metagRoot

F436337

General Info

Members	Datasets	Scaffolds	Average Seq Length
406	259	406	328

Family's Representative Sequence

Representative Sequence	3300050492\|nmdc:mga0yw44_142385_c1\|nmdc:mga0yw44_142385_c1_281_1306
Length	341
Sequence	LKKEEISMTASTQPKTRTLGNSNLSVLPIGLGCMSLSGAYGKSNDDEAIRVIHHAIDRGVNFLDSSDMYGWGHNETLLGKALAGGRRGKVVLATKFGQTQQPGGANGVDGSPAYVKAACDASLKRLGVDVIDLYYQHRVDPSVPIEDTVGAMGELVKAGKVRALGLSEAKPETIRRAHKVHPLAAVQSEYSLLYREHAEETLKTTRALGISYVAYSPLGRSLLTGTVRQAADIPEGDGRGRHPRFVGDNLGRNLAKTSAIEAVAREKGCKPGQVALAWLLAQGADIVPIPGTKRSERVDENLAALEVALSADEVTRLSTALPPGAAAGTRYPEGGMKGVYL

Samples

	Sample ID	Description	Type	Environment
1	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
6	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
7	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
8	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
12	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
13	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
17	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
18	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
19	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
20	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
21	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
22	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
23	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
24	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
25	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
26	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
27	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
28	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
29	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
30	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
31	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
32	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
33	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
34	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
35	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
36	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
37	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
38	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
39	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
40	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
41	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
44	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
45	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
46	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
47	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
48	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
49	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
50	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
51	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
54	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
55	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
56	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
57	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
59	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
60	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
61	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
62	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
67	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
68	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
74	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
75	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
76	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
77	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
78	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
79	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
80	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
81	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
82	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
83	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
133	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
137	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
138	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
139	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
140	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
141	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
142	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
143	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
144	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
145	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
146	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
147	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
148	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
149	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
150	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
151	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
152	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
153	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
154	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
155	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
156	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
157	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
158	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
159	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
160	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
161	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
162	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
163	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
164	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
166	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
167	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
168	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
169	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
170	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
171	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
172	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
173	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
174	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
175	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
176	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
177	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
178	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
179	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
180	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
181	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
182	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
183	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
184	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
185	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
186	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
187	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
188	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
189	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
190	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
191	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
192	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
193	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
194	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
195	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
196	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
197	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
198	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
199	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
200	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
201	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
202	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
203	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
204	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
205	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
206	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
207	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
208	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
209	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
238	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
239	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
240	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
241	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
242	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
243	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
244	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
245	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
246	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
247	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
248	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
249	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
252	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
253	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
254	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
255	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
256	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
257	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
258	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
259	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.17
Nodule	0
Rhizoplane	0.74
Rhizosphere	93.6
Stem	0
Stem Tuber	0
Unclassified	0.49

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065707_10008820	3300005295	Bacteria	3605
2	Ga0065707_10135065	3300005295	Bacteria	1855
3	Ga0070658_10005298	3300005327	Bacteria	10470
4	Ga0070658_10255320	3300005327	Bacteria	1488
5	Ga0070683_100052087	3300005329	Bacteria	3791
6	Ga0070690_100000841	3300005330	Bacteria	15569
7	Ga0068869_100001651	3300005334	Bacteria	13315
8	Ga0070666_10149100	3300005335	Bacteria	1632
9	Ga0070680_100001241	3300005336	Bacteria	18376
10	Ga0070680_100227103	3300005336	Bacteria	1576
11	Ga0070682_100011140	3300005337	Bacteria	5131
12	Ga0068868_100004039	3300005338	Bacteria	10228
13	Ga0070689_100097436	3300005340	Bacteria	2326
14	Ga0070689_100150351	3300005340	Bacteria	1877
15	Ga0070691_10022378	3300005341	Bacteria	2932
16	Ga0070687_100000713	3300005343	Bacteria	11062
17	Ga0070687_100079261	3300005343	Bacteria	1787
18	Ga0070692_10008183	3300005345	Bacteria	4652
19	Ga0070669_100226914	3300005353	Bacteria	1479
20	Ga0070675_100098135	3300005354	Bacteria	2464
21	Ga0070667_100064038	3300005367	Bacteria	3119
22	Ga0070714_100001717	3300005435	Bacteria	15944
23	Ga0070713_100108891	3300005436	Bacteria	2413
24	Ga0070710_10000615	3300005437	Bacteria	16951
25	Ga0070710_10073068	3300005437	Bacteria	1982
26	Ga0070701_10011337	3300005438	Bacteria	3981
27	Ga0070701_10073381	3300005438	Bacteria	1835
28	Ga0070711_100001965	3300005439	Bacteria	11538
29	Ga0070705_100180656	3300005440	Bacteria	1429
30	Ga0070700_100001890	3300005441	Bacteria	10586
31	Ga0070694_100011477	3300005444	Bacteria	5488
32	Ga0070694_100058806	3300005444	Bacteria	2616
33	Ga0070694_100083203	3300005444	Bacteria	2230
34	Ga0070681_10003085	3300005458	Bacteria	15467
35	Ga0068867_100000640	3300005459	Bacteria	23146
36	Ga0068867_100026035	3300005459	Bacteria	4197
37	Ga0070706_100082746	3300005467	Bacteria	2973
38	Ga0070707_100331883	3300005468	Bacteria	1477
39	Ga0070698_100004749	3300005471	Bacteria	14921
40	Ga0070699_100071116	3300005518	Bacteria	3025
41	Ga0070699_100137863	3300005518	Bacteria	2153
42	Ga0070679_100005398	3300005530	Bacteria	11844
43	Ga0070686_100197543	3300005544	Bacteria	1440
44	Ga0070695_100090317	3300005545	Bacteria	2044
45	Ga0070695_100284486	3300005545	Bacteria	1216
46	Ga0070696_100000527	3300005546	Bacteria	24255
47	Ga0070696_100002762	3300005546	Bacteria	11646
48	Ga0070693_100001459	3300005547	Bacteria	10658
49	Ga0070693_100013135	3300005547	Bacteria	4211
50	Ga0070665_100126997	3300005548	Bacteria	2553
51	Ga0070704_100002169	3300005549	Bacteria	10934
52	Ga0070704_100005292	3300005549	Bacteria	7520
53	Ga0068855_100291339	3300005563	Bacteria	1809
54	Ga0070664_100070708	3300005564	Bacteria	2989
55	Ga0068857_100112954	3300005577	Bacteria	2442
56	Ga0068854_100013384	3300005578	Bacteria	5383
57	Ga0068854_100119514	3300005578	Bacteria	1998
58	Ga0068856_100016600	3300005614	Bacteria	7128
59	Ga0068856_100049328	3300005614	Bacteria	4149
60	Ga0068856_100349116	3300005614	Bacteria	1498
61	Ga0070702_100005829	3300005615	Bacteria	5776
62	Ga0070702_100070951	3300005615	Bacteria	2058
63	Ga0068864_100128626	3300005618	Bacteria	2272
64	Ga0068866_10001344	3300005718	Bacteria	10628
65	Ga0068866_10130366	3300005718	Bacteria	1429
66	Ga0068861_100000456	3300005719	Bacteria	23810
67	Ga0068861_100038867	3300005719	Bacteria	3548
68	Ga0068863_100040665	3300005841	Bacteria	4420
69	Ga0068863_100335157	3300005841	Bacteria	1471
70	Ga0068862_100003371	3300005844	Bacteria	13778
71	Ga0081455_10000243	3300005937	Bacteria	70794
72	Ga0081455_10017097	3300005937	Bacteria	6969
73	Ga0081538_10008234	3300005981	Bacteria	8884
74	Ga0081538_10079656	3300005981	Bacteria	1751
75	Ga0081539_10001920	3300005985	Bacteria	32135
76	Ga0081539_10005219	3300005985	Bacteria	13451
77	Ga0075365_10136898	3300006038	Bacteria	1698
78	Ga0075365_10162055	3300006038	Bacteria	1558
79	Ga0070715_10012665	3300006163	Bacteria	3077
80	Ga0075362_10008147	3300006177	Bacteria	3999
81	Ga0075367_10119255	3300006178	Bacteria	1625
82	Ga0075369_10007173	3300006186	Bacteria	4236
83	Ga0097621_100005085	3300006237	Bacteria	9241
84	Ga0075370_10003641	3300006353	Bacteria	7376
85	Ga0075370_10056358	3300006353	Bacteria	2234
86	Ga0068871_100035054	3300006358	Bacteria	3986
87	Ga0075428_100002876	3300006844	Bacteria	18778
88	Ga0075428_100051805	3300006844	Bacteria	4501
89	Ga0075428_100084187	3300006844	Bacteria	3470
90	Ga0075428_100105661	3300006844	Bacteria	3070
91	Ga0075430_100007753	3300006846	Bacteria	9070
92	Ga0075430_100026081	3300006846	Bacteria	4972
93	Ga0075431_100000647	3300006847	Bacteria	29545
94	Ga0075431_100030839	3300006847	Bacteria	5523
95	Ga0075431_100190800	3300006847	Bacteria	2099
96	Ga0075431_100250997	3300006847	Bacteria	1798
97	Ga0075434_100000221	3300006871	Bacteria	38986
98	Ga0075434_100094831	3300006871	Bacteria	2989
99	Ga0075429_100009086	3300006880	Bacteria	8631
100	Ga0075429_100301597	3300006880	Bacteria	1402
101	Ga0068865_100002491	3300006881	Bacteria	10906
102	Ga0068865_100051202	3300006881	Bacteria	2857
103	Ga0068865_100089269	3300006881	Bacteria	2232
104	Ga0075436_100001742	3300006914	Bacteria	14903
105	Ga0075435_100000249	3300007076	Bacteria	33358
106	Ga0099794_10055086	3300007265	Bacteria	1921
107	Ga0111539_10004830	3300009094	Bacteria	17568
108	Ga0111539_10005703	3300009094	Bacteria	16116
109	Ga0111539_10060150	3300009094	Bacteria	4503
110	Ga0111539_10073836	3300009094	Bacteria	4020
111	Ga0111539_10273147	3300009094	Bacteria	1967
112	Ga0111539_10583581	3300009094	Bacteria	1302
113	Ga0105245_10026033	3300009098	Bacteria	5147
114	Ga0114129_10003165	3300009147	Bacteria	23085
115	Ga0114129_10324278	3300009147	Bacteria	2047
116	Ga0105243_10002569	3300009148	Bacteria	15169
117	Ga0105243_10032653	3300009148	Bacteria	4023
118	Ga0105242_10005337	3300009176	Bacteria	9931
119	Ga0105242_10211746	3300009176	Bacteria	1728
120	Ga0105242_10300932	3300009176	Bacteria	1464
121	Ga0105249_10008025	3300009553	Bacteria	9199
122	Ga0105249_10017573	3300009553	Bacteria	6350
123	Ga0105249_10033380	3300009553	Bacteria	4659
124	Ga0105239_10182689	3300010375	Bacteria	2346
125	Ga0157378_10017676	3300013297	Bacteria	6260
126	Ga0163162_10023311	3300013306	Bacteria	6109
127	Ga0163162_10442379	3300013306	Bacteria	1432
128	Ga0157372_10412071	3300013307	Bacteria	1575
129	Ga0163163_10386565	3300014325	Bacteria	1457
130	Ga0157376_10016340	3300014969	Bacteria	5632
131	Ga0213872_10020935	3300021361	Bacteria	3013
132	Ga0213876_10010605	3300021384	Bacteria	4937
133	Ga0207697_10074392	3300025315	Bacteria	1427
134	Ga0207653_10059513	3300025885	Bacteria	1286
135	Ga0207692_10000073	3300025898	Bacteria	29005
136	Ga0207680_10240052	3300025903	Bacteria	1248
137	Ga0207647_10129736	3300025904	Bacteria	1482
138	Ga0207685_10001201	3300025905	Bacteria	5239
139	Ga0207699_10001951	3300025906	Bacteria	9731
140	Ga0207645_10094013	3300025907	Bacteria	1929
141	Ga0207645_10204497	3300025907	Bacteria	1299
142	Ga0207643_10033050	3300025908	Bacteria	2893
143	Ga0207643_10078169	3300025908	Bacteria	1914
144	Ga0207684_10127087	3300025910	Bacteria	2188
145	Ga0207707_10020057	3300025912	Bacteria	5833
146	Ga0207695_10038583	3300025913	Bacteria	5140
147	Ga0207671_10421418	3300025914	Bacteria	1062
148	Ga0207693_10041377	3300025915	Bacteria	3627
149	Ga0207663_10022203	3300025916	Bacteria	3625
150	Ga0207660_10019929	3300025917	Bacteria	4494
151	Ga0207662_10000953	3300025918	Bacteria	13423
152	Ga0207662_10058161	3300025918	Bacteria	2313
153	Ga0207657_10255520	3300025919	Bacteria	1396
154	Ga0207649_10021559	3300025920	Bacteria	3711
155	Ga0207652_10005518	3300025921	Bacteria	10253
156	Ga0207681_10231578	3300025923	Bacteria	1434
157	Ga0207694_10036678	3300025924	Bacteria	3763
158	Ga0207659_10018191	3300025926	Bacteria	4603
159	Ga0207687_10020099	3300025927	Bacteria	4429
160	Ga0207700_10002308	3300025928	Bacteria	10949
161	Ga0207700_10077086	3300025928	Bacteria	2588
162	Ga0207664_10002203	3300025929	Bacteria	12839
163	Ga0207686_10188026	3300025934	Bacteria	1470
164	Ga0207709_10014755	3300025935	Bacteria	4320
165	Ga0207709_10015973	3300025935	Bacteria	4167
166	Ga0207670_10015089	3300025936	Bacteria	4607
167	Ga0207670_10015283	3300025936	Bacteria	4583
168	Ga0207670_10149157	3300025936	Bacteria	1733
169	Ga0207704_10004892	3300025938	Bacteria	6155
170	Ga0207704_10086660	3300025938	Bacteria	2043
171	Ga0207691_10202574	3300025940	Bacteria	1727
172	Ga0207689_10060040	3300025942	Bacteria	3127
173	Ga0207689_10071265	3300025942	Bacteria	2854
174	Ga0207689_10242636	3300025942	Bacteria	1489
175	Ga0207679_10500239	3300025945	Bacteria	1084
176	Ga0207667_10009161	3300025949	Bacteria	11692
177	Ga0207667_10066083	3300025949	Bacteria	3771
178	Ga0207712_10004759	3300025961	Bacteria	8570
179	Ga0207712_10119674	3300025961	Bacteria	1990
180	Ga0207712_10332600	3300025961	Bacteria	1257
181	Ga0207668_10015913	3300025972	Bacteria	4683
182	Ga0207640_10004854	3300025981	Bacteria	7302
183	Ga0207640_10061970	3300025981	Bacteria	2480
184	Ga0207658_10179743	3300025986	Bacteria	1750
185	Ga0207677_10129799	3300026023	Bacteria	1911
186	Ga0207708_10004694	3300026075	Bacteria	10051
187	Ga0207708_10007120	3300026075	Bacteria	8265
188	Ga0207708_10046266	3300026075	Bacteria	3314
189	Ga0207702_10028548	3300026078	Bacteria	4638
190	Ga0207702_10276204	3300026078	Bacteria	1586
191	Ga0207641_10289853	3300026088	Bacteria	1543
192	Ga0207641_10307180	3300026088	Bacteria	1500
193	Ga0207648_10000238	3300026089	Bacteria	59053
194	Ga0207648_10007300	3300026089	Bacteria	10896
195	Ga0207648_10040208	3300026089	Bacteria	4109
196	Ga0207675_100001083	3300026118	Bacteria	26980
197	Ga0207675_100007203	3300026118	Bacteria	10503
198	Ga0207675_100040231	3300026118	Bacteria	4365
199	Ga0207675_100256900	3300026118	Bacteria	1692
200	Ga0207675_100518982	3300026118	Bacteria	1187
201	Ga0207683_10157179	3300026121	Bacteria	2054
202	Ga0209981_1003934	3300027378	Bacteria	1935
203	Ga0209995_1013364	3300027471	Bacteria	1344
204	Ga0209971_1010152	3300027682	Bacteria	2227
205	Ga0209974_10038533	3300027876	Bacteria	1589
206	Ga0207428_10020619	3300027907	Bacteria	5596
207	Ga0207428_10021886	3300027907	Bacteria	5405
208	Ga0207428_10265079	3300027907	Bacteria	1279
209	Ga0268266_10011364	3300028379	Bacteria	7742
210	Ga0268265_10001655	3300028380	Bacteria	18241
211	Ga0268264_10572153	3300028381	Bacteria	1110
212	Ga0265334_10049885	3300028573	Bacteria	1609
213	Ga0265340_10074745	3300031247	Bacteria	1602
214	Ga0265316_10071045	3300031344	Bacteria	2684
215	Ga0307416_100431962	3300032002	Bacteria	1364
216	Ga0307411_10202837	3300032005	Bacteria	1525
217	Ga0373950_0009117	3300034818	Bacteria	1576
218	Ga0373938_0010026	3300034957	Bacteria	1730
219	Ga0373926_0000727	3300035083	Bacteria	9135
220	Ga0373926_0017944	3300035083	Bacteria	2431
221	Ga0373940_0004706	3300035088	Bacteria	2904
222	Ga0373944_0036683	3300035089	Bacteria	1498
223	Ga0373952_0001215	3300035092	Bacteria	4689
224	Ga0373932_0001922	3300035112	Bacteria	5532
225	Ga0373936_0012624	3300035113	Bacteria	3215
226	Ga0373939_0043573	3300035114	Bacteria	1362
227	Ga0373941_0010886	3300035115	Bacteria	2338
228	Ga0373945_0012991	3300035116	Bacteria	2774
229	Ga0373954_0000071	3300035118	Bacteria	36140
230	Ga0373960_0008016	3300035121	Bacteria	2519
231	Ga0373943_0002563	3300035170	Bacteria	8265
232	Ga0373946_0005223	3300035171	Bacteria	4682
233	Ga0373942_0003706	3300035207	Bacteria	3584
234	Ga0373961_0022581	3300035241	Bacteria	1684
235	Ga0373961_0040012	3300035241	Bacteria	1349
236	Ga0373931_0010151	3300035691	Bacteria	4520
237	Ga0373931_0160964	3300035691	Bacteria	1316
238	Ga0373935_0022922	3300035692	Bacteria	3833
239	Ga0373935_0093840	3300035692	Bacteria	1968
240	Ga0373927_0022719	3300035695	Bacteria	4107
241	Ga0373927_0048238	3300035695	Bacteria	2754
242	Ga0373933_0006966	3300035724	Bacteria	6161
243	Ga0373947_0019259	3300035725	Bacteria	3934
244	Ga0373947_0221217	3300035725	Bacteria	1244
245	Ga0373937_0000282	3300036401	Bacteria	48656
246	Ga0373937_0105716	3300036401	Bacteria	2616
247	Ga0373937_0109804	3300036401	Bacteria	2565
248	Ga0373925_0003559	3300037068	Bacteria	12005
249	Ga0373925_0195186	3300037068	Bacteria	1608
250	Ga0395899_0023110	3300037312	Bacteria	4711
251	Ga0395899_0189323	3300037312	Bacteria	1440
252	Ga0395900_0003439	3300037418	Bacteria	17122
253	Ga0395900_0053653	3300037418	Bacteria	4149
254	Ga0395898_0007003	3300037466	Bacteria	11982
255	Ga0395901_0001004	3300038443	Bacteria	30516
256	Ga0395901_0008299	3300038443	Bacteria	10496
257	Ga0395901_0056148	3300038443	Bacteria	4096
258	Ga0436365_0618909	3300039437	Bacteria	19642
259	Ga0436361_1150609	3300039447	Bacteria	3355
260	Ga0439441_000026	3300042001	Bacteria	11272
261	Ga0439441_011189	3300042001	Bacteria	1518
262	Ga0439443_010979	3300042003	Bacteria	1321
263	Ga0439448_0018509	3300042005	Bacteria	2136
264	Ga0439451_032575	3300042009	Bacteria	1048
265	Ga0450923_011112	3300042125	Bacteria	1613
266	Ga0439435_0000253	3300042436	Bacteria	7765
267	Ga0439435_0007028	3300042436	Bacteria	2558
268	Ga0439460_0003045	3300042461	Bacteria	4049
269	Ga0450893_0006182	3300042532	Bacteria	1933
270	Ga0451577_0116176	3300042876	Bacteria	2396
271	Ga0451577_0551266	3300042876	Bacteria	1047
272	Ga0466963_0142067	3300044694	Bacteria	1663
273	Ga0466957_0231099	3300044842	Bacteria	1224
274	Ga0451576_0007178	3300045051	Bacteria	13426
275	Ga0451576_0050695	3300045051	Bacteria	4352
276	Ga0466967_0003087	3300045976	Bacteria	10707
277	Ga0466967_0185642	3300045976	Bacteria	1963
278	Ga0495592_0025781	3300046454	Bacteria	4462
279	Ga0495603_0015811	3300046455	Bacteria	4562
280	Ga0495629_0101292	3300046459	Bacteria	2010
281	Ga0495580_0018600	3300046472	Bacteria	5171
282	Ga0495582_0015024	3300046473	Bacteria	4258
283	Ga0495639_0002419	3300046475	Bacteria	8156
284	Ga0495608_0001761	3300046511	Bacteria	15451
285	Ga0495618_0093560	3300046514	Bacteria	1922
286	Ga0495642_0027257	3300046528	Bacteria	2273
287	Ga0495665_0034947	3300046531	Bacteria	2687
288	Ga0495586_0045175	3300046535	Bacteria	2373
289	Ga0495587_0028064	3300046536	Bacteria	3427
290	Ga0495621_0138134	3300046539	Bacteria	952
291	Ga0495588_0021948	3300046674	Bacteria	3151
292	Ga0495647_0002172	3300046681	Bacteria	6131
293	Ga0495658_0004465	3300046683	Bacteria	6886
294	Ga0495658_0118600	3300046683	Bacteria	1598
295	Ga0495613_0027382	3300046689	Bacteria	4242
296	Ga0495624_0053660	3300046690	Bacteria	2544
297	Ga0495670_0155689	3300046691	Bacteria	1199
298	Ga0495604_0051744	3300047317	Bacteria	3182
299	Ga0495593_0065552	3300047673	Bacteria	1894
300	Ga0496100_0208241	3300048903	Bacteria	1429
301	Ga0496101_0148692	3300048904	Bacteria	1790
302	Ga0496112_0115875	3300048915	Bacteria	2650
303	Ga0501299_008346	3300049522	Bacteria	1683
304	Ga0501031_0020315	3300049568	Bacteria	4330
305	Ga0501033_0019386	3300049570	Bacteria	5143
306	Ga0501034_0001818	3300049571	Bacteria	27125
307	Ga0501034_0002618	3300049571	Bacteria	21346
308	Ga0501034_0066826	3300049571	Bacteria	3609
309	Ga0501036_0002503	3300049572	Bacteria	14414
310	Ga0501037_0158732	3300049573	Bacteria	1613
311	Ga0501038_0006655	3300049574	Bacteria	10683
312	Ga0501038_0143418	3300049574	Bacteria	1952
313	Ga0501038_0200020	3300049574	Bacteria	1604
314	Ga0501039_0086467	3300049575	Bacteria	2441
315	Ga0501039_0223711	3300049575	Bacteria	1479
316	Ga0501040_0002520	3300049576	Bacteria	11807
317	Ga0501040_0002573	3300049576	Bacteria	11701
318	Ga0501041_0000398	3300049577	Bacteria	21891
319	Ga0501041_0013193	3300049577	Bacteria	4896
320	Ga0501042_0015385	3300049578	Bacteria	5238
321	Ga0501042_0045347	3300049578	Bacteria	3133
322	Ga0501043_0125110	3300049579	Bacteria	2016
323	Ga0501046_0000393	3300049580	Bacteria	43715
324	Ga0501048_0000181	3300049582	Bacteria	39855
325	Ga0501068_0003002	3300049584	Bacteria	8994
326	Ga0501070_0104338	3300049586	Bacteria	2344
327	Ga0501070_0104650	3300049586	Bacteria	2340
328	Ga0501071_0028098	3300049587	Bacteria	3961
329	Ga0501071_0078700	3300049587	Bacteria	2410
330	Ga0501072_0015534	3300049588	Bacteria	5832
331	Ga0501072_0223974	3300049588	Bacteria	1499
332	Ga0501072_0300920	3300049588	Bacteria	1275
333	Ga0501073_0108445	3300049589	Bacteria	1927
334	Ga0501074_0017841	3300049590	Bacteria	5157
335	Ga0501075_0000242	3300049591	Bacteria	29265
336	Ga0501075_0004419	3300049591	Bacteria	9512
337	Ga0501076_0001073	3300049592	Bacteria	17968
338	Ga0501076_0003833	3300049592	Bacteria	10589
339	Ga0501077_0002349	3300049593	Bacteria	11401
340	Ga0501079_0004535	3300049741	Bacteria	10303
341	Ga0501079_0046143	3300049741	Bacteria	3361
342	Ga0501079_0113657	3300049741	Bacteria	2105
343	Ga0501080_0002206	3300049742	Bacteria	16926
344	Ga0501080_0057349	3300049742	Bacteria	3626
345	Ga0501081_0000938	3300049743	Bacteria	17301
346	Ga0501081_0015784	3300049743	Bacteria	4986
347	Ga0501035_0003028	3300049822	Bacteria	16113
348	Ga0501035_0230383	3300049822	Bacteria	1579
349	Ga0501044_0031931	3300049823	Bacteria	5537
350	Ga0501044_0165544	3300049823	Bacteria	2185
351	Ga0501044_0250746	3300049823	Bacteria	1711
352	Ga0501045_0001586	3300049824	Bacteria	15173
353	Ga0501045_0026376	3300049824	Bacteria	4179
354	Ga0501045_0128952	3300049824	Bacteria	1880
355	nmdc:mga03683_23978_c1	3300050489	Bacteria	2383
356	nmdc:mga03683_765_c1	3300050489	Bacteria	9217
357	nmdc:mga0yw44_142385_c1	3300050492	Bacteria	1559
358	nmdc:mga0yw44_27133_c1	3300050492	Bacteria	3277
359	nmdc:mga0k408_74468_c1	3300050493	Bacteria	1984
360	nmdc:mga06z11_171797_c1	3300050494	Bacteria	1245
361	nmdc:mga06z11_194842_c1	3300050494	Bacteria	1174
362	nmdc:mga06z11_57078_c1	3300050494	Bacteria	2021
363	nmdc:mga07m45_3409_c1	3300050496	Bacteria	7663
364	nmdc:mga05p37_222422_c1	3300050507	Bacteria	2278
365	nmdc:mga05p37_338950_c1	3300050507	Bacteria	1773
366	nmdc:mga05p37_34048_c1	3300050507	Bacteria	5117
367	nmdc:mga05p37_448377_c1	3300050507	Bacteria	1494
368	nmdc:mga05p37_495794_c1	3300050507	Bacteria	1403
369	nmdc:mga09592_13793_c1	3300050508	Bacteria	6602
370	nmdc:mga09592_18475_c1	3300050508	Bacteria	5718
371	nmdc:mga09592_207589_c1	3300050508	Bacteria	1697
372	nmdc:mga09592_2090_c1	3300050508	Bacteria	16115
373	nmdc:mga09592_250394_c1	3300050508	Bacteria	1535
374	nmdc:mga0qj67_118917_c1	3300050509	Bacteria	2137
375	nmdc:mga0qj67_12927_c1	3300050509	Bacteria	6299
376	nmdc:mga0qj67_2525_c1	3300050509	Bacteria	13071
377	nmdc:mga0qj67_572492_c1	3300050509	Bacteria	905
378	nmdc:mga06r32_10530_c1	3300050510	Bacteria	8338
379	nmdc:mga06r32_12452_c1	3300050510	Bacteria	7676
380	nmdc:mga06r32_148523_c1	3300050510	Bacteria	2321
381	nmdc:mga06r32_303378_c1	3300050510	Bacteria	1583
382	nmdc:mga06r32_66248_c1	3300050510	Bacteria	3485
383	nmdc:mga08y16_127106_c1	3300050511	Bacteria	2651
384	nmdc:mga08y16_19731_c1	3300050511	Bacteria	7108
385	nmdc:mga08y16_34320_c1	3300050511	Bacteria	5330
386	nmdc:mga08y16_46559_c1	3300050511	Bacteria	4541
387	nmdc:mga08y16_6508_c1	3300050511	Bacteria	12251
388	nmdc:mga08y16_83267_c1	3300050511	Bacteria	3334
389	nmdc:mga0n895_133643_c1	3300050512	Bacteria	2507
390	nmdc:mga0n895_511_c1	3300050512	Bacteria	26369
391	nmdc:mga0rr50_1254_c1	3300050513	Bacteria	13821
392	nmdc:mga0rr50_254461_c1	3300050513	Bacteria	1459
393	nmdc:mga08x19_5039_c1	3300050514	Bacteria	7816
394	nmdc:mga0a205_106_c1	3300050515	Bacteria	48183
395	nmdc:mga0sz30_77_c1	3300050516	Bacteria	37634
396	nmdc:mga0sz30_8760_c1	3300050516	Bacteria	3829
397	Ga0495619_0054458	3300053085	Bacteria	2648
398	Ga0500641_0000186	3300053096	Bacteria	23436
399	Ga0500568_0005346	3300053139	Bacteria	6654
400	Ga0500616_0001083	3300053153	Bacteria	28382
401	Ga0501084_0002815	3300054114	Bacteria	14041
402	Ga0501084_0088895	3300054114	Bacteria	2593
403	Ga0590071_014952	3300059421	Bacteria	1821
404	Ga0501082_0000358	3300060353	Bacteria	40322
405	Ga0501082_0016566	3300060353	Bacteria	6345
406	Ga0530510_0063685	3300061734	Bacteria	2669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046454	Ga0495592_0025781	Ga0495592_0025781_3619_4440	273
2	3300047317	Ga0495604_0051744	Ga0495604_0051744_2339_3160	273
3	3300049586	Ga0501070_0104338	Ga0501070_0104338_13_834	273
4	3300046539	Ga0495621_0138134	Ga0495621_0138134_118_942	274
5	3300050494	nmdc:mga06z11_194842_c1	nmdc:mga06z11_194842_c1_22_846	274
6	3300050509	nmdc:mga0qj67_572492_c1	nmdc:mga0qj67_572492_c1_62_886	274
7	3300005518	Ga0070699_100071116	Ga0070699_1000711162	276
8	3300025942	Ga0207689_10242636	Ga0207689_102426362	277
9	3300035695	Ga0373927_0048238	Ga0373927_0048238_299_1216	305
10	3300025919	Ga0207657_10255520	Ga0207657_102555202	306
11	3300006847	Ga0075431_100000647	Ga0075431_10000064718	307
12	3300034818	Ga0373950_0009117	Ga0373950_0009117_623_1546	307
13	3300042001	Ga0439441_011189	Ga0439441_011189_55_978	307
14	3300050510	nmdc:mga06r32_10530_c1	nmdc:mga06r32_10530_c1_3244_4167	307
15	3300005981	Ga0081538_10008234	Ga0081538_100082348	313
16	3300042003	Ga0439443_010979	Ga0439443_010979_14_976	320
17	3300006038	Ga0075365_10136898	Ga0075365_101368981	323
18	3300006178	Ga0075367_10119255	Ga0075367_101192551	323
19	3300006186	Ga0075369_10007173	Ga0075369_100071733	323
20	3300006353	Ga0075370_10056358	Ga0075370_100563582	323
21	3300050489	nmdc:mga03683_23978_c1	nmdc:mga03683_23978_c1_459_1472	323
22	3300050516	nmdc:mga0sz30_8760_c1	nmdc:mga0sz30_8760_c1_1319_2305	323
23	3300053153	Ga0500616_0001083	Ga0500616_0001083_9940_10926	323
24	3300005367	Ga0070667_100064038	Ga0070667_1000640383	324
25	3300005719	Ga0068861_100038867	Ga0068861_1000388674	324
26	3300009176	Ga0105242_10300932	Ga0105242_103009321	324
27	3300009553	Ga0105249_10017573	Ga0105249_100175735	324
28	3300010375	Ga0105239_10182689	Ga0105239_101826892	324
29	3300013306	Ga0163162_10023311	Ga0163162_100233115	324
30	3300025942	Ga0207689_10071265	Ga0207689_100712653	324
31	3300025986	Ga0207658_10179743	Ga0207658_101797431	324
32	3300026118	Ga0207675_100040231	Ga0207675_1000402313	324
33	3300031247	Ga0265340_10074745	Ga0265340_100747452	324
34	3300005343	Ga0070687_100079261	Ga0070687_1000792613	325
35	3300005435	Ga0070714_100001717	Ga0070714_1000017176	325
36	3300005437	Ga0070710_10000615	Ga0070710_1000061514	325
37	3300005439	Ga0070711_100001965	Ga0070711_1000019658	325
38	3300006163	Ga0070715_10012665	Ga0070715_100126652	325
39	3300006844	Ga0075428_100084187	Ga0075428_1000841872	325
40	3300006847	Ga0075431_100190800	Ga0075431_1001908002	325
41	3300009094	Ga0111539_10004830	Ga0111539_1000483012	325
42	3300009094	Ga0111539_10273147	Ga0111539_102731472	325
43	3300009147	Ga0114129_10324278	Ga0114129_103242782	325
44	3300013307	Ga0157372_10412071	Ga0157372_104120712	325
45	3300025898	Ga0207692_10000073	Ga0207692_1000007314	325
46	3300025905	Ga0207685_10001201	Ga0207685_100012012	325
47	3300025906	Ga0207699_10001951	Ga0207699_100019518	325
48	3300025915	Ga0207693_10041377	Ga0207693_100413772	325
49	3300025916	Ga0207663_10022203	Ga0207663_100222032	325
50	3300025928	Ga0207700_10002308	Ga0207700_100023084	325
51	3300025929	Ga0207664_10002203	Ga0207664_100022033	325
52	3300031344	Ga0265316_10071045	Ga0265316_100710455	325
53	3300035241	Ga0373961_0022581	Ga0373961_0022581_53_1030	325
54	3300048903	Ga0496100_0208241	Ga0496100_0208241_436_1419	325
55	3300048904	Ga0496101_0148692	Ga0496101_0148692_757_1740	325
56	3300049586	Ga0501070_0104650	Ga0501070_0104650_1155_2141	325
57	3300049588	Ga0501072_0223974	Ga0501072_0223974_380_1366	325
58	3300050508	nmdc:mga09592_250394_c1	nmdc:mga09592_250394_c1_330_1313	325
59	3300050510	nmdc:mga06r32_303378_c1	nmdc:mga06r32_303378_c1_529_1512	325
60	3300050513	nmdc:mga0rr50_254461_c1	nmdc:mga0rr50_254461_c1_341_1324	325
61	3300005327	Ga0070658_10255320	Ga0070658_102553202	327
62	3300005336	Ga0070680_100227103	Ga0070680_1002271031	327
63	3300005340	Ga0070689_100097436	Ga0070689_1000974362	327
64	3300005440	Ga0070705_100180656	Ga0070705_1001806562	327
65	3300005444	Ga0070694_100058806	Ga0070694_1000588061	327
66	3300005444	Ga0070694_100083203	Ga0070694_1000832033	327
67	3300005544	Ga0070686_100197543	Ga0070686_1001975432	327
68	3300005545	Ga0070695_100090317	Ga0070695_1000903172	327
69	3300005545	Ga0070695_100284486	Ga0070695_1002844861	327
70	3300005547	Ga0070693_100013135	Ga0070693_1000131353	327
71	3300005549	Ga0070704_100005292	Ga0070704_1000052923	327
72	3300005577	Ga0068857_100112954	Ga0068857_1001129542	327
73	3300005718	Ga0068866_10130366	Ga0068866_101303661	327
74	3300005841	Ga0068863_100335157	Ga0068863_1003351571	327
75	3300005981	Ga0081538_10079656	Ga0081538_100796562	327
76	3300006844	Ga0075428_100051805	Ga0075428_1000518052	327
77	3300006844	Ga0075428_100105661	Ga0075428_1001056611	327
78	3300006846	Ga0075430_100007753	Ga0075430_1000077535	327
79	3300006846	Ga0075430_100026081	Ga0075430_1000260812	327
80	3300006847	Ga0075431_100030839	Ga0075431_1000308392	327
81	3300006871	Ga0075434_100094831	Ga0075434_1000948312	327
82	3300006880	Ga0075429_100009086	Ga0075429_1000090866	327
83	3300006880	Ga0075429_100301597	Ga0075429_1003015972	327
84	3300006881	Ga0068865_100089269	Ga0068865_1000892693	327
85	3300009094	Ga0111539_10060150	Ga0111539_100601503	327
86	3300009094	Ga0111539_10073836	Ga0111539_100738363	327
87	3300009176	Ga0105242_10211746	Ga0105242_102117462	327
88	3300025920	Ga0207649_10021559	Ga0207649_100215592	327
89	3300025934	Ga0207686_10188026	Ga0207686_101880261	327
90	3300025936	Ga0207670_10149157	Ga0207670_101491572	327
91	3300025961	Ga0207712_10332600	Ga0207712_103326001	327
92	3300025981	Ga0207640_10061970	Ga0207640_100619702	327
93	3300026089	Ga0207648_10040208	Ga0207648_100402084	327
94	3300026118	Ga0207675_100256900	Ga0207675_1002569001	327
95	3300027471	Ga0209995_1013364	Ga0209995_10133641	327
96	3300027682	Ga0209971_1010152	Ga0209971_10101522	327
97	3300027876	Ga0209974_10038533	Ga0209974_100385332	327
98	3300027907	Ga0207428_10265079	Ga0207428_102650792	327
99	3300028381	Ga0268264_10572153	Ga0268264_105721532	327
100	3300032002	Ga0307416_100431962	Ga0307416_1004319622	327
101	3300032005	Ga0307411_10202837	Ga0307411_102028372	327
102	3300035088	Ga0373940_0004706	Ga0373940_0004706_919_1905	327
103	3300035118	Ga0373954_0000071	Ga0373954_0000071_23601_24584	327
104	3300035207	Ga0373942_0003706	Ga0373942_0003706_1374_2357	327
105	3300035724	Ga0373933_0006966	Ga0373933_0006966_2558_3541	327
106	3300036401	Ga0373937_0000282	Ga0373937_0000282_25472_26455	327
107	3300036401	Ga0373937_0105716	Ga0373937_0105716_587_1570	327
108	3300042001	Ga0439441_000026	Ga0439441_000026_47_1030	327
109	3300042009	Ga0439451_032575	Ga0439451_032575_40_1023	327
110	3300042436	Ga0439435_0000253	Ga0439435_0000253_4797_5780	327
111	3300042436	Ga0439435_0007028	Ga0439435_0007028_598_1581	327
112	3300042461	Ga0439460_0003045	Ga0439460_0003045_3027_4010	327
113	3300042532	Ga0450893_0006182	Ga0450893_0006182_182_1165	327
114	3300042876	Ga0451577_0551266	Ga0451577_0551266_51_1034	327
115	3300045976	Ga0466967_0003087	Ga0466967_0003087_2794_3798	327
116	3300046459	Ga0495629_0101292	Ga0495629_0101292_317_1300	327
117	3300046511	Ga0495608_0001761	Ga0495608_0001761_8349_9332	327
118	3300046514	Ga0495618_0093560	Ga0495618_0093560_917_1900	327
119	3300046528	Ga0495642_0027257	Ga0495642_0027257_1130_2113	327
120	3300046535	Ga0495586_0045175	Ga0495586_0045175_1211_2194	327
121	3300046536	Ga0495587_0028064	Ga0495587_0028064_2211_3194	327
122	3300046683	Ga0495658_0118600	Ga0495658_0118600_19_1002	327
123	3300046689	Ga0495613_0027382	Ga0495613_0027382_2445_3428	327
124	3300046690	Ga0495624_0053660	Ga0495624_0053660_728_1711	327
125	3300047673	Ga0495593_0065552	Ga0495593_0065552_82_1065	327
126	3300049522	Ga0501299_008346	Ga0501299_008346_451_1434	327
127	3300049568	Ga0501031_0020315	Ga0501031_0020315_1191_2174	327
128	3300049570	Ga0501033_0019386	Ga0501033_0019386_3040_4023	327
129	3300049572	Ga0501036_0002503	Ga0501036_0002503_3692_4675	327
130	3300049573	Ga0501037_0158732	Ga0501037_0158732_102_1085	327
131	3300049574	Ga0501038_0006655	Ga0501038_0006655_6450_7433	327
132	3300049574	Ga0501038_0143418	Ga0501038_0143418_947_1930	327
133	3300049574	Ga0501038_0200020	Ga0501038_0200020_111_1094	327
134	3300049575	Ga0501039_0086467	Ga0501039_0086467_174_1157	327
135	3300049575	Ga0501039_0223711	Ga0501039_0223711_450_1433	327
136	3300049576	Ga0501040_0002520	Ga0501040_0002520_8097_9080	327
137	3300049576	Ga0501040_0002573	Ga0501040_0002573_1441_2424	327
138	3300049577	Ga0501041_0000398	Ga0501041_0000398_14997_15980	327
139	3300049577	Ga0501041_0013193	Ga0501041_0013193_1781_2764	327
140	3300049578	Ga0501042_0015385	Ga0501042_0015385_3906_4889	327
141	3300049578	Ga0501042_0045347	Ga0501042_0045347_1120_2103	327
142	3300049580	Ga0501046_0000393	Ga0501046_0000393_41598_42581	327
143	3300049582	Ga0501048_0000181	Ga0501048_0000181_14566_15549	327
144	3300049584	Ga0501068_0003002	Ga0501068_0003002_3412_4395	327
145	3300049587	Ga0501071_0028098	Ga0501071_0028098_62_1045	327
146	3300049587	Ga0501071_0078700	Ga0501071_0078700_735_1718	327
147	3300049588	Ga0501072_0015534	Ga0501072_0015534_4067_5050	327
148	3300049588	Ga0501072_0300920	Ga0501072_0300920_32_1015	327
149	3300049589	Ga0501073_0108445	Ga0501073_0108445_700_1683	327
150	3300049590	Ga0501074_0017841	Ga0501074_0017841_3294_4277	327
151	3300049591	Ga0501075_0000242	Ga0501075_0000242_25010_25993	327
152	3300049591	Ga0501075_0004419	Ga0501075_0004419_2820_3803	327
153	3300049592	Ga0501076_0001073	Ga0501076_0001073_15402_16385	327
154	3300049592	Ga0501076_0003833	Ga0501076_0003833_2399_3382	327
155	3300049593	Ga0501077_0002349	Ga0501077_0002349_4403_5386	327
156	3300049741	Ga0501079_0004535	Ga0501079_0004535_60_1043	327
157	3300049741	Ga0501079_0046143	Ga0501079_0046143_1244_2227	327
158	3300049741	Ga0501079_0113657	Ga0501079_0113657_496_1479	327
159	3300049742	Ga0501080_0002206	Ga0501080_0002206_10068_11051	327
160	3300049742	Ga0501080_0057349	Ga0501080_0057349_1154_2137	327
161	3300049743	Ga0501081_0000938	Ga0501081_0000938_15056_16039	327
162	3300049743	Ga0501081_0015784	Ga0501081_0015784_66_1049	327
163	3300049822	Ga0501035_0003028	Ga0501035_0003028_10193_11176	327
164	3300049822	Ga0501035_0230383	Ga0501035_0230383_38_1021	327
165	3300049823	Ga0501044_0165544	Ga0501044_0165544_651_1634	327
166	3300049824	Ga0501045_0001586	Ga0501045_0001586_13690_14673	327
167	3300049824	Ga0501045_0026376	Ga0501045_0026376_439_1422	327
168	3300049824	Ga0501045_0128952	Ga0501045_0128952_680_1663	327
169	3300050507	nmdc:mga05p37_34048_c1	nmdc:mga05p37_34048_c1_2142_3125	327
170	3300050507	nmdc:mga05p37_448377_c1	nmdc:mga05p37_448377_c1_296_1282	327
171	3300050508	nmdc:mga09592_13793_c1	nmdc:mga09592_13793_c1_2979_3962	327
172	3300050508	nmdc:mga09592_18475_c1	nmdc:mga09592_18475_c1_4304_5287	327
173	3300050509	nmdc:mga0qj67_118917_c1	nmdc:mga0qj67_118917_c1_779_1762	327
174	3300050509	nmdc:mga0qj67_12927_c1	nmdc:mga0qj67_12927_c1_1554_2537	327
175	3300050509	nmdc:mga0qj67_2525_c1	nmdc:mga0qj67_2525_c1_11152_12135	327
176	3300050510	nmdc:mga06r32_12452_c1	nmdc:mga06r32_12452_c1_4438_5421	327
177	3300050510	nmdc:mga06r32_148523_c1	nmdc:mga06r32_148523_c1_350_1333	327
178	3300050510	nmdc:mga06r32_66248_c1	nmdc:mga06r32_66248_c1_1373_2356	327
179	3300050511	nmdc:mga08y16_19731_c1	nmdc:mga08y16_19731_c1_1435_2418	327
180	3300050511	nmdc:mga08y16_34320_c1	nmdc:mga08y16_34320_c1_2531_3514	327
181	3300050512	nmdc:mga0n895_133643_c1	nmdc:mga0n895_133643_c1_260_1249	327
182	3300053085	Ga0495619_0054458	Ga0495619_0054458_1604_2587	327
183	3300053096	Ga0500641_0000186	Ga0500641_0000186_1564_2565	327
184	3300054114	Ga0501084_0002815	Ga0501084_0002815_2335_3318	327
185	3300054114	Ga0501084_0088895	Ga0501084_0088895_1150_2133	327
186	3300059421	Ga0590071_014952	Ga0590071_014952_603_1586	327
187	3300060353	Ga0501082_0000358	Ga0501082_0000358_25138_26121	327
188	3300060353	Ga0501082_0016566	Ga0501082_0016566_5176_6159	327
189	3300061734	Ga0530510_0063685	Ga0530510_0063685_1095_2078	327
190	3300005295	Ga0065707_10008820	Ga0065707_100088203	328
191	3300005295	Ga0065707_10135065	Ga0065707_101350652	328
192	3300005327	Ga0070658_10005298	Ga0070658_100052986	328
193	3300005329	Ga0070683_100052087	Ga0070683_1000520872	328
194	3300005330	Ga0070690_100000841	Ga0070690_1000008414	328
195	3300005334	Ga0068869_100001651	Ga0068869_1000016514	328
196	3300005335	Ga0070666_10149100	Ga0070666_101491002	328
197	3300005336	Ga0070680_100001241	Ga0070680_1000012415	328
198	3300005337	Ga0070682_100011140	Ga0070682_1000111402	328
199	3300005338	Ga0068868_100004039	Ga0068868_1000040399	328
200	3300005340	Ga0070689_100150351	Ga0070689_1001503512	328
201	3300005341	Ga0070691_10022378	Ga0070691_100223782	328
202	3300005343	Ga0070687_100000713	Ga0070687_1000007134	328
203	3300005345	Ga0070692_10008183	Ga0070692_100081833	328
204	3300005353	Ga0070669_100226914	Ga0070669_1002269142	328
205	3300005354	Ga0070675_100098135	Ga0070675_1000981352	328
206	3300005436	Ga0070713_100108891	Ga0070713_1001088912	328
207	3300005437	Ga0070710_10073068	Ga0070710_100730682	328
208	3300005438	Ga0070701_10011337	Ga0070701_100113374	328
209	3300005438	Ga0070701_10073381	Ga0070701_100733811	328
210	3300005441	Ga0070700_100001890	Ga0070700_10000189011	328
211	3300005444	Ga0070694_100011477	Ga0070694_1000114773	328
212	3300005458	Ga0070681_10003085	Ga0070681_1000308514	328
213	3300005459	Ga0068867_100000640	Ga0068867_1000006405	328
214	3300005459	Ga0068867_100026035	Ga0068867_1000260352	328
215	3300005467	Ga0070706_100082746	Ga0070706_1000827462	328
216	3300005468	Ga0070707_100331883	Ga0070707_1003318831	328
217	3300005471	Ga0070698_100004749	Ga0070698_1000047492	328
218	3300005518	Ga0070699_100137863	Ga0070699_1001378631	328
219	3300005530	Ga0070679_100005398	Ga0070679_1000053986	328
220	3300005546	Ga0070696_100000527	Ga0070696_10000052710	328
221	3300005546	Ga0070696_100002762	Ga0070696_1000027629	328
222	3300005547	Ga0070693_100001459	Ga0070693_1000014594	328
223	3300005548	Ga0070665_100126997	Ga0070665_1001269972	328
224	3300005549	Ga0070704_100002169	Ga0070704_1000021695	328
225	3300005563	Ga0068855_100291339	Ga0068855_1002913392	328
226	3300005564	Ga0070664_100070708	Ga0070664_1000707082	328
227	3300005578	Ga0068854_100013384	Ga0068854_1000133843	328
228	3300005578	Ga0068854_100119514	Ga0068854_1001195142	328
229	3300005614	Ga0068856_100016600	Ga0068856_1000166005	328
230	3300005614	Ga0068856_100049328	Ga0068856_1000493286	328
231	3300005614	Ga0068856_100349116	Ga0068856_1003491162	328
232	3300005615	Ga0070702_100005829	Ga0070702_1000058293	328
233	3300005615	Ga0070702_100070951	Ga0070702_1000709512	328
234	3300005618	Ga0068864_100128626	Ga0068864_1001286263	328
235	3300005718	Ga0068866_10001344	Ga0068866_100013449	328
236	3300005719	Ga0068861_100000456	Ga0068861_1000004565	328
237	3300005841	Ga0068863_100040665	Ga0068863_1000406656	328
238	3300005844	Ga0068862_100003371	Ga0068862_10000337110	328
239	3300005937	Ga0081455_10000243	Ga0081455_100002436	328
240	3300005937	Ga0081455_10017097	Ga0081455_100170978	328
241	3300005985	Ga0081539_10001920	Ga0081539_1000192012	328
242	3300005985	Ga0081539_10005219	Ga0081539_1000521913	328
243	3300006038	Ga0075365_10162055	Ga0075365_101620552	328
244	3300006177	Ga0075362_10008147	Ga0075362_100081474	328
245	3300006237	Ga0097621_100005085	Ga0097621_1000050854	328
246	3300006353	Ga0075370_10003641	Ga0075370_100036414	328
247	3300006358	Ga0068871_100035054	Ga0068871_1000350542	328
248	3300006844	Ga0075428_100002876	Ga0075428_10000287611	328
249	3300006847	Ga0075431_100250997	Ga0075431_1002509972	328
250	3300006871	Ga0075434_100000221	Ga0075434_10000022136	328
251	3300006881	Ga0068865_100002491	Ga0068865_1000024914	328
252	3300006881	Ga0068865_100051202	Ga0068865_1000512023	328
253	3300006914	Ga0075436_100001742	Ga0075436_10000174214	328
254	3300007076	Ga0075435_100000249	Ga0075435_1000002496	328
255	3300007265	Ga0099794_10055086	Ga0099794_100550862	328
256	3300009094	Ga0111539_10005703	Ga0111539_1000570310	328
257	3300009094	Ga0111539_10583581	Ga0111539_105835812	328
258	3300009098	Ga0105245_10026033	Ga0105245_100260332	328
259	3300009147	Ga0114129_10003165	Ga0114129_1000316511	328
260	3300009148	Ga0105243_10002569	Ga0105243_1000256910	328
261	3300009148	Ga0105243_10032653	Ga0105243_100326535	328
262	3300009176	Ga0105242_10005337	Ga0105242_100053372	328
263	3300009553	Ga0105249_10008025	Ga0105249_100080253	328
264	3300009553	Ga0105249_10033380	Ga0105249_100333803	328
265	3300013297	Ga0157378_10017676	Ga0157378_100176765	328
266	3300013306	Ga0163162_10442379	Ga0163162_104423792	328
267	3300014325	Ga0163163_10386565	Ga0163163_103865652	328
268	3300014969	Ga0157376_10016340	Ga0157376_100163405	328
269	3300021361	Ga0213872_10020935	Ga0213872_100209352	328
270	3300021384	Ga0213876_10010605	Ga0213876_100106053	328
271	3300025315	Ga0207697_10074392	Ga0207697_100743922	328
272	3300025885	Ga0207653_10059513	Ga0207653_100595131	328
273	3300025903	Ga0207680_10240052	Ga0207680_102400522	328
274	3300025904	Ga0207647_10129736	Ga0207647_101297362	328
275	3300025907	Ga0207645_10094013	Ga0207645_100940132	328
276	3300025907	Ga0207645_10204497	Ga0207645_102044972	328
277	3300025908	Ga0207643_10033050	Ga0207643_100330502	328
278	3300025908	Ga0207643_10078169	Ga0207643_100781692	328
279	3300025910	Ga0207684_10127087	Ga0207684_101270872	328
280	3300025912	Ga0207707_10020057	Ga0207707_100200574	328
281	3300025913	Ga0207695_10038583	Ga0207695_100385831	328
282	3300025914	Ga0207671_10421418	Ga0207671_104214181	328
283	3300025917	Ga0207660_10019929	Ga0207660_100199292	328
284	3300025918	Ga0207662_10000953	Ga0207662_1000095313	328
285	3300025918	Ga0207662_10058161	Ga0207662_100581612	328
286	3300025921	Ga0207652_10005518	Ga0207652_100055184	328
287	3300025923	Ga0207681_10231578	Ga0207681_102315782	328
288	3300025924	Ga0207694_10036678	Ga0207694_100366782	328
289	3300025926	Ga0207659_10018191	Ga0207659_100181912	328
290	3300025927	Ga0207687_10020099	Ga0207687_100200994	328
291	3300025928	Ga0207700_10077086	Ga0207700_100770862	328
292	3300025935	Ga0207709_10014755	Ga0207709_100147552	328
293	3300025935	Ga0207709_10015973	Ga0207709_100159732	328
294	3300025936	Ga0207670_10015089	Ga0207670_100150894	328
295	3300025936	Ga0207670_10015283	Ga0207670_100152832	328
296	3300025938	Ga0207704_10004892	Ga0207704_100048924	328
297	3300025938	Ga0207704_10086660	Ga0207704_100866602	328
298	3300025940	Ga0207691_10202574	Ga0207691_102025742	328
299	3300025942	Ga0207689_10060040	Ga0207689_100600402	328
300	3300025945	Ga0207679_10500239	Ga0207679_105002391	328
301	3300025949	Ga0207667_10009161	Ga0207667_100091612	328
302	3300025949	Ga0207667_10066083	Ga0207667_100660834	328
303	3300025961	Ga0207712_10004759	Ga0207712_100047597	328
304	3300025961	Ga0207712_10119674	Ga0207712_101196742	328
305	3300025972	Ga0207668_10015913	Ga0207668_100159133	328
306	3300025981	Ga0207640_10004854	Ga0207640_100048544	328
307	3300026023	Ga0207677_10129799	Ga0207677_101297992	328
308	3300026075	Ga0207708_10004694	Ga0207708_1000469411	328
309	3300026075	Ga0207708_10007120	Ga0207708_100071202	328
310	3300026075	Ga0207708_10046266	Ga0207708_100462662	328
311	3300026078	Ga0207702_10028548	Ga0207702_100285484	328
312	3300026078	Ga0207702_10276204	Ga0207702_102762042	328
313	3300026088	Ga0207641_10289853	Ga0207641_102898532	328
314	3300026088	Ga0207641_10307180	Ga0207641_103071802	328
315	3300026089	Ga0207648_10000238	Ga0207648_100002388	328
316	3300026089	Ga0207648_10007300	Ga0207648_1000730010	328
317	3300026118	Ga0207675_100001083	Ga0207675_10000108318	328
318	3300026118	Ga0207675_100007203	Ga0207675_1000072037	328
319	3300026118	Ga0207675_100518982	Ga0207675_1005189822	328
320	3300026121	Ga0207683_10157179	Ga0207683_101571792	328
321	3300027378	Ga0209981_1003934	Ga0209981_10039343	328
322	3300027907	Ga0207428_10020619	Ga0207428_100206194	328
323	3300027907	Ga0207428_10021886	Ga0207428_100218865	328
324	3300028379	Ga0268266_10011364	Ga0268266_100113647	328
325	3300028380	Ga0268265_10001655	Ga0268265_1000165512	328
326	3300028573	Ga0265334_10049885	Ga0265334_100498851	328
327	3300034957	Ga0373938_0010026	Ga0373938_0010026_68_1057	328
328	3300035083	Ga0373926_0000727	Ga0373926_0000727_5195_6181	328
329	3300035083	Ga0373926_0017944	Ga0373926_0017944_1135_2121	328
330	3300035089	Ga0373944_0036683	Ga0373944_0036683_141_1127	328
331	3300035092	Ga0373952_0001215	Ga0373952_0001215_1837_2823	328
332	3300035112	Ga0373932_0001922	Ga0373932_0001922_1497_2483	328
333	3300035113	Ga0373936_0012624	Ga0373936_0012624_161_1147	328
334	3300035114	Ga0373939_0043573	Ga0373939_0043573_203_1189	328
335	3300035115	Ga0373941_0010886	Ga0373941_0010886_156_1142	328
336	3300035116	Ga0373945_0012991	Ga0373945_0012991_1405_2391	328
337	3300035121	Ga0373960_0008016	Ga0373960_0008016_1039_2025	328
338	3300035170	Ga0373943_0002563	Ga0373943_0002563_7023_8009	328
339	3300035171	Ga0373946_0005223	Ga0373946_0005223_2316_3302	328
340	3300035241	Ga0373961_0040012	Ga0373961_0040012_65_1051	328
341	3300035691	Ga0373931_0010151	Ga0373931_0010151_2959_3945	328
342	3300035691	Ga0373931_0160964	Ga0373931_0160964_24_1028	328
343	3300035692	Ga0373935_0022922	Ga0373935_0022922_1602_2588	328
344	3300035692	Ga0373935_0093840	Ga0373935_0093840_861_1847	328
345	3300035695	Ga0373927_0022719	Ga0373927_0022719_1155_2141	328
346	3300035725	Ga0373947_0019259	Ga0373947_0019259_2704_3690	328
347	3300035725	Ga0373947_0221217	Ga0373947_0221217_245_1231	328
348	3300036401	Ga0373937_0109804	Ga0373937_0109804_994_1995	328
349	3300037068	Ga0373925_0003559	Ga0373925_0003559_2767_3753	328
350	3300037068	Ga0373925_0195186	Ga0373925_0195186_12_1013	328
351	3300037312	Ga0395899_0023110	Ga0395899_0023110_2263_3267	328
352	3300037312	Ga0395899_0189323	Ga0395899_0189323_61_1065	328
353	3300037418	Ga0395900_0003439	Ga0395900_0003439_7310_8314	328
354	3300037418	Ga0395900_0053653	Ga0395900_0053653_2562_3566	328
355	3300037466	Ga0395898_0007003	Ga0395898_0007003_408_1412	328
356	3300038443	Ga0395901_0001004	Ga0395901_0001004_21966_22970	328
357	3300038443	Ga0395901_0008299	Ga0395901_0008299_7651_8655	328
358	3300038443	Ga0395901_0056148	Ga0395901_0056148_359_1363	328
359	3300039437	Ga0436365_0618909	Ga0436365_0618909_14334_15326	328
360	3300039447	Ga0436361_1150609	Ga0436361_1150609_1405_2409	328
361	3300042005	Ga0439448_0018509	Ga0439448_0018509_134_1138	328
362	3300042125	Ga0450923_011112	Ga0450923_011112_281_1267	328
363	3300042876	Ga0451577_0116176	Ga0451577_0116176_156_1142	328
364	3300044694	Ga0466963_0142067	Ga0466963_0142067_306_1310	328
365	3300044842	Ga0466957_0231099	Ga0466957_0231099_27_1031	328
366	3300045051	Ga0451576_0007178	Ga0451576_0007178_330_1316	328
367	3300045051	Ga0451576_0050695	Ga0451576_0050695_729_1715	328
368	3300045976	Ga0466967_0185642	Ga0466967_0185642_435_1439	328
369	3300046455	Ga0495603_0015811	Ga0495603_0015811_2400_3386	328
370	3300046472	Ga0495580_0018600	Ga0495580_0018600_4149_5135	328
371	3300046473	Ga0495582_0015024	Ga0495582_0015024_94_1080	328
372	3300046475	Ga0495639_0002419	Ga0495639_0002419_2874_3860	328
373	3300046531	Ga0495665_0034947	Ga0495665_0034947_931_1917	328
374	3300046674	Ga0495588_0021948	Ga0495588_0021948_749_1735	328
375	3300046681	Ga0495647_0002172	Ga0495647_0002172_2878_3864	328
376	3300046683	Ga0495658_0004465	Ga0495658_0004465_2378_3364	328
377	3300046691	Ga0495670_0155689	Ga0495670_0155689_81_1067	328
378	3300048915	Ga0496112_0115875	Ga0496112_0115875_1211_2215	328
379	3300049571	Ga0501034_0001818	Ga0501034_0001818_1157_2161	328
380	3300049571	Ga0501034_0002618	Ga0501034_0002618_12276_13280	328
381	3300049571	Ga0501034_0066826	Ga0501034_0066826_519_1523	328
382	3300049579	Ga0501043_0125110	Ga0501043_0125110_159_1163	328
383	3300049823	Ga0501044_0031931	Ga0501044_0031931_161_1165	328
384	3300049823	Ga0501044_0250746	Ga0501044_0250746_635_1639	328
385	3300050489	nmdc:mga03683_765_c1	nmdc:mga03683_765_c1_7097_8101	328
386	3300050492	nmdc:mga0yw44_142385_c1	nmdc:mga0yw44_142385_c1_281_1306	328
387	3300050492	nmdc:mga0yw44_27133_c1	nmdc:mga0yw44_27133_c1_202_1203	328
388	3300050493	nmdc:mga0k408_74468_c1	nmdc:mga0k408_74468_c1_42_1046	328
389	3300050494	nmdc:mga06z11_171797_c1	nmdc:mga06z11_171797_c1_191_1216	328
390	3300050494	nmdc:mga06z11_57078_c1	nmdc:mga06z11_57078_c1_969_1973	328
391	3300050496	nmdc:mga07m45_3409_c1	nmdc:mga07m45_3409_c1_2090_3094	328
392	3300050507	nmdc:mga05p37_222422_c1	nmdc:mga05p37_222422_c1_363_1349	328
393	3300050507	nmdc:mga05p37_338950_c1	nmdc:mga05p37_338950_c1_113_1099	328
394	3300050507	nmdc:mga05p37_495794_c1	nmdc:mga05p37_495794_c1_42_1028	328
395	3300050508	nmdc:mga09592_207589_c1	nmdc:mga09592_207589_c1_599_1585	328
396	3300050508	nmdc:mga09592_2090_c1	nmdc:mga09592_2090_c1_685_1671	328
397	3300050511	nmdc:mga08y16_127106_c1	nmdc:mga08y16_127106_c1_1209_2234	328
398	3300050511	nmdc:mga08y16_46559_c1	nmdc:mga08y16_46559_c1_930_1916	328
399	3300050511	nmdc:mga08y16_6508_c1	nmdc:mga08y16_6508_c1_6652_7638	328
400	3300050511	nmdc:mga08y16_83267_c1	nmdc:mga08y16_83267_c1_354_1340	328
401	3300050512	nmdc:mga0n895_511_c1	nmdc:mga0n895_511_c1_11057_12043	328
402	3300050513	nmdc:mga0rr50_1254_c1	nmdc:mga0rr50_1254_c1_10447_11433	328
403	3300050514	nmdc:mga08x19_5039_c1	nmdc:mga08x19_5039_c1_2344_3330	328
404	3300050515	nmdc:mga0a205_106_c1	nmdc:mga0a205_106_c1_37077_38063	328
405	3300050516	nmdc:mga0sz30_77_c1	nmdc:mga0sz30_77_c1_3632_4636	328
406	3300053139	Ga0500568_0005346	Ga0500568_0005346_908_1900	328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

28

321

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3v0u-assembly1.cif.gz_A	crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding	0.9365	1	310
3v0t-assembly1.cif.gz_A	crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding	0.9288	1	309
1pz0-assembly1.cif.gz_A	structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo)	0.9279	2	309
8hnq-assembly1.cif.gz_A	the structure of a alcohol dehydrogenase akr13b2 with nadp	0.9179	3	304
3n2t-assembly1.cif.gz_A	structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans	0.9172	3	307

ID	Description	Score	Start	End	Superfamily
af_F4HPY8_8_325_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9752	1	320	3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9463	68	320	3.20.20.100
af_P49249_9_269_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9432	2	255	3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.942	1	214	3.20.20.100
af_Q2G0G6_3_309_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9418	2	309	3.20.20.100

ID	Description	Score	Start	End	GO Terms
AF-A0A521YKN2-F1-model_v4	Aldo/keto reductase	0.9789	1	328	GO:0004033 GO:0005737
AF-A0A4Y9N7P7-F1-model_v4	Aldo/keto reductase	0.9776	2	318	GO:0004033 GO:0005737
AF-A0A521YKN2-F1-model_v4	Aldo/keto reductase	0.9759	1	328	GO:0004033 GO:0005737
AF-A0A7C8ZCS5-F1-model_v4	Pyridoxine 4-dehydrogenase (EC 1.1.1.65)	0.9701	61	161	GO:0005737 GO:0050236
AF-A0A849IN34-F1-model_v4	Aldo/keto reductase	0.9699	23	204	GO:0004033 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
93.63	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436337

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00248

Aldo_ket_red

Aldo/keto reductase family

28

321

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map