F436368

General Info

Members Datasets Scaffolds Average Seq Length
407 247 400 167

Family's Representative Sequence

Representative Sequence 3300002076|JGI24749J21850_1000015|JGI24749J21850_100001521
Length 190
Sequence VLANIASLSRRSVLLGFIMTRKASFPPVAGPDTRLLLLGSLPGEASLRAGRYYAHPQNQFWRLIGAVIGREDLHALDYAARLAALEAAGVGLWDVVADAVRAGSLDGAIRDHRPNDLVALIGTLPELRAIGFNGATAARIGRKMVGQCDGLTLVDLPSSSPAHTIAYAQKRGSWLMLRHFLPSDGKSVRP

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
236 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
237 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.92
Nodule 0.25
Rhizoplane 3.44
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c001916 3300000041 Bacteria 1995
2 JGI24740J21852_10000334 3300001979 Bacteria 19929
3 JGI24737J22298_10006892 3300001990 Bacteria 3856
4 JGI24749J21850_1000015 3300002076 Bacteria 34487
5 JGI24742J22300_10031237 3300002244 Bacteria 931
6 JGI24751J29686_10000256 3300002459 Bacteria 20791
7 JGI25153J46596_10000152 3300003215 Bacteria 70039
8 JGI25153J46596_10021472 3300003215 Bacteria 2405
9 Ga0055525_1000035 3300003759 Bacteria 300887
10 Ga0055529_1000088 3300003763 Bacteria 139031
11 Ga0055537_1002583 3300003773 Bacteria 5940
12 Ga0055524_1000081 3300003775 Bacteria 119940
13 Ga0055530_10000194 3300003791 Bacteria 54519
14 Ga0055531_10000019 3300003794 Bacteria 170825
15 Ga0055531_10005572 3300003794 Bacteria 7345
16 Ga0055531_10010612 3300003794 Bacteria 4553
17 Ga0055531_10073502 3300003794 Bacteria 779
18 Ga0065165_1003382 3300005262 Bacteria 11280
19 Ga0065165_1013767 3300005262 Bacteria 3187
20 Ga0065165_1046024 3300005262 Bacteria 1267
21 Ga0065707_10085225 3300005295 Bacteria 6336
22 Ga0065707_10085715 3300005295 Bacteria 5938
23 Ga0065707_10256483 3300005295 Bacteria 1110
24 Ga0070658_10013483 3300005327 Bacteria 6559
25 Ga0070670_100000028 3300005331 Bacteria 184816
26 Ga0070670_100000973 3300005331 Bacteria 22431
27 Ga0070670_100032665 3300005331 Bacteria 4483
28 Ga0070670_100159338 3300005331 Bacteria 1956
29 Ga0068869_100530536 3300005334 Bacteria 986
30 Ga0070666_10059094 3300005335 Bacteria 2593
31 Ga0070692_10003352 3300005345 Bacteria 6484
32 Ga0070668_100000105 3300005347 Bacteria 51899
33 Ga0070668_100235495 3300005347 Bacteria 1515
34 Ga0070669_100000005 3300005353 Bacteria 309134
35 Ga0070671_100019275 3300005355 Bacteria 5549
36 Ga0070674_100015961 3300005356 Bacteria 4701
37 Ga0070667_100000036 3300005367 Bacteria 172536
38 Ga0070667_100000071 3300005367 Bacteria 125713
39 Ga0070667_100000733 3300005367 Bacteria 31433
40 Ga0070678_100055494 3300005456 Bacteria 2892
41 Ga0070678_100130868 3300005456 Bacteria 1993
42 Ga0070662_100395094 3300005457 Bacteria 1140
43 Ga0070672_100022638 3300005543 Bacteria 4620
44 Ga0068857_100046541 3300005577 Bacteria 3850
45 Ga0068854_100057210 3300005578 Bacteria 2812
46 Ga0068859_100003554 3300005617 Bacteria 15881
47 Ga0068859_100016751 3300005617 Bacteria 7359
48 Ga0068859_100545816 3300005617 Bacteria 1254
49 Ga0068864_100000049 3300005618 Bacteria 143621
50 Ga0068864_100001349 3300005618 Bacteria 20418
51 Ga0068861_100000089 3300005719 Bacteria 44335
52 Ga0068861_100010921 3300005719 Bacteria 6310
53 Ga0068861_100030218 3300005719 Bacteria 3969
54 Ga0068863_100003010 3300005841 Bacteria 16656
55 Ga0068863_100006355 3300005841 Bacteria 11588
56 Ga0068863_100007160 3300005841 Bacteria 10944
57 Ga0068863_100101403 3300005841 Bacteria 2736
58 Ga0068858_100000410 3300005842 Bacteria 44537
59 Ga0068860_100000049 3300005843 Bacteria 208782
60 Ga0068860_100000063 3300005843 Bacteria 189519
61 Ga0068860_100820040 3300005843 Bacteria 944
62 Ga0068862_100000005 3300005844 Bacteria 350713
63 Ga0068862_100000134 3300005844 Bacteria 85840
64 Ga0081539_10059802 3300005985 Bacteria 2095
65 Ga0075368_10000112 3300006042 Bacteria 21160
66 Ga0075363_100012861 3300006048 Bacteria 4042
67 Ga0075364_10014899 3300006051 Bacteria 4812
68 Ga0075362_10000129 3300006177 Bacteria 20881
69 Ga0075367_10010792 3300006178 Bacteria 4812
70 Ga0075369_10064545 3300006186 Bacteria 1604
71 Ga0075366_10053009 3300006195 Bacteria 2409
72 Ga0075366_10169431 3300006195 Bacteria 1325
73 Ga0075370_10162718 3300006353 Bacteria 1310
74 Ga0097620_100003554 3300006931 Bacteria 15881
75 Ga0097620_100016751 3300006931 Bacteria 7359
76 Ga0097620_100545856 3300006931 Bacteria 1254
77 Ga0079104_1045457 3300006946 Bacteria 1002
78 Ga0105243_10000091 3300009148 Bacteria 102081
79 Ga0105241_10004776 3300009174 Bacteria 9979
80 Ga0105248_10000218 3300009177 Bacteria 66074
81 Ga0105248_10054427 3300009177 Bacteria 4487
82 Ga0105248_10769552 3300009177 Bacteria 1086
83 Ga0105237_10015289 3300009545 Bacteria 7994
84 Ga0105238_10187384 3300009551 Bacteria 2045
85 Ga0105249_10532959 3300009553 Bacteria 1223
86 Ga0105249_10552768 3300009553 Bacteria 1202
87 Ga0157326_1000122 3300012513 Bacteria 8222
88 Ga0157326_1021543 3300012513 Bacteria 799
89 Ga0157369_10119260 3300013105 Bacteria 2800
90 Ga0157369_10893788 3300013105 Bacteria 911
91 Ga0157374_10301858 3300013296 Bacteria 1584
92 Ga0163162_10531707 3300013306 Bacteria 1305
93 Ga0157375_10329308 3300013308 Bacteria 1692
94 Ga0163163_10071416 3300014325 Bacteria 3459
95 Ga0157380_10000023 3300014326 Bacteria 113686
96 Ga0157380_10778616 3300014326 Bacteria 971
97 Ga0213872_10000210 3300021361 Bacteria 51803
98 Ga0213876_10089950 3300021384 Bacteria 1626
99 Ga0209563_100047 3300025230 Bacteria 366620
100 Ga0207425_1017952 3300025245 Bacteria 1543
101 Ga0209677_105356 3300025253 Bacteria 3373
102 Ga0209148_1000017 3300025254 Bacteria 787064
103 Ga0209565_1000012 3300025263 Bacteria 606500
104 Ga0209455_1000005 3300025272 Bacteria 1416756
105 Ga0209673_1002896 3300025273 Bacteria 10880
106 Ga0209675_1006102 3300025291 Bacteria 4908
107 Ga0209564_1066209 3300025295 Bacteria 777
108 Ga0209758_1000035 3300025297 Bacteria 448190
109 Ga0209758_1016236 3300025297 Bacteria 3795
110 Ga0209050_1000010 3300025298 Bacteria 980454
111 Ga0209256_1000012 3300025299 Bacteria 790371
112 Ga0209257_1000009 3300025304 Bacteria 1205047
113 Ga0209257_1007567 3300025304 Bacteria 6511
114 Ga0209257_1020250 3300025304 Bacteria 2467
115 Ga0207688_10037332 3300025901 Bacteria 2694
116 Ga0207680_10044070 3300025903 Bacteria 2621
117 Ga0207647_10003893 3300025904 Bacteria 11150
118 Ga0207705_10000557 3300025909 Bacteria 31254
119 Ga0207654_10000284 3300025911 Bacteria 30901
120 Ga0207657_10659412 3300025919 Bacteria 814
121 Ga0207681_10000003 3300025923 Bacteria 713245
122 Ga0207694_10223355 3300025924 Bacteria 1537
123 Ga0207650_10000012 3300025925 Bacteria 437889
124 Ga0207650_10002528 3300025925 Bacteria 12692
125 Ga0207644_10000443 3300025931 Bacteria 26768
126 Ga0207706_10030167 3300025933 Bacteria 4838
127 Ga0207709_10000018 3300025935 Bacteria 431545
128 Ga0207669_10000084 3300025937 Bacteria 47546
129 Ga0207704_10074203 3300025938 Bacteria 2170
130 Ga0207691_10045286 3300025940 Bacteria 4045
131 Ga0207711_10000706 3300025941 Bacteria 32854
132 Ga0207711_10004455 3300025941 Bacteria 11940
133 Ga0207667_10000004 3300025949 Bacteria 737718
134 Ga0207712_10499550 3300025961 Bacteria 1039
135 Ga0207712_10560978 3300025961 Bacteria 983
136 Ga0207668_10000011 3300025972 Bacteria 184484
137 Ga0207668_10008351 3300025972 Bacteria 6167
138 Ga0207640_10008751 3300025981 Bacteria 5633
139 Ga0207658_10000014 3300025986 Bacteria 218248
140 Ga0207658_10000083 3300025986 Bacteria 104502
141 Ga0207658_10000617 3300025986 Bacteria 31548
142 Ga0207703_10000402 3300026035 Bacteria 46561
143 Ga0207639_10002341 3300026041 Bacteria 12731
144 Ga0207702_10000708 3300026078 Bacteria 35874
145 Ga0207641_10000477 3300026088 Bacteria 45337
146 Ga0207641_10001682 3300026088 Bacteria 21512
147 Ga0207641_10002219 3300026088 Bacteria 18214
148 Ga0207641_10158730 3300026088 Bacteria 2054
149 Ga0207676_10000009 3300026095 Bacteria 545256
150 Ga0207676_10000759 3300026095 Bacteria 25256
151 Ga0207674_10715297 3300026116 Bacteria 967
152 Ga0207675_100000264 3300026118 Bacteria 49823
153 Ga0207675_100010398 3300026118 Bacteria 8720
154 Ga0207675_100050515 3300026118 Bacteria 3880
155 Ga0207683_10019950 3300026121 Bacteria 5727
156 Ga0207683_10067481 3300026121 Bacteria 3155
157 Ga0207698_10023162 3300026142 Bacteria 4333
158 Ga0207698_10268620 3300026142 Bacteria 1571
159 Ga0207698_11142012 3300026142 Unclassified 792
160 Ga0209813_10001612 3300027866 Bacteria 5084
161 Ga0268266_10689340 3300028379 Bacteria 984
162 Ga0268265_10000001 3300028380 Bacteria 1230727
163 Ga0268265_10000228 3300028380 Bacteria 64301
164 Ga0268264_10000083 3300028381 Bacteria 245366
165 Ga0268264_10000121 3300028381 Bacteria 190368
166 Ga0268264_10735847 3300028381 Bacteria 982
167 Ga0314311_1094399 3300030733 Bacteria 1455
168 Ga0307408_100046760 3300031548 Bacteria 3096
169 Ga0307408_100095912 3300031548 Bacteria 2249
170 Ga0307408_100159337 3300031548 Bacteria 1791
171 Ga0307408_100949806 3300031548 Bacteria 790
172 Ga0307408_101490647 3300031548 Bacteria 639
173 Ga0307405_10014495 3300031731 Bacteria 4240
174 Ga0307405_10200961 3300031731 Bacteria 1447
175 Ga0307405_10319427 3300031731 Bacteria 1185
176 Ga0307405_10801477 3300031731 Bacteria 789
177 Ga0307413_10022613 3300031824 Bacteria 3392
178 Ga0307413_10177513 3300031824 Bacteria 1514
179 Ga0307413_10738613 3300031824 Bacteria 821
180 Ga0307410_10023755 3300031852 Bacteria 3818
181 Ga0307410_10043516 3300031852 Bacteria 2976
182 Ga0307410_10085456 3300031852 Bacteria 2226
183 Ga0307410_10112526 3300031852 Bacteria 1971
184 Ga0307410_10147382 3300031852 Bacteria 1748
185 Ga0307410_10369948 3300031852 Bacteria 1150
186 Ga0307410_10598500 3300031852 Bacteria 919
187 Ga0307410_10841976 3300031852 Bacteria 782
188 Ga0307410_11234480 3300031852 Bacteria 652
189 Ga0307406_10082007 3300031901 Bacteria 2146
190 Ga0307406_11000958 3300031901 Bacteria 717
191 Ga0307407_10024144 3300031903 Bacteria 3183
192 Ga0307407_10438538 3300031903 Bacteria 945
193 Ga0307407_10510821 3300031903 Bacteria 882
194 Ga0307412_10014022 3300031911 Bacteria 4719
195 Ga0307412_10046709 3300031911 Bacteria 2839
196 Ga0307412_10053354 3300031911 Bacteria 2679
197 Ga0307412_10071169 3300031911 Bacteria 2373
198 Ga0307412_10090674 3300031911 Bacteria 2137
199 Ga0307412_10181247 3300031911 Bacteria 1584
200 Ga0307412_10605902 3300031911 Bacteria 928
201 Ga0307409_100050592 3300031995 Bacteria 3174
202 Ga0307409_100143907 3300031995 Bacteria 2058
203 Ga0307409_100277403 3300031995 Bacteria 1547
204 Ga0307409_100363184 3300031995 Bacteria 1370
205 Ga0307416_100133908 3300032002 Bacteria 2237
206 Ga0307416_100140917 3300032002 Bacteria 2191
207 Ga0307416_101013627 3300032002 Bacteria 934
208 Ga0307416_102346406 3300032002 Bacteria 633
209 Ga0307414_10067484 3300032004 Bacteria 2562
210 Ga0307414_10070490 3300032004 Bacteria 2517
211 Ga0307414_10088216 3300032004 Bacteria 2295
212 Ga0307414_10089066 3300032004 Bacteria 2286
213 Ga0307414_10223073 3300032004 Bacteria 1548
214 Ga0307414_10246364 3300032004 Bacteria 1482
215 Ga0307414_10467618 3300032004 Bacteria 1109
216 Ga0307414_10931129 3300032004 Bacteria 798
217 Ga0307411_10012228 3300032005 Bacteria 4672
218 Ga0307411_10021320 3300032005 Bacteria 3788
219 Ga0307411_10071601 3300032005 Bacteria 2350
220 Ga0307411_10120409 3300032005 Bacteria 1897
221 Ga0307411_10125884 3300032005 Bacteria 1863
222 Ga0307411_10339911 3300032005 Bacteria 1219
223 Ga0307415_100085908 3300032126 Bacteria 2262
224 Ga0307415_100103205 3300032126 Bacteria 2097
225 Ga0307415_100141762 3300032126 Bacteria 1837
226 Ga0373942_0057086 3300035207 Bacteria 1110
227 Ga0373931_0047717 3300035691 Bacteria 2267
228 Ga0395900_0111247 3300037418 Bacteria 2813
229 Ga0395905_0265064 3300037471 Bacteria 1603
230 Ga0395905_0522883 3300037471 Bacteria 1087
231 Ga0395901_0019077 3300038443 Bacteria 7012
232 Ga0436365_0491674 3300039437 Bacteria 3353
233 Ga0436361_0328227 3300039447 Bacteria 29208
234 Ga0436363_1117181 3300039450 Bacteria 675
235 Ga0439436_0018042 3300041404 Bacteria 2111
236 Ga0439461_0003640 3300041410 Bacteria 2542
237 Ga0439461_0013996 3300041410 Bacteria 1519
238 Ga0439465_0000245 3300041413 Bacteria 14910
239 Ga0439465_0007093 3300041413 Bacteria 3561
240 Ga0451793_0611042 3300041452 Bacteria 587
241 Ga0451795_1206806 3300041456 Bacteria 811
242 Ga0451800_0623530 3300041459 Bacteria 1582
243 Ga0451807_1240922 3300041486 Bacteria 1602
244 Ga0451807_2006468 3300041486 Bacteria 668
245 Ga0451841_0940740 3300041498 Bacteria 550
246 Ga0451849_0730787 3300041505 Bacteria 571
247 Ga0451853_2464682 3300041512 Bacteria 606
248 Ga0439431_0001431 3300041997 Bacteria 5268
249 Ga0439431_0008854 3300041997 Bacteria 2268
250 Ga0439431_0048035 3300041997 Bacteria 1101
251 Ga0439442_016746 3300042002 Bacteria 1512
252 Ga0439445_0002310 3300042004 Bacteria 4229
253 Ga0439445_0004803 3300042004 Bacteria 3066
254 Ga0439432_005603 3300042006 Bacteria 4513
255 Ga0439432_005726 3300042006 Bacteria 4464
256 Ga0439449_0216587 3300042007 Bacteria 718
257 Ga0439452_027518 3300042010 Bacteria 1427
258 Ga0439457_030980 3300042014 Bacteria 1186
259 Ga0439462_0000928 3300042015 Bacteria 6204
260 Ga0439446_0007255 3300042156 Bacteria 2911
261 Ga0450909_015336 3300042185 Bacteria 1131
262 Ga0439434_0000087 3300042435 Bacteria 23113
263 Ga0451577_1201554 3300042876 Unclassified 676
264 Ga0466970_0511076 3300044765 Unclassified 692
265 Ga0466970_0649785 3300044765 Bacteria 613
266 Ga0466960_0579496 3300044901 Unclassified 664
267 Ga0495627_016547 3300046453 Bacteria 2523
268 Ga0495638_0142770 3300046460 Bacteria 1395
269 Ga0495638_0302571 3300046460 Bacteria 861
270 Ga0495662_0096830 3300046476 Bacteria 1442
271 Ga0495584_0000011 3300046491 Bacteria 208322
272 Ga0495584_0005889 3300046491 Bacteria 6461
273 Ga0495584_0041433 3300046491 Bacteria 2325
274 Ga0495585_0029012 3300046492 Bacteria 3153
275 Ga0495596_0173813 3300046500 Bacteria 837
276 Ga0495607_0247467 3300046501 Bacteria 860
277 Ga0495583_0002700 3300046506 Bacteria 14741
278 Ga0495583_0003092 3300046506 Bacteria 13172
279 Ga0495583_0012264 3300046506 Bacteria 4863
280 Ga0495606_0000795 3300046507 Bacteria 48219
281 Ga0495606_0019195 3300046507 Bacteria 5097
282 Ga0495606_0067812 3300046507 Bacteria 2258
283 Ga0495610_0153394 3300046512 Bacteria 980
284 Ga0495631_0019708 3300046518 Bacteria 3162
285 Ga0495631_0061329 3300046518 Bacteria 1631
286 Ga0495637_0008333 3300046520 Bacteria 5097
287 Ga0495643_0007276 3300046522 Bacteria 7155
288 Ga0495643_0028191 3300046522 Bacteria 3151
289 Ga0495643_0041518 3300046522 Bacteria 2507
290 Ga0495643_0047111 3300046522 Bacteria 2335
291 Ga0495648_0000537 3300046524 Bacteria 40955
292 Ga0495663_0027487 3300046525 Bacteria 1670
293 Ga0495663_0060725 3300046525 Bacteria 1188
294 Ga0495663_0118864 3300046525 Bacteria 883
295 Ga0495622_0027722 3300046557 Bacteria 2643
296 Ga0495633_0000321 3300046558 Bacteria 54191
297 Ga0495633_0001403 3300046558 Bacteria 18789
298 Ga0495633_0032774 3300046558 Bacteria 2508
299 Ga0495668_0000090 3300046616 Bacteria 144763
300 Ga0495668_0077223 3300046616 Bacteria 1828
301 Ga0495668_0251753 3300046616 Bacteria 967
302 Ga0495611_0007772 3300046648 Bacteria 4554
303 Ga0495611_0048464 3300046648 Bacteria 1910
304 Ga0495611_0198177 3300046648 Bacteria 937
305 Ga0495625_0004391 3300046660 Bacteria 13380
306 Ga0495625_0051483 3300046660 Bacteria 2952
307 Ga0495625_0149411 3300046660 Bacteria 1571
308 Ga0495625_0276944 3300046660 Bacteria 1081
309 Ga0495659_0055822 3300046664 Bacteria 1448
310 Ga0495623_0257815 3300046679 Bacteria 978
311 Ga0495669_0000262 3300046684 Bacteria 30336
312 Ga0495669_0082585 3300046684 Bacteria 1476
313 Ga0495613_0486848 3300046689 Bacteria 832
314 Ga0495670_0000005 3300046691 Bacteria 289725
315 Ga0495670_0067053 3300046691 Bacteria 1811
316 Ga0495670_0111415 3300046691 Bacteria 1416
317 Ga0495670_0514726 3300046691 Bacteria 650
318 Ga0495649_0024025 3300046694 Bacteria 3402
319 Ga0495649_0354262 3300046694 Bacteria 741
320 Ga0495600_0001054 3300046809 Bacteria 14939
321 Ga0495660_0022436 3300046810 Bacteria 3605
322 Ga0495660_0160252 3300046810 Bacteria 1104
323 Ga0495683_0009847 3300047323 Bacteria 5080
324 Ga0495683_0098261 3300047323 Bacteria 1410
325 Ga0495687_000234 3300047443 Bacteria 76988
326 Ga0495687_000402 3300047443 Bacteria 53513
327 Ga0495677_0212391 3300047445 Bacteria 753
328 Ga0495673_0259942 3300047469 Bacteria 632
329 Ga0495681_0017919 3300047470 Bacteria 3918
330 Ga0495681_0173952 3300047470 Bacteria 889
331 Ga0496102_0000125 3300048905 Bacteria 109075
332 Ga0496102_0635526 3300048905 Bacteria 991
333 Ga0496103_0002012 3300048906 Bacteria 13099
334 Ga0496104_0018691 3300048907 Bacteria 6327
335 Ga0496105_0001064 3300048908 Bacteria 19031
336 Ga0496110_0003258 3300048913 Bacteria 12376
337 Ga0496113_0010216 3300048916 Bacteria 6198
338 Ga0496114_0044047 3300048917 Bacteria 3701
339 Ga0496115_0000291 3300048918 Bacteria 43391
340 Ga0496116_0022951 3300048919 Bacteria 4658
341 Ga0496117_0000714 3300048920 Bacteria 52535
342 Ga0496118_0000701 3300048921 Bacteria 54243
343 Ga0496119_0071776 3300048922 Bacteria 2025
344 Ga0496120_0043680 3300048923 Bacteria 2609
345 Ga0496121_0000296 3300048924 Bacteria 103215
346 Ga0496121_0001032 3300048924 Bacteria 49662
347 Ga0496122_0013462 3300048925 Bacteria 8004
348 Ga0496123_0016928 3300048926 Bacteria 5890
349 Ga0496124_0000666 3300048927 Bacteria 56496
350 Ga0496125_0000945 3300048928 Bacteria 45641
351 Ga0496125_0074271 3300048928 Bacteria 2637
352 Ga0496125_0100713 3300048928 Bacteria 2129
353 Ga0496126_0001123 3300048929 Bacteria 44806
354 Ga0496126_0120312 3300048929 Bacteria 2278
355 Ga0501032_0017029 3300049569 Bacteria 5105
356 Ga0501046_0076878 3300049580 Bacteria 2585
357 Ga0501047_0000938 3300049581 Bacteria 29563
358 Ga0501048_0055567 3300049582 Bacteria 2810
359 Ga0501249_000113 3300049679 Bacteria 24903
360 Ga0501249_031970 3300049679 Bacteria 1176
361 Ga0501035_0219184 3300049822 Bacteria 1625
362 Ga0501204_011050 3300049850 Bacteria 1068
363 nmdc:mga03683_344_c1 3300050489 Bacteria 13557
364 nmdc:mga03n38_111702_c1 3300050490 Bacteria 1332
365 nmdc:mga00v17_138836_c1 3300050491 Bacteria 1557
366 nmdc:mga00v17_3742_c1 3300050491 Bacteria 7856
367 nmdc:mga0k408_184888_c1 3300050493 Bacteria 1243
368 nmdc:mga0k408_38528_c1 3300050493 Bacteria 2743
369 nmdc:mga0k408_68853_c1 3300050493 Bacteria 1206
370 nmdc:mga06z11_303042_c1 3300050494 Bacteria 950
371 nmdc:mga06z11_84_c1 3300050494 Bacteria 40055
372 nmdc:mga04h51_230529_c1 3300050495 Bacteria 737
373 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
374 Ga0500610_0001715 3300053079 Bacteria 7666
375 Ga0500643_001850 3300053087 Bacteria 11549
376 Ga0500643_036236 3300053087 Bacteria 1474
377 Ga0500643_078225 3300053087 Bacteria 911
378 Ga0500583_0025168 3300053092 Bacteria 2538
379 Ga0500566_0000728 3300053094 Bacteria 18489
380 Ga0500592_001140 3300053116 Bacteria 4325
381 Ga0500595_000411 3300053119 Bacteria 27292
382 Ga0500595_002079 3300053119 Bacteria 10237
383 Ga0500597_005354 3300053120 Bacteria 4125
384 Ga0500607_329061 3300053121 Bacteria 543
385 Ga0500626_119358 3300053128 Bacteria 1130
386 Ga0500642_0000866 3300053130 Bacteria 8792
387 Ga0500658_0015622 3300053134 Bacteria 2820
388 Ga0500658_0060554 3300053134 Bacteria 1572
389 Ga0500568_0001399 3300053139 Bacteria 15649
390 Ga0500604_0019964 3300053151 Bacteria 1881
391 Ga0500624_000032 3300053157 Bacteria 104403
392 Ga0500636_0104279 3300053177 Bacteria 1608
393 Ga0500637_0000019 3300053178 Bacteria 65170
394 Ga0500645_000005 3300053730 Bacteria 284466
395 Ga0500645_007990 3300053730 Bacteria 3645
396 Ga0500645_036323 3300053730 Bacteria 1466
397 Ga0500645_084289 3300053730 Bacteria 905
398 Ga0500645_170866 3300053730 Bacteria 594
399 Ga0500596_003894 3300053735 Bacteria 2792
400 Ga0590075_102367 3300059424 Bacteria 746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0579496 Ga0466960_0579496_15_419 134
2 3300005331 Ga0070670_100032665 Ga0070670_1000326655 146
3 3300005356 Ga0070674_100015961 Ga0070674_1000159615 146
4 3300005456 Ga0070678_100055494 Ga0070678_1000554942 146
5 3300005543 Ga0070672_100022638 Ga0070672_1000226382 146
6 3300025904 Ga0207647_10003893 Ga0207647_100038933 146
7 3300025937 Ga0207669_10000084 Ga0207669_1000008434 146
8 3300025938 Ga0207704_10074203 Ga0207704_100742033 146
9 3300025940 Ga0207691_10045286 Ga0207691_100452865 146
10 3300026121 Ga0207683_10019950 Ga0207683_100199507 146
11 3300046522 Ga0495643_0007276 Ga0495643_0007276_2795_3235 146
12 3300046557 Ga0495622_0027722 Ga0495622_0027722_28_468 146
13 3300046648 Ga0495611_0048464 Ga0495611_0048464_12_452 146
14 3300048907 Ga0496104_0018691 Ga0496104_0018691_10_450 146
15 3300053121 Ga0500607_329061 Ga0500607_329061_21_461 146
16 3300050494 nmdc:mga06z11_303042_c1 nmdc:mga06z11_303042_c1_449_916 149
17 3300031548 Ga0307408_100095912 Ga0307408_1000959122 150
18 3300032004 Ga0307414_10089066 Ga0307414_100890663 150
19 3300053730 Ga0500645_170866 Ga0500645_170866_110_562 150
20 3300048924 Ga0496121_0000296 Ga0496121_0000296_77801_78256 151
21 3300032126 Ga0307415_100085908 Ga0307415_1000859082 152
22 3300037471 Ga0395905_0522883 Ga0395905_0522883_192_653 153
23 3300041512 Ga0451853_2464682 Ga0451853_2464682_22_489 153
24 3300046500 Ga0495596_0173813 Ga0495596_0173813_13_477 154
25 3300046501 Ga0495607_0247467 Ga0495607_0247467_251_715 154
26 3300046507 Ga0495606_0000795 Ga0495606_0000795_15881_16345 154
27 3300046518 Ga0495631_0061329 Ga0495631_0061329_205_669 154
28 3300046522 Ga0495643_0041518 Ga0495643_0041518_1109_1573 154
29 3300046524 Ga0495648_0000537 Ga0495648_0000537_17030_17494 154
30 3300046558 Ga0495633_0001403 Ga0495633_0001403_3961_4425 154
31 3300046660 Ga0495625_0149411 Ga0495625_0149411_463_927 154
32 3300046679 Ga0495623_0257815 Ga0495623_0257815_487_951 154
33 3300046694 Ga0495649_0024025 Ga0495649_0024025_1903_2367 154
34 3300046810 Ga0495660_0160252 Ga0495660_0160252_476_940 154
35 3300047323 Ga0495683_0098261 Ga0495683_0098261_478_942 154
36 3300047445 Ga0495677_0212391 Ga0495677_0212391_172_636 154
37 3300053130 Ga0500642_0000866 Ga0500642_0000866_467_931 154
38 3300031824 Ga0307413_10738613 Ga0307413_107386131 158
39 3300031852 Ga0307410_10043516 Ga0307410_100435162 158
40 3300032005 Ga0307411_10012228 Ga0307411_100122286 158
41 3300031548 Ga0307408_100046760 Ga0307408_1000467602 159
42 3300031548 Ga0307408_100159337 Ga0307408_1001593374 159
43 3300031548 Ga0307408_101490647 Ga0307408_1014906471 159
44 3300031731 Ga0307405_10319427 Ga0307405_103194272 159
45 3300031852 Ga0307410_10023755 Ga0307410_100237552 159
46 3300031852 Ga0307410_10085456 Ga0307410_100854562 159
47 3300031852 Ga0307410_11234480 Ga0307410_112344802 159
48 3300031901 Ga0307406_10082007 Ga0307406_100820073 159
49 3300031903 Ga0307407_10024144 Ga0307407_100241442 159
50 3300031911 Ga0307412_10071169 Ga0307412_100711695 159
51 3300031911 Ga0307412_10090674 Ga0307412_100906743 159
52 3300031911 Ga0307412_10181247 Ga0307412_101812472 159
53 3300031995 Ga0307409_100050592 Ga0307409_1000505923 159
54 3300031995 Ga0307409_100363184 Ga0307409_1003631843 159
55 3300032002 Ga0307416_100133908 Ga0307416_1001339082 159
56 3300032004 Ga0307414_10067484 Ga0307414_100674844 159
57 3300032004 Ga0307414_10467618 Ga0307414_104676182 159
58 3300032005 Ga0307411_10125884 Ga0307411_101258843 159
59 3300046525 Ga0495663_0060725 Ga0495663_0060725_36_533 159
60 3300046664 Ga0495659_0055822 Ga0495659_0055822_429_926 159
61 3300046684 Ga0495669_0082585 Ga0495669_0082585_760_1257 159
62 3300046691 Ga0495670_0514726 Ga0495670_0514726_83_580 159
63 3300005295 Ga0065707_10256483 Ga0065707_102564831 160
64 3300014326 Ga0157380_10778616 Ga0157380_107786162 160
65 3300031852 Ga0307410_10369948 Ga0307410_103699482 160
66 3300059424 Ga0590075_102367 Ga0590075_102367_28_525 160
67 3300005985 Ga0081539_10059802 Ga0081539_100598023 161
68 3300044765 Ga0466970_0649785 Ga0466970_0649785_61_546 161
69 3300046691 Ga0495670_0067053 Ga0495670_0067053_1272_1766 161
70 iso_pu_bacteria 2582581305 2585261256 161
71 iso_pu_bacteria 2643221605 2644038843 161
72 3300032004 Ga0307414_10070490 Ga0307414_100704904 162
73 3300035207 Ga0373942_0057086 Ga0373942_0057086_357_851 162
74 3300035691 Ga0373931_0047717 Ga0373931_0047717_695_1189 162
75 3300041486 Ga0451807_2006468 Ga0451807_2006468_110_604 162
76 3300041505 Ga0451849_0730787 Ga0451849_0730787_45_551 162
77 3300042876 Ga0451577_1201554 Ga0451577_1201554_37_555 162
78 3300047443 Ga0495687_000234 Ga0495687_000234_75975_76463 162
79 3300001979 JGI24740J21852_10000334 JGI24740J21852_1000033413 163
80 3300001990 JGI24737J22298_10006892 JGI24737J22298_100068925 163
81 3300002244 JGI24742J22300_10031237 JGI24742J22300_100312371 163
82 3300003215 JGI25153J46596_10000152 JGI25153J46596_1000015230 163
83 3300003759 Ga0055525_1000035 Ga0055525_1000035249 163
84 3300003763 Ga0055529_1000088 Ga0055529_100008850 163
85 3300005262 Ga0065165_1003382 Ga0065165_100338213 163
86 3300005327 Ga0070658_10013483 Ga0070658_100134831 163
87 3300005331 Ga0070670_100000973 Ga0070670_10000097311 163
88 3300005334 Ga0068869_100530536 Ga0068869_1005305362 163
89 3300005335 Ga0070666_10059094 Ga0070666_100590942 163
90 3300005347 Ga0070668_100000105 Ga0070668_10000010545 163
91 3300005355 Ga0070671_100019275 Ga0070671_1000192753 163
92 3300005367 Ga0070667_100000071 Ga0070667_10000007144 163
93 3300005456 Ga0070678_100130868 Ga0070678_1001308682 163
94 3300005617 Ga0068859_100016751 Ga0068859_1000167517 163
95 3300005618 Ga0068864_100001349 Ga0068864_1000013497 163
96 3300005719 Ga0068861_100030218 Ga0068861_1000302183 163
97 3300005841 Ga0068863_100003010 Ga0068863_1000030107 163
98 3300005841 Ga0068863_100007160 Ga0068863_1000071603 163
99 3300005842 Ga0068858_100000410 Ga0068858_10000041027 163
100 3300005843 Ga0068860_100000049 Ga0068860_100000049172 163
101 3300005844 Ga0068862_100000134 Ga0068862_10000013450 163
102 3300006186 Ga0075369_10064545 Ga0075369_100645451 163
103 3300006195 Ga0075366_10169431 Ga0075366_101694312 163
104 3300006931 Ga0097620_100016751 Ga0097620_1000167517 163
105 3300009148 Ga0105243_10000091 Ga0105243_1000009150 163
106 3300009174 Ga0105241_10004776 Ga0105241_1000477610 163
107 3300009177 Ga0105248_10769552 Ga0105248_107695522 163
108 3300009545 Ga0105237_10015289 Ga0105237_100152892 163
109 3300012513 Ga0157326_1021543 Ga0157326_10215431 163
110 3300013105 Ga0157369_10119260 Ga0157369_101192604 163
111 3300013105 Ga0157369_10893788 Ga0157369_108937882 163
112 3300013296 Ga0157374_10301858 Ga0157374_103018582 163
113 3300013308 Ga0157375_10329308 Ga0157375_103293082 163
114 3300021361 Ga0213872_10000210 Ga0213872_1000021045 163
115 3300025230 Ga0209563_100047 Ga0209563_100047106 163
116 3300025253 Ga0209677_105356 Ga0209677_1053564 163
117 3300025254 Ga0209148_1000017 Ga0209148_100001747 163
118 3300025272 Ga0209455_1000005 Ga0209455_100000547 163
119 3300025297 Ga0209758_1000035 Ga0209758_100003531 163
120 3300025901 Ga0207688_10037332 Ga0207688_100373322 163
121 3300025903 Ga0207680_10044070 Ga0207680_100440703 163
122 3300025909 Ga0207705_10000557 Ga0207705_1000055722 163
123 3300025911 Ga0207654_10000284 Ga0207654_1000028428 163
124 3300025919 Ga0207657_10659412 Ga0207657_106594122 163
125 3300025925 Ga0207650_10002528 Ga0207650_100025289 163
126 3300025931 Ga0207644_10000443 Ga0207644_1000044311 163
127 3300025933 Ga0207706_10030167 Ga0207706_100301672 163
128 3300025935 Ga0207709_10000018 Ga0207709_10000018207 163
129 3300025949 Ga0207667_10000004 Ga0207667_1000000442 163
130 3300025972 Ga0207668_10000011 Ga0207668_1000001148 163
131 3300025986 Ga0207658_10000014 Ga0207658_10000014179 163
132 3300026035 Ga0207703_10000402 Ga0207703_1000040225 163
133 3300026041 Ga0207639_10002341 Ga0207639_1000234110 163
134 3300026078 Ga0207702_10000708 Ga0207702_1000070827 163
135 3300026088 Ga0207641_10001682 Ga0207641_100016829 163
136 3300026088 Ga0207641_10002219 Ga0207641_1000221910 163
137 3300026095 Ga0207676_10000759 Ga0207676_1000075913 163
138 3300026118 Ga0207675_100050515 Ga0207675_1000505153 163
139 3300026121 Ga0207683_10067481 Ga0207683_100674812 163
140 3300026142 Ga0207698_10023162 Ga0207698_100231626 163
141 3300026142 Ga0207698_11142012 Ga0207698_111420121 163
142 3300028379 Ga0268266_10689340 Ga0268266_106893402 163
143 3300028380 Ga0268265_10000228 Ga0268265_1000022825 163
144 3300028381 Ga0268264_10000121 Ga0268264_10000121158 163
145 3300031824 Ga0307413_10022613 Ga0307413_100226136 163
146 3300031901 Ga0307406_11000958 Ga0307406_110009582 163
147 3300031911 Ga0307412_10014022 Ga0307412_100140222 163
148 3300032002 Ga0307416_101013627 Ga0307416_1010136272 163
149 3300037418 Ga0395900_0111247 Ga0395900_0111247_1449_1940 163
150 3300037471 Ga0395905_0265064 Ga0395905_0265064_926_1417 163
151 3300038443 Ga0395901_0019077 Ga0395901_0019077_1068_1559 163
152 3300039447 Ga0436361_0328227 Ga0436361_0328227_16869_17360 163
153 3300041498 Ga0451841_0940740 Ga0451841_0940740_21_521 163
154 3300044765 Ga0466970_0511076 Ga0466970_0511076_106_603 163
155 3300046460 Ga0495638_0142770 Ga0495638_0142770_567_1067 163
156 3300046460 Ga0495638_0302571 Ga0495638_0302571_105_626 163
157 3300046476 Ga0495662_0096830 Ga0495662_0096830_227_718 163
158 3300046491 Ga0495584_0005889 Ga0495584_0005889_2000_2521 163
159 3300046491 Ga0495584_0041433 Ga0495584_0041433_463_954 163
160 3300046492 Ga0495585_0029012 Ga0495585_0029012_2122_2613 163
161 3300046506 Ga0495583_0002700 Ga0495583_0002700_9777_10298 163
162 3300046506 Ga0495583_0003092 Ga0495583_0003092_4292_4783 163
163 3300046506 Ga0495583_0012264 Ga0495583_0012264_3990_4481 163
164 3300046507 Ga0495606_0067812 Ga0495606_0067812_1165_1656 163
165 3300046512 Ga0495610_0153394 Ga0495610_0153394_369_869 163
166 3300046518 Ga0495631_0019708 Ga0495631_0019708_2175_2696 163
167 3300046520 Ga0495637_0008333 Ga0495637_0008333_17_508 163
168 3300046522 Ga0495643_0028191 Ga0495643_0028191_536_1027 163
169 3300046522 Ga0495643_0047111 Ga0495643_0047111_428_919 163
170 3300046525 Ga0495663_0027487 Ga0495663_0027487_467_958 163
171 3300046558 Ga0495633_0032774 Ga0495633_0032774_1085_1576 163
172 3300046616 Ga0495668_0000090 Ga0495668_0000090_60520_61011 163
173 3300046616 Ga0495668_0077223 Ga0495668_0077223_980_1501 163
174 3300046616 Ga0495668_0251753 Ga0495668_0251753_163_654 163
175 3300046648 Ga0495611_0007772 Ga0495611_0007772_2314_2835 163
176 3300046648 Ga0495611_0198177 Ga0495611_0198177_175_666 163
177 3300046660 Ga0495625_0004391 Ga0495625_0004391_10431_10952 163
178 3300046660 Ga0495625_0051483 Ga0495625_0051483_161_661 163
179 3300046684 Ga0495669_0000262 Ga0495669_0000262_14368_14889 163
180 3300046689 Ga0495613_0486848 Ga0495613_0486848_152_643 163
181 3300046694 Ga0495649_0354262 Ga0495649_0354262_41_562 163
182 3300046809 Ga0495600_0001054 Ga0495600_0001054_7212_7703 163
183 3300046810 Ga0495660_0022436 Ga0495660_0022436_1193_1714 163
184 3300047323 Ga0495683_0009847 Ga0495683_0009847_466_957 163
185 3300047443 Ga0495687_000402 Ga0495687_000402_52470_52991 163
186 3300047470 Ga0495681_0017919 Ga0495681_0017919_193_684 163
187 3300048905 Ga0496102_0000125 Ga0496102_0000125_64854_65345 163
188 3300048906 Ga0496103_0002012 Ga0496103_0002012_702_1193 163
189 3300048908 Ga0496105_0001064 Ga0496105_0001064_888_1379 163
190 3300048913 Ga0496110_0003258 Ga0496110_0003258_7660_8151 163
191 3300048916 Ga0496113_0010216 Ga0496113_0010216_234_755 163
192 3300048917 Ga0496114_0044047 Ga0496114_0044047_114_605 163
193 3300048918 Ga0496115_0000291 Ga0496115_0000291_42161_42652 163
194 3300048919 Ga0496116_0022951 Ga0496116_0022951_165_656 163
195 3300048920 Ga0496117_0000714 Ga0496117_0000714_845_1336 163
196 3300048921 Ga0496118_0000701 Ga0496118_0000701_728_1219 163
197 3300048922 Ga0496119_0071776 Ga0496119_0071776_621_1112 163
198 3300048923 Ga0496120_0043680 Ga0496120_0043680_370_861 163
199 3300048924 Ga0496121_0001032 Ga0496121_0001032_813_1304 163
200 3300048925 Ga0496122_0013462 Ga0496122_0013462_16_507 163
201 3300048926 Ga0496123_0016928 Ga0496123_0016928_605_1126 163
202 3300048927 Ga0496124_0000666 Ga0496124_0000666_665_1156 163
203 3300048928 Ga0496125_0000945 Ga0496125_0000945_472_993 163
204 3300048929 Ga0496126_0001123 Ga0496126_0001123_43726_44217 163
205 3300048929 Ga0496126_0120312 Ga0496126_0120312_684_1178 163
206 3300050493 nmdc:mga0k408_38528_c1 nmdc:mga0k408_38528_c1_1831_2322 163
207 3300053079 Ga0500610_0001715 Ga0500610_0001715_34_555 163
208 3300053087 Ga0500643_078225 Ga0500643_078225_267_767 163
209 3300053092 Ga0500583_0025168 Ga0500583_0025168_655_1176 163
210 3300053119 Ga0500595_000411 Ga0500595_000411_6961_7452 163
211 3300053177 Ga0500636_0104279 Ga0500636_0104279_673_1164 163
212 3300053730 Ga0500645_000005 Ga0500645_000005_56616_57137 163
213 3300053730 Ga0500645_084289 Ga0500645_084289_150_650 163
214 3300053735 Ga0500596_003894 Ga0500596_003894_1915_2424 163
215 3300003791 Ga0055530_10000194 Ga0055530_1000019433 164
216 3300003794 Ga0055531_10000019 Ga0055531_1000001988 164
217 3300005345 Ga0070692_10003352 Ga0070692_100033524 164
218 3300005719 Ga0068861_100000089 Ga0068861_10000008938 164
219 3300021384 Ga0213876_10089950 Ga0213876_100899502 164
220 3300025298 Ga0209050_1000010 Ga0209050_100001088 164
221 3300025304 Ga0209257_1000009 Ga0209257_10000091028 164
222 3300026118 Ga0207675_100000264 Ga0207675_10000026453 164
223 3300031903 Ga0307407_10510821 Ga0307407_105108211 164
224 3300032004 Ga0307414_10088216 Ga0307414_100882162 164
225 3300039437 Ga0436365_0491674 Ga0436365_0491674_2469_2963 164
226 3300046558 Ga0495633_0000321 Ga0495633_0000321_26080_26622 164
227 3300053120 Ga0500597_005354 Ga0500597_005354_2453_2947 164
228 3300053157 Ga0500624_000032 Ga0500624_000032_55671_56165 164
229 3300053178 Ga0500637_0000019 Ga0500637_0000019_16436_16930 164
230 iso_pu_bacteria 2643221622 2644127254 164
231 3300005295 Ga0065707_10085715 Ga0065707_100857153 165
232 3300005367 Ga0070667_100000036 Ga0070667_100000036117 165
233 3300005617 Ga0068859_100545816 Ga0068859_1005458162 165
234 3300005841 Ga0068863_100101403 Ga0068863_1001014032 165
235 3300005843 Ga0068860_100000063 Ga0068860_10000006348 165
236 3300006931 Ga0097620_100545856 Ga0097620_1005458562 165
237 3300006946 Ga0079104_1045457 Ga0079104_10454572 165
238 3300009177 Ga0105248_10054427 Ga0105248_100544276 165
239 3300009553 Ga0105249_10532959 Ga0105249_105329592 165
240 3300009553 Ga0105249_10552768 Ga0105249_105527682 165
241 3300025941 Ga0207711_10004455 Ga0207711_100044556 165
242 3300025961 Ga0207712_10499550 Ga0207712_104995502 165
243 3300025961 Ga0207712_10560978 Ga0207712_105609782 165
244 3300025986 Ga0207658_10000083 Ga0207658_1000008360 165
245 3300026088 Ga0207641_10000477 Ga0207641_1000047714 165
246 3300028381 Ga0268264_10000083 Ga0268264_10000083103 165
247 3300031731 Ga0307405_10200961 Ga0307405_102009613 165
248 3300031824 Ga0307413_10177513 Ga0307413_101775133 165
249 3300031852 Ga0307410_10112526 Ga0307410_101125261 165
250 3300031852 Ga0307410_10147382 Ga0307410_101473823 165
251 3300031852 Ga0307410_10598500 Ga0307410_105985002 165
252 3300031852 Ga0307410_10841976 Ga0307410_108419761 165
253 3300031903 Ga0307407_10438538 Ga0307407_104385382 165
254 3300031911 Ga0307412_10605902 Ga0307412_106059022 165
255 3300031995 Ga0307409_100277403 Ga0307409_1002774031 165
256 3300032002 Ga0307416_100140917 Ga0307416_1001409173 165
257 3300032002 Ga0307416_102346406 Ga0307416_1023464061 165
258 3300032004 Ga0307414_10223073 Ga0307414_102230732 165
259 3300032004 Ga0307414_10246364 Ga0307414_102463643 165
260 3300032005 Ga0307411_10071601 Ga0307411_100716013 165
261 3300032005 Ga0307411_10120409 Ga0307411_101204092 165
262 3300032005 Ga0307411_10339911 Ga0307411_103399113 165
263 3300032126 Ga0307415_100103205 Ga0307415_1001032053 165
264 3300039450 Ga0436363_1117181 Ga0436363_1117181_140_640 165
265 3300041459 Ga0451800_0623530 Ga0451800_0623530_188_685 165
266 3300041486 Ga0451807_1240922 Ga0451807_1240922_509_1006 165
267 3300048905 Ga0496102_0635526 Ga0496102_0635526_324_821 165
268 3300048928 Ga0496125_0074271 Ga0496125_0074271_288_827 165
269 3300048928 Ga0496125_0100713 Ga0496125_0100713_1498_1998 165
270 3300053087 Ga0500643_001850 Ga0500643_001850_887_1384 165
271 3300053116 Ga0500592_001140 Ga0500592_001140_3427_3924 165
272 3300053119 Ga0500595_002079 Ga0500595_002079_1799_2296 165
273 3300053128 Ga0500626_119358 Ga0500626_119358_354_851 165
274 3300002076 JGI24749J21850_1000015 JGI24749J21850_100001521 166
275 3300002459 JGI24751J29686_10000256 JGI24751J29686_100002568 166
276 3300003794 Ga0055531_10073502 Ga0055531_100735021 166
277 3300005295 Ga0065707_10085225 Ga0065707_100852255 166
278 3300005331 Ga0070670_100000028 Ga0070670_100000028125 166
279 3300005347 Ga0070668_100235495 Ga0070668_1002354952 166
280 3300005353 Ga0070669_100000005 Ga0070669_100000005186 166
281 3300005367 Ga0070667_100000733 Ga0070667_10000073312 166
282 3300005457 Ga0070662_100395094 Ga0070662_1003950942 166
283 3300005577 Ga0068857_100046541 Ga0068857_1000465413 166
284 3300005578 Ga0068854_100057210 Ga0068854_1000572102 166
285 3300005617 Ga0068859_100003554 Ga0068859_10000355416 166
286 3300005618 Ga0068864_100000049 Ga0068864_10000004919 166
287 3300005719 Ga0068861_100010921 Ga0068861_1000109217 166
288 3300005841 Ga0068863_100006355 Ga0068863_1000063554 166
289 3300005843 Ga0068860_100820040 Ga0068860_1008200401 166
290 3300005844 Ga0068862_100000005 Ga0068862_100000005262 166
291 3300006042 Ga0075368_10000112 Ga0075368_1000011220 166
292 3300006048 Ga0075363_100012861 Ga0075363_1000128617 166
293 3300006051 Ga0075364_10014899 Ga0075364_100148996 166
294 3300006177 Ga0075362_10000129 Ga0075362_1000012921 166
295 3300006178 Ga0075367_10010792 Ga0075367_100107926 166
296 3300006195 Ga0075366_10053009 Ga0075366_100530093 166
297 3300006353 Ga0075370_10162718 Ga0075370_101627181 166
298 3300006931 Ga0097620_100003554 Ga0097620_1000035542 166
299 3300009177 Ga0105248_10000218 Ga0105248_1000021842 166
300 3300009551 Ga0105238_10187384 Ga0105238_101873843 166
301 3300013306 Ga0163162_10531707 Ga0163162_105317072 166
302 3300014325 Ga0163163_10071416 Ga0163163_100714165 166
303 3300014326 Ga0157380_10000023 Ga0157380_1000002366 166
304 3300025304 Ga0209257_1020250 Ga0209257_10202503 166
305 3300025923 Ga0207681_10000003 Ga0207681_10000003126 166
306 3300025924 Ga0207694_10223355 Ga0207694_102233552 166
307 3300025925 Ga0207650_10000012 Ga0207650_10000012133 166
308 3300025941 Ga0207711_10000706 Ga0207711_1000070623 166
309 3300025972 Ga0207668_10008351 Ga0207668_100083517 166
310 3300025981 Ga0207640_10008751 Ga0207640_100087516 166
311 3300025986 Ga0207658_10000617 Ga0207658_1000061712 166
312 3300026088 Ga0207641_10158730 Ga0207641_101587302 166
313 3300026095 Ga0207676_10000009 Ga0207676_10000009122 166
314 3300026116 Ga0207674_10715297 Ga0207674_107152972 166
315 3300026118 Ga0207675_100010398 Ga0207675_1000103988 166
316 3300026142 Ga0207698_10268620 Ga0207698_102686202 166
317 3300027866 Ga0209813_10001612 Ga0209813_1000161210 166
318 3300028380 Ga0268265_10000001 Ga0268265_10000001351 166
319 3300028381 Ga0268264_10735847 Ga0268264_107358471 166
320 3300031548 Ga0307408_100949806 Ga0307408_1009498061 166
321 3300031731 Ga0307405_10014495 Ga0307405_100144955 166
322 3300031731 Ga0307405_10801477 Ga0307405_108014771 166
323 3300031911 Ga0307412_10046709 Ga0307412_100467093 166
324 3300031911 Ga0307412_10053354 Ga0307412_100533542 166
325 3300031995 Ga0307409_100143907 Ga0307409_1001439072 166
326 3300032004 Ga0307414_10931129 Ga0307414_109311292 166
327 3300032005 Ga0307411_10021320 Ga0307411_100213204 166
328 3300032126 Ga0307415_100141762 Ga0307415_1001417622 166
329 3300041452 Ga0451793_0611042 Ga0451793_0611042_18_533 166
330 3300041456 Ga0451795_1206806 Ga0451795_1206806_239_754 166
331 3300046660 Ga0495625_0276944 Ga0495625_0276944_288_788 166
332 3300046691 Ga0495670_0000005 Ga0495670_0000005_242260_242796 166
333 3300046691 Ga0495670_0111415 Ga0495670_0111415_785_1285 166
334 3300049679 Ga0501249_031970 Ga0501249_031970_365_886 166
335 3300050489 nmdc:mga03683_344_c1 nmdc:mga03683_344_c1_9516_10037 166
336 3300050490 nmdc:mga03n38_111702_c1 nmdc:mga03n38_111702_c1_756_1277 166
337 3300050491 nmdc:mga00v17_138836_c1 nmdc:mga00v17_138836_c1_321_839 166
338 3300050491 nmdc:mga00v17_3742_c1 nmdc:mga00v17_3742_c1_1742_2263 166
339 3300050493 nmdc:mga0k408_184888_c1 nmdc:mga0k408_184888_c1_301_819 166
340 3300050493 nmdc:mga0k408_68853_c1 nmdc:mga0k408_68853_c1_231_752 166
341 3300050494 nmdc:mga06z11_84_c1 nmdc:mga06z11_84_c1_37960_38481 166
342 3300050495 nmdc:mga04h51_230529_c1 nmdc:mga04h51_230529_c1_191_712 166
343 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_12848_13369 166
344 3300053730 Ga0500645_007990 Ga0500645_007990_1446_1946 166
345 3300053730 Ga0500645_036323 Ga0500645_036323_120_623 166
346 iso_pu_bacteria 2512564039 2512736708 166
347 3300005331 Ga0070670_100159338 Ga0070670_1001593384 167
348 3300012513 Ga0157326_1000122 Ga0157326_10001226 167
349 3300025304 Ga0209257_1007567 Ga0209257_10075676 167
350 3300041410 Ga0439461_0003640 Ga0439461_0003640_538_1050 167
351 3300041413 Ga0439465_0000245 Ga0439465_0000245_2394_2906 167
352 3300041413 Ga0439465_0007093 Ga0439465_0007093_2757_3284 167
353 3300041997 Ga0439431_0001431 Ga0439431_0001431_1598_2110 167
354 3300041997 Ga0439431_0008854 Ga0439431_0008854_889_1416 167
355 3300042002 Ga0439442_016746 Ga0439442_016746_348_860 167
356 3300042004 Ga0439445_0002310 Ga0439445_0002310_736_1248 167
357 3300042004 Ga0439445_0004803 Ga0439445_0004803_225_752 167
358 3300042006 Ga0439432_005603 Ga0439432_005603_3612_4139 167
359 3300042006 Ga0439432_005726 Ga0439432_005726_2640_3152 167
360 3300042010 Ga0439452_027518 Ga0439452_027518_146_658 167
361 3300042015 Ga0439462_0000928 Ga0439462_0000928_3061_3573 167
362 3300042156 Ga0439446_0007255 Ga0439446_0007255_1293_1805 167
363 3300042435 Ga0439434_0000087 Ga0439434_0000087_11782_12294 167
364 3300046491 Ga0495584_0000011 Ga0495584_0000011_90273_90812 167
365 3300046507 Ga0495606_0019195 Ga0495606_0019195_945_1484 167
366 3300047469 Ga0495673_0259942 Ga0495673_0259942_60_599 167
367 3300049569 Ga0501032_0017029 Ga0501032_0017029_1989_2561 167
368 3300049580 Ga0501046_0076878 Ga0501046_0076878_1936_2508 167
369 3300049581 Ga0501047_0000938 Ga0501047_0000938_12483_13055 167
370 3300049582 Ga0501048_0055567 Ga0501048_0055567_1719_2291 167
371 3300049679 Ga0501249_000113 Ga0501249_000113_11398_11928 167
372 3300049822 Ga0501035_0219184 Ga0501035_0219184_339_911 167
373 3300049850 Ga0501204_011050 Ga0501204_011050_398_928 167
374 3300053094 Ga0500566_0000728 Ga0500566_0000728_10187_10711 167
375 3300053134 Ga0500658_0015622 Ga0500658_0015622_1290_1817 167
376 iso_pu_bacteria 2643221541 2643728188 167
377 iso_pu_bacteria 2643221606 2644042863 167
378 iso_pu_bacteria 2643221671 2644395706 167
379 3300000041 ARcpr5oldR_c001916 ARcpr5oldR_0019162 168
380 3300003215 JGI25153J46596_10021472 JGI25153J46596_100214722 168
381 3300003773 Ga0055537_1002583 Ga0055537_10025833 168
382 3300003775 Ga0055524_1000081 Ga0055524_100008115 168
383 3300003794 Ga0055531_10005572 Ga0055531_100055723 168
384 3300003794 Ga0055531_10010612 Ga0055531_100106123 168
385 3300005262 Ga0065165_1013767 Ga0065165_10137672 168
386 3300005262 Ga0065165_1046024 Ga0065165_10460241 168
387 3300025245 Ga0207425_1017952 Ga0207425_10179522 168
388 3300025263 Ga0209565_1000012 Ga0209565_1000012467 168
389 3300025273 Ga0209673_1002896 Ga0209673_10028963 168
390 3300025291 Ga0209675_1006102 Ga0209675_10061025 168
391 3300025295 Ga0209564_1066209 Ga0209564_10662092 168
392 3300025297 Ga0209758_1016236 Ga0209758_10162362 168
393 3300025299 Ga0209256_1000012 Ga0209256_1000012658 168
394 3300030733 Ga0314311_1094399 Ga0314311_10943993 168
395 3300041404 Ga0439436_0018042 Ga0439436_0018042_893_1423 168
396 3300041410 Ga0439461_0013996 Ga0439461_0013996_789_1319 168
397 3300041997 Ga0439431_0048035 Ga0439431_0048035_378_908 168
398 3300042007 Ga0439449_0216587 Ga0439449_0216587_155_685 168
399 3300042014 Ga0439457_030980 Ga0439457_030980_598_1128 168
400 3300042185 Ga0450909_015336 Ga0450909_015336_149_679 168
401 3300046453 Ga0495627_016547 Ga0495627_016547_1418_1948 168
402 3300046525 Ga0495663_0118864 Ga0495663_0118864_283_813 168
403 3300047470 Ga0495681_0173952 Ga0495681_0173952_34_564 168
404 3300053087 Ga0500643_036236 Ga0500643_036236_341_871 168
405 3300053134 Ga0500658_0060554 Ga0500658_0060554_51_581 168
406 3300053139 Ga0500568_0001399 Ga0500568_0001399_10098_10628 168
407 3300053151 Ga0500604_0019964 Ga0500604_0019964_1156_1686 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

26

180

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l3f-assembly1.cif.gz_A solution nmr structure of a putative uracil dna glycosylase from methanosarcina acetivorans, northeast structural genomics consortium target mvr76 0.8829 3 164
2l3f-assembly1.cif.gz_A solution nmr structure of a putative uracil dna glycosylase from methanosarcina acetivorans, northeast structural genomics consortium target mvr76 0.8675 3 164
3ufj-assembly1.cif.gz_B human thymine dna glycosylase bound to substrate analog 2'-fluoro-2'-deoxyuridine 0.7705 7 164
6u15-assembly1.cif.gz_A human thymine dna glycosylase n140a mutant bound to dna with 2'-f-5-carboxyl-dc substrate analog 0.7695 6 164
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.7463 9 165
ID Description Score Start End Superfamily
2l3fA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8829 3 164 3.40.470.10
2l3fA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8675 3 164 3.40.470.10
af_A4I7J6_7_234_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8108 8 162 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7865 6 164 3.40.470.10
af_A4I7J6_7_234_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7481 8 162 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A196MPV6-F1-model_v4 DNA-deoxyinosine glycosylase 0.9993 1 163
AF-A0A2G6RQL4-F1-model_v4 deleted 0.9928 2 160
AF-A0A2S9H4G4-F1-model_v4 HypoxanDNAglyco: DNA-deoxyinosine glycosylase 0.9925 3 163
AF-A0A848SFK1-F1-model_v4 DNA-deoxyinosine glycosylase (EC 3.2.2.15) 0.9898 3 163 GO:0016798
AF-A0A7W9CJQ9-F1-model_v4 Hypoxanthine-DNA glycosylase 0.9882 3 163

Feature Viewer

pLDDT pTM Quality
94.49 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map