884891 3300025916 Unclassified 714
187 Ga0207662_10043653 3300025918 Unclassified 2645
188 Ga0207657_10005532 3300025919 Bacteria 13188
189 Ga0207649_10118261 3300025920 Bacteria 1783
190 Ga0207652_10698688 3300025921 Unclassified 905
191 Ga0207646_10905320 3300025922 Bacteria 782
192 Ga0207681_10035436 3300025923 Bacteria 3288
193 Ga0207681_10433226 3300025923 Bacteria 1067
194 Ga0207681_10583061 3300025923 Bacteria 923
195 Ga0207681_10798601 3300025923 Unclassified 788
196 Ga0207681_11500990 3300025923 Bacteria 565
197 Ga0207650_10004825 3300025925 Bacteria 9211
198 Ga0207650_10009464 3300025925 Bacteria 6656
199 Ga0207650_10072939 3300025925 Bacteria 2584
200 Ga0207644_10037409 3300025931 Bacteria 3414
201 Ga0207690_10137843 3300025932 Bacteria 1794
202 Ga0207690_11217937 3300025932 Unclassified 629
203 Ga0207706_10384330 3300025933 Bacteria 1218
204 Ga0207686_10629971 3300025934 Unclassified 847
205 Ga0207686_11119964 3300025934 Bacteria 642
206 Ga0207670_10116235 3300025936 Bacteria 1936
207 Ga0207691_10485283 3300025940 Bacteria 1050
208 Ga0207711_10171823 3300025941 Bacteria 1967
209 Ga0207711_10812513 3300025941 Bacteria 871
210 Ga0207689_10101815 3300025942 Bacteria 2359
211 Ga0207689_10116207 3300025942 Bacteria 2199
212 Ga0207689_10360158 3300025942 Bacteria 1209
213 Ga0207661_10012730 3300025944 Bacteria 6127
214 Ga0207679_10006694 3300025945 Bacteria 7295
215 Ga0207679_10017423 3300025945 Bacteria 4792
216 Ga0207679_10041867 3300025945 Bacteria 3288
217 Ga0207679_11129666 3300025945 Bacteria 719
218 Ga0207651_10345499 3300025960 Bacteria 1251
219 Ga0207712_10169793 3300025961 Bacteria 1704
220 Ga0207712_11733457 3300025961 Bacteria 560
221 Ga0207668_10995271 3300025972 Bacteria 749
222 Ga0207640_10269022 3300025981 Bacteria 1332
223 Ga0207640_10878906 3300025981 Bacteria 782
224 Ga0207658_10219879 3300025986 Bacteria 1597
225 Ga0207658_10612594 3300025986 Bacteria 979
226 Ga0207677_11007680 3300026023 Bacteria 755
227 Ga0207703_10070698 3300026035 Bacteria 2881
228 Ga0207703_10220529 3300026035 Bacteria 1695
229 Ga0207678_10074021 3300026067 Bacteria 2918
230 Ga0207678_10419166 3300026067 Bacteria 1161
231 Ga0207708_10099292 3300026075 Bacteria 2252
232 Ga0207708_10121184 3300026075 Bacteria 2038
233 Ga0207641_10841152 3300026088 Unclassified 909
234 Ga0207648_10633261 3300026089 Bacteria 988
235 Ga0207676_10015324 3300026095 Bacteria 5528
236 Ga0207674_10031049 3300026116 Bacteria 5614
237 Ga0207674_10033079 3300026116 Bacteria 5416
238 Ga0207674_10066002 3300026116 Bacteria 3646
239 Ga0207674_12205880 3300026116 Bacteria 514
240 Ga0207675_100017628 3300026118 Bacteria 6661
241 Ga0207675_100106880 3300026118 Bacteria 2638
242 Ga0207675_101362555 3300026118 Bacteria 730
243 Ga0209970_1026944 3300027614 Bacteria 988
244 Ga0209813_10183718 3300027866 Unclassified 766
245 Ga0207428_10016570 3300027907 Bacteria 6335
246 Ga0207428_10022044 3300027907 Bacteria 5380
247 Ga0207428_10038580 3300027907 Bacteria 3882
248 Ga0207428_10042574 3300027907 Bacteria 3672
249 Ga0207428_10056825 3300027907 Bacteria 3108
250 Ga0207428_10396483 3300027907 Bacteria 1011
251 Ga0268266_10296078 3300028379 Bacteria 1508
252 Ga0268265_10080991 3300028380 Bacteria 2562
253 Ga0268265_10230902 3300028380 Bacteria 1626
254 Ga0268265_10769235 3300028380 Bacteria 936
255 Ga0307515_10309284 3300028794 Bacteria 1257
256 Ga0265330_10008709 3300031235 Bacteria 4864
257 Ga0265330_10345985 3300031235 Bacteria 628
258 Ga0265325_10005934 3300031241 Bacteria 7481
259 Ga0265339_10185946 3300031249 Bacteria 1032
260 Ga0265316_10022185 3300031344 Bacteria 5361
261 Ga0265316_10022272 3300031344 Bacteria 5346
262 Ga0307408_100416926 3300031548 Bacteria 1157
263 Ga0307408_100514182 3300031548 Bacteria 1050
264 Ga0265313_10068502 3300031595 Bacteria 1639
265 Ga0265342_10015367 3300031712 Bacteria 5038
266 Ga0265342_10038053 3300031712 Bacteria 2932
267 Ga0307405_10010426 3300031731 Bacteria 4815
268 Ga0307405_10430043 3300031731 Bacteria 1041
269 Ga0307410_10036084 3300031852 Bacteria 3216
270 Ga0307410_10728822 3300031852 Bacteria 838
271 Ga0307412_10036858 3300031911 Bacteria 3137
272 Ga0307412_10158668 3300031911 Unclassified 1678
273 Ga0307409_100612786 3300031995 Bacteria 1077
274 Ga0307409_101600253 3300031995 Bacteria 680
275 Ga0307416_100008162 3300032002 Bacteria 6729
276 Ga0307416_100368279 3300032002 Bacteria 1462
277 Ga0307416_100436709 3300032002 Unclassified 1358
278 Ga0307416_100458317 3300032002 Unclassified 1329
279 Ga0307416_101276980 3300032002 Unclassified 840
280 Ga0307416_101334532 3300032002 Bacteria 823
281 Ga0307414_10207129 3300032004 Bacteria 1600
282 Ga0307414_10668997 3300032004 Bacteria 937
283 Ga0307411_10103807 3300032005 Bacteria 2017
284 Ga0307415_100006108 3300032126 Bacteria 6460
285 Ga0307415_100417236 3300032126 Bacteria 1151
286 Ga0373923_0704380 3300035111 Bacteria 502
287 Ga0373955_0019570 3300035172 Bacteria 3387
288 Ga0373961_0250512 3300035241 Unclassified 641
289 Ga0373924_0099895 3300035410 Unclassified 1247
290 Ga0373924_0118682 3300035410 Unclassified 1147
291 Ga0373931_0397745 3300035691 Bacteria 872
292 Ga0373933_0153851 3300035724 Unclassified 1458
293 Ga0373933_0256658 3300035724 Unclassified 1126
294 Ga0373933_1191426 3300035724 Unclassified 502
295 Ga0373947_0411183 3300035725 Unclassified 913
296 Ga0373937_0012556 3300036401 Bacteria 7452
297 Ga0373937_0105173 3300036401 Unclassified 2623
298 Ga0395900_0321699 3300037418 Bacteria 1527
299 Ga0451807_0307703 3300041486 Bacteria 870
300 Ga0451851_0976397 3300041507 Bacteria 747
301 Ga0439433_0006830 3300041999 Bacteria 2460
302 Ga0439449_0113966 3300042007 Unclassified 1002
303 Ga0450923_002125 3300042125 Bacteria 2785
304 Ga0439446_0030260 3300042156 Bacteria 1565
305 Ga0439434_0126394 3300042435 Bacteria 837
306 Ga0451577_0348416 3300042876 Bacteria 1343
307 Ga0451577_1906775 3300042876 Unclassified 520
308 Ga0453684_0096499 3300044712 Bacteria 3631
309 Ga0466967_0154636 3300045976 Bacteria 2147
310 Ga0495592_0033103 3300046454 Bacteria 3900
311 Ga0495629_0608428 3300046459 Unclassified 730
312 Ga0495653_0379517 3300046463 Bacteria 903
313 Ga0495582_0737927 3300046473 Unclassified 570
314 Ga0495628_0179855 3300046516 Unclassified 1600
315 Ga0495628_0196861 3300046516 Bacteria 1520
316 Ga0495640_0492716 3300046533 Unclassified 746
317 Ga0495586_0614147 3300046535 Unclassified 628
318 Ga0495645_0002924 3300046543 Bacteria 11586
319 Ga0495635_0498060 3300046663 Unclassified 802
320 Ga0495599_0163366 3300046678 Bacteria 1376
321 Ga0495658_0288641 3300046683 Bacteria 1036
322 Ga0495658_0679772 3300046683 Bacteria 659
323 Ga0495669_0003229 3300046684 Bacteria 6711
324 Ga0495600_0031803 3300046809 Unclassified 3421
325 Ga0495593_0177847 3300047673 Unclassified 1072
326 Ga0496100_0297132 3300048903 Bacteria 1208
327 Ga0496104_0006599 3300048907 Bacteria 10204
328 Ga0496105_0031269 3300048908 Bacteria 4365
329 Ga0496105_0246671 3300048908 Unclassified 1448
330 Ga0496106_0289188 3300048909 Bacteria 1314
331 Ga0496108_0010381 3300048911 Bacteria 7562
332 Ga0496109_0001942 3300048912 Bacteria 17183
333 Ga0496109_1708772 3300048912 Unclassified 563
334 Ga0496110_0025737 3300048913 Bacteria 5030
335 Ga0496111_0086220 3300048914 Bacteria 2297
336 Ga0496112_0006838 3300048915 Bacteria 10052
337 Ga0496113_0289194 3300048916 Bacteria 1311
338 Ga0495682_0211800 3300049460 Bacteria 687
339 Ga0501031_0000904 3300049568 Bacteria 17856
340 Ga0501032_0005473 3300049569 Bacteria 9421
341 Ga0501033_0005808 3300049570 Bacteria 9710
342 Ga0501034_0015188 3300049571 Bacteria 7915
343 Ga0501034_0051415 3300049571 Bacteria 4154
344 Ga0501036_0011426 3300049572 Bacteria 7350
345 Ga0501037_0001478 3300049573 Bacteria 17194
346 Ga0501037_0799980 3300049573 Unclassified 623
347 Ga0501038_0003264 3300049574 Bacteria 15128
348 Ga0501039_0003783 3300049575 Bacteria 11369
349 Ga0501040_0226825 3300049576 Bacteria 1330
350 Ga0501042_0051748 3300049578 Bacteria 2929
351 Ga0501043_0015539 3300049579 Bacteria 5964
352 Ga0501046_0025995 3300049580 Bacteria 4784
353 Ga0501047_0028949 3300049581 Bacteria 5342
354 Ga0501048_0023306 3300049582 Bacteria 4526
355 Ga0501067_0001655 3300049583 Bacteria 12246
356 Ga0501068_0001775 3300049584 Bacteria 11471
357 Ga0501069_0001019 3300049585 Bacteria 13361
358 Ga0501070_0039979 3300049586 Bacteria 3911
359 Ga0501071_0004290 3300049587 Bacteria 9034
360 Ga0501071_0744473 3300049587 Bacteria 755
361 Ga0501072_0155536 3300049588 Bacteria 1823
362 Ga0501073_0005755 3300049589 Bacteria 9268
363 Ga0501073_0471187 3300049589 Bacteria 868
364 Ga0501073_0722894 3300049589 Bacteria 687
365 Ga0501074_0001424 3300049590 Bacteria 15947
366 Ga0501076_0111027 3300049592 Unclassified 2216
367 Ga0501076_0293956 3300049592 Bacteria 1331
368 Ga0501079_0003667 3300049741 Bacteria 11314
369 Ga0501079_1504571 3300049741 Bacteria 529
370 Ga0501080_0046391 3300049742 Bacteria 4045
371 Ga0501081_0366412 3300049743 Bacteria 1063
372 Ga0501279_023896 3300049775 Bacteria 883
373 Ga0501035_0053504 3300049822 Bacteria 3609
374 Ga0501044_0031761 3300049823 Bacteria 5554
375 Ga0501045_0000936 3300049824 Bacteria 19073
376 Ga0501045_0756677 3300049824 Bacteria 716
377 nmdc:mga03683_144030_c1 3300050489 Bacteria 1073
378 nmdc:mga00v17_26524_c1 3300050491 Bacteria 3377
379 nmdc:mga00v17_570793_c1 3300050491 Bacteria 731
380 nmdc:mga06z11_711805_c1 3300050494 Unclassified 612
381 nmdc:mga04h51_211133_c1 3300050495 Unclassified 766
382 nmdc:mga05p37_388_c1 3300050507 Bacteria 39947
383 nmdc:mga09592_811601_c1 3300050508 Bacteria 791
384 nmdc:mga08y16_12049_c1 3300050511 Bacteria 9085
385 nmdc:mga08y16_194544_c1 3300050511 Bacteria 2103
386 nmdc:mga08y16_497720_c1 3300050511 Bacteria 1239
387 nmdc:mga08y16_65145_c1 3300050511 Bacteria 3804
388 nmdc:mga08y16_80704_c1 3300050511 Bacteria 3392
389 nmdc:mga0n895_11104_c1 3300050512 Bacteria 8015
390 nmdc:mga0n895_528566_c1 3300050512 Unclassified 1187
391 nmdc:mga0n895_757323_c1 3300050512 Bacteria 964
392 nmdc:mga0rr50_353660_c1 3300050513 Bacteria 1236
393 nmdc:mga0rr50_864327_c1 3300050513 Unclassified 771
394 nmdc:mga0rr50_96952_c1 3300050513 Bacteria 2308
395 nmdc:mga0a205_37099_c1 3300050515 Bacteria 4686
396 nmdc:mga0a205_422950_c1 3300050515 Bacteria 1194
397 nmdc:mga0a205_5823_c1 3300050515 Bacteria 11110
398 nmdc:mga0a205_636856_c1 3300050515 Bacteria 918
399 nmdc:mga0a205_75970_c1 3300050515 Bacteria 3246
400 Ga0495595_0268876 3300053084 Bacteria 855
401 Ga0495619_0013295 3300053085 Bacteria 5185
402 Ga0495619_0927518 3300053085 Bacteria 585
403 Ga0500641_0050274 3300053096 Unclassified 1712
404 Ga0500599_060207 3300053736 Bacteria 616
405 Ga0501084_0035426 3300054114 Bacteria 4172
406 Ga0501082_0006399 3300060353 Bacteria 10217
407 Ga0501082_0778182 3300060353 Bacteria 837
408 Ga0006759J45824_1119392
409 MRS1b_contig_5040160
410 Ga0065714_10034441
411 Ga0065714_10123687
412 Ga0065712_10025332
413 Ga0065712_10068037
414 Ga0065712_10154637
415 Ga0065715_10001526
416 Ga0065707_10007052
417 Ga0065707_10133227
418 Ga0065707_10225768
419 Ga0065707_10495937
420 Ga0070676_10106969
421 Ga0070683_100004153
422 Ga0070670_100001952
423 Ga0070670_100021791
424 Ga0070670_100047094
425 Ga0070670_100060957
426 Ga0070677_10169335
427 Ga0068869_100007679
428 Ga0068869_100290687
429 Ga0068869_100484616
430 Ga0070666_10523283
431 Ga0070680_100183374
432 Ga0070680_100567588
433 Ga0070682_100100107
434 Ga0070682_101312303
435 Ga0068868_100912234
436 Ga0068868_101134808
437 Ga0070660_100015656
438 Ga0070689_100207866
439 Ga0070689_101423007
440 Ga0070687_100269137
441 Ga0070661_100005421
442 Ga0070669_100000886
443 Ga0070669_100589048
444 Ga0070669_101912803
445 Ga0070675_100447094
446 Ga0070675_100891769
447 Ga0070671_100031933
448 Ga0070673_100208016
449 Ga0070688_100325534
450 Ga0070688_100427916
451 Ga0070688_100562626
452 Ga0070688_100878457
453 Ga0070659_100179997
454 Ga0070659_100206715
455 Ga0070659_100890679
456 Ga0070667_100062392
457 Ga0070667_100791422
458 Ga0070709_10096294
459 Ga0070714_100015180
460 Ga0070711_100502102
461 Ga0070705_100578084
462 Ga0070705_100958823
463 Ga0070700_100071646
464 Ga0070700_101577312
465 Ga0070700_101664045
466 Ga0070708_100492684
467 Ga0070708_101726046
468 Ga0070663_100247364
469 Ga0070662_100191142
470 Ga0070681_10282275
471 Ga0070681_10323880
472 Ga0068867_100668575
473 Ga0068867_101477175
474 Ga0070685_10663864
475 Ga0070706_100036465
476 Ga0070698_100020863
477 Ga0070699_100047918
478 Ga0070679_101653620
479 Ga0070684_100002281
480 Ga0068853_101198613
481 Ga0070672_100636098
482 Ga0070686_100827491
483 Ga0070696_100070440
484 Ga0070696_100882403
485 Ga0070693_100037390
486 Ga0070704_100033327
487 Ga0070704_100432707
488 Ga0070704_101097483
489 Ga0070704_101566069
490 Ga0070704_101984455
491 Ga0070664_100000148
492 Ga0070664_100046006
493 Ga0070664_100772585
494 Ga0070664_101828591
495 Ga0068857_100008157
496 Ga0068857_100089784
497 Ga0068857_100173021
498 Ga0068857_100638711
499 Ga0068854_100324223
500 Ga0068854_101152917
501 Ga0068852_101604265
502 Ga0068859_100110000
503 Ga0068859_100739631
504 Ga0068859_101653790
505 Ga0068864_100204932
506 Ga0068861_100135349
507 Ga0068863_100680191
508 Ga0068863_101728675
509 Ga0068858_100430149
510 Ga0068862_100078583
511 Ga0068862_100237046
512 Ga0068862_101161590
513 Ga0070717_11098647
514 Ga0075368_10015324
515 Ga0075368_10220835
516 Ga0075364_10082029
517 Ga0097621_100811891
518 Ga0068871_100772639
519 Ga0075428_101216109
520 Ga0075430_101561968
521 Ga0075433_10006514
522 Ga0075433_10167455
523 Ga0075433_10198786
524 Ga0075433_10535405
525 Ga0075433_10777608
526 Ga0075434_100005095
527 Ga0075434_100380017
528 Ga0075434_100862706
529 Ga0075434_101404264
530 Ga0075434_101986022
531 Ga0097620_100110006
532 Ga0097620_100739576
533 Ga0097620_101654210
534 Ga0075435_100180887
535 Ga0075435_100554598
536 Ga0075435_100788047
537 Ga0105240_10128465
538 Ga0105240_11934568
539 Ga0111539_10001302
540 Ga0111539_10006177
541 Ga0111539_10068036
542 Ga0111539_10254072
543 Ga0111539_10420343
544 Ga0111539_10428796
545 Ga0111539_11286058
546 Ga0111539_12033572
547 Ga0111539_12583451
548 Ga0105245_10488238
549 Ga0105245_10672837
550 Ga0105247_10060335
551 Ga0105247_10390623
552 Ga0114129_10000513
553 Ga0105241_10117338
554 Ga0105241_10238039
555 Ga0105242_10970998
556 Ga0105248_10020806
557 Ga0105248_10024953
558 Ga0105248_10300664
559 Ga0105237_10131214
560 Ga0105249_11372175
561 Ga0105239_11223828
562 Ga0105246_10056156
563 Ga0105246_10271585
564 Ga0157373_10040638
565 Ga0157374_10304353
566 Ga0157378_10112734
567 Ga0157378_11119047
568 Ga0163162_11357606
569 Ga0163162_11549101
570 Ga0157372_10807573
571 Ga0157372_11337037
572 Ga0157372_11435385
573 Ga0163163_10008515
574 Ga0163163_10146702
575 Ga0163163_10257021
576 Ga0157380_10033669
577 Ga0157380_10920096
578 Ga0157377_10065191
579 Ga0157379_11432524
580 Ga0157376_11039862
581 Ga0163161_11108292
582 Ga0206355_1105545
583 Ga0207697_10023165
584 Ga0207710_10043632
585 Ga0207710_10198899
586 Ga0207680_10614573
587 Ga0207645_10116831
588 Ga0207684_10010505
589 Ga0207684_10104607
590 Ga0207684_10954400
591 Ga0207654_10474848
592 Ga0207707_10520534
593 Ga0207663_10884891
594 Ga0207662_10043653
595 Ga0207657_10005532
596 Ga0207649_10118261
597 Ga0207652_10698688
598 Ga0207646_10905320
599 Ga0207681_10035436
600 Ga0207681_10433226
601 Ga0207681_10583061
602 Ga0207681_10798601
603 Ga0207681_11500990
604 Ga0207650_10004825
605 Ga0207650_10009464
606 Ga0207650_10072939
607 Ga0207644_10037409
608 Ga0207690_10137843
609 Ga0207690_11217937
610 Ga0207706_10384330
611 Ga0207686_10629971
612 Ga0207686_11119964
613 Ga0207670_10116235
614 Ga0207691_10485283
615 Ga0207711_10171823
616 Ga0207711_10812513
617 Ga0207689_10101815
618 Ga0207689_10116207
619 Ga0207689_10360158
620 Ga0207661_10012730
621 Ga0207679_10006694
622 Ga0207679_10017423
623 Ga0207679_10041867
624 Ga0207679_11129666
625 Ga0207651_10345499
626 Ga0207712_10169793
627 Ga0207712_11733457
628 Ga0207668_10995271
629 Ga0207640_10269022
630 Ga0207640_10878906
631 Ga0207658_10219879
632 Ga0207658_10612594
633 Ga0207677_11007680
634 Ga0207703_10070698
635 Ga0207703_10220529
636 Ga0207678_10074021
637 Ga0207678_10419166
638 Ga0207708_10099292
639 Ga0207708_10121184
640 Ga0207641_10841152
641 Ga0207648_10633261
642 Ga0207676_10015324
643 Ga0207674_10031049
644 Ga0207674_10033079
645 Ga0207674_10066002
646 Ga0207674_12205880
647 Ga0207675_100017628
648 Ga0207675_100106880
649 Ga0207675_101362555
650 Ga0209970_1026944
651 Ga0209813_10183718
652 Ga0207428_10016570
653 Ga0207428_10022044
654 Ga0207428_10038580
655 Ga0207428_10042574
656 Ga0207428_10056825
657 Ga0207428_10396483
658 Ga0268266_10296078
659 Ga0268265_10080991
660 Ga0268265_10230902
661 Ga0268265_10769235
662 Ga0307515_10309284
663 Ga0265330_10008709
664 Ga0265330_10345985
665 Ga0265325_10005934
666 Ga0265339_10185946
667 Ga0265316_10022185
668 Ga0265316_10022272
669 Ga0307408_100416926
670 Ga0307408_100514182
671 Ga0265313_10068502
672 Ga0265342_10015367
673 Ga0265342_10038053
674 Ga0307405_10010426
675 Ga0307405_10430043
676 Ga0307410_10036084
677 Ga0307410_10728822
678 Ga0307412_10036858
679 Ga0307412_10158668
680 Ga0307409_100612786
681 Ga0307409_101600253
682 Ga0307416_100008162
683 Ga0307416_100368279
684 Ga0307416_100436709
685 Ga0307416_100458317
686 Ga0307416_101276980
687 Ga0307416_101334532
688 Ga0307414_10207129
689 Ga0307414_10668997
690 Ga0307411_10103807
691 Ga0307415_100006108
692 Ga0307415_100417236
693 Ga0373923_0704380
694 Ga0373955_0019570
695 Ga0373961_0250512
696 Ga0373924_0099895
697 Ga0373924_0118682
698 Ga0373931_0397745
699 Ga0373933_0153851
700 Ga0373933_0256658
701 Ga0373933_1191426
702 Ga0373947_0411183
703 Ga0373937_0012556
704 Ga0373937_0105173
705 Ga0395900_0321699
706 Ga0451807_0307703
707 Ga0451851_0976397
708 Ga0439433_0006830
709 Ga0439449_0113966
710 Ga0450923_002125
711 Ga0439446_0030260
712 Ga0439434_0126394
713 Ga0451577_0348416
714 Ga0451577_1906775
715 Ga0453684_0096499
716 Ga0466967_0154636
717 Ga0495592_0033103
718 Ga0495629_0608428
719 Ga0495653_0379517
720 Ga0495582_0737927
721 Ga0495628_0179855
722 Ga0495628_0196861
723 Ga0495640_0492716
724 Ga0495586_0614147
725 Ga0495645_0002924
726 Ga0495635_0498060
727 Ga0495599_0163366
728 Ga0495658_0288641
729 Ga0495658_0679772
730 Ga0495669_0003229
731 Ga0495600_0031803
732 Ga0495593_0177847
733 Ga0496100_0297132
734 Ga0496104_0006599
735 Ga0496105_0031269
736 Ga0496105_0246671
737 Ga0496106_0289188
738 Ga0496108_0010381
739 Ga0496109_0001942
740 Ga0496109_1708772
741 Ga0496110_0025737
742 Ga0496111_0086220
743 Ga0496112_0006838
744 Ga0496113_0289194
745 Ga0495682_0211800
746 Ga0501031_0000904
747 Ga0501032_0005473
748 Ga0501033_0005808
749 Ga0501034_0015188
750 Ga0501034_0051415
751 Ga0501036_0011426
752 Ga0501037_0001478
753 Ga0501037_0799980
754 Ga0501038_0003264
755 Ga0501039_0003783
756 Ga0501040_0226825
757 Ga0501042_0051748
758 Ga0501043_0015539
759 Ga0501046_0025995
760 Ga0501047_0028949
761 Ga0501048_0023306
762 Ga0501067_0001655
763 Ga0501068_0001775
764 Ga0501069_0001019
765 Ga0501070_0039979
766 Ga0501071_0004290
767 Ga0501071_0744473
768 Ga0501072_0155536
769 Ga0501073_0005755
770 Ga0501073_0471187
771 Ga0501073_0722894
772 Ga0501074_0001424
773 Ga0501076_0111027
774 Ga0501076_0293956
775 Ga0501079_0003667
776 Ga0501079_1504571
777 Ga0501080_0046391
778 Ga0501081_0366412
779 Ga0501279_023896
780 Ga0501035_0053504
781 Ga0501044_0031761
782 Ga0501045_0000936
783 Ga0501045_0756677
784 nmdc:mga03683_144030_c1
785 nmdc:mga00v17_26524_c1
786 nmdc:mga00v17_570793_c1
787 nmdc:mga06z11_711805_c1
788 nmdc:mga04h51_211133_c1
789 nmdc:mga05p37_388_c1
790 nmdc:mga09592_811601_c1
791 nmdc:mga08y16_12049_c1
792 nmdc:mga08y16_194544_c1
793 nmdc:mga08y16_497720_c1
794 nmdc:mga08y16_65145_c1
795 nmdc:mga08y16_80704_c1
796 nmdc:mga0n895_11104_c1
797 nmdc:mga0n895_528566_c1
798 nmdc:mga0n895_757323_c1
799 nmdc:mga0rr50_353660_c1
800 nmdc:mga0rr50_864327_c1
801 nmdc:mga0rr50_96952_c1
802 nmdc:mga0a205_37099_c1
803 nmdc:mga0a205_422950_c1
804 nmdc:mga0a205_5823_c1
805 nmdc:mga0a205_636856_c1
806 nmdc:mga0a205_75970_c1
807 Ga0495595_0268876
808 Ga0495619_0013295
809 Ga0495619_0927518
810 Ga0500641_0050274
811 Ga0500599_060207
812 Ga0501084_0035426
813 Ga0501082_0006399
814 Ga0501082_0778182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06491

Disulph_isomer

Disulphide isomerase

3

138

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9565 5 138
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9439 4 139
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9243 4 139
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.8863 5 138
2h70-assembly2.cif.gz_B crystal structure of thioredoxin mutant d9e in hexagonal (p61) space group 0.8049 20 139
ID Description Score Start End Superfamily
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9637 21 138 3.40.30.10
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9479 21 138 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9299 21 138 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9008 21 138 3.40.30.10
2oe3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.798 20 137 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0FNH4-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9863 7 139
AF-A0A2V8M9H3-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9815 1 141
AF-A0A2V8SW75-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9809 16 138
AF-A0A838GTM2-F1-model_v4 deleted 0.9805 1 143
AF-F9YR41-F1-model_v4 UPF0403 protein 0.9797 3 139

Map