F436333

General Info

Members Datasets Scaffolds Average Seq Length
406 228 812 136

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_1534432|Ga0501079_1534432_17_511
Length 164
Sequence VTADFIRSHVKRKRMSLQPAPNKIAHIGIAVKSLDDALPFYTEQLGLPLLGAEEVASEQVRVAFLGIGESRIELLEPLGPDSPIARFIEKRGEGIHHIALDVDDVNERLLRLRENGVPLIHETAKPGAHGAQIAFLHPKGAHGVLYELCQAPKASASKEETAHE

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
149 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
155 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
188 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
189 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
190 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
191 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
214 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
218 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
219 2738541278 Niastella sp. CF465 Isolate Unclassified
220 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
221 2857581216 Bacillus sp. R-71922 Isolate Unclassified
222 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
223 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
224 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
225 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
226 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
227 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
228 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 0
Rhizoplane 1.72
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 16.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_1534432 3300049741 Bacteria 524
2 JGI24740J21852_10025860 3300001979 Bacteria 1972
3 rootH2_10021908 3300003320 Bacteria 1150
4 rootL2_10131882 3300003322 Bacteria 1659
5 rootL2_10184537 3300003322 Bacteria 1062
6 rootL2_10338352 3300003322 Bacteria 2622
7 rootH1_10107858 3300003323 Bacteria 4813
8 rootH1_10127229 3300003323 Bacteria 9000
9 Ga0055531_10000212 3300003794 Bacteria 63711
10 Ga0065704_10311843 3300005289 Unclassified 867
11 Ga0065712_10006494 3300005290 Bacteria 2604
12 Ga0065712_10023990 3300005290 Bacteria 1055
13 Ga0065712_10372696 3300005290 Bacteria 732
14 Ga0065715_10233535 3300005293 Bacteria 1223
15 Ga0065707_10026114 3300005295 Unclassified 1447
16 Ga0065707_10417628 3300005295 Bacteria 833
17 Ga0070676_10265602 3300005328 Bacteria 1151
18 Ga0070683_101530395 3300005329 Bacteria 641
19 Ga0070670_100380465 3300005331 Bacteria 1243
20 Ga0070677_10387736 3300005333 Unclassified 733
21 Ga0068869_100010086 3300005334 Bacteria 6145
22 Ga0068869_100051880 3300005334 Bacteria 2977
23 Ga0068869_100105836 3300005334 Bacteria 2134
24 Ga0070666_10000086 3300005335 Bacteria 66096
25 Ga0070666_10354613 3300005335 Bacteria 1050
26 Ga0068868_100054791 3300005338 Bacteria 3144
27 Ga0068868_100257150 3300005338 Bacteria 1471
28 Ga0068868_100266609 3300005338 Bacteria 1446
29 Ga0068868_100349397 3300005338 Unclassified 1266
30 Ga0070689_100096235 3300005340 Bacteria 2340
31 Ga0070689_100963566 3300005340 Bacteria 757
32 Ga0070689_101455947 3300005340 Bacteria 620
33 Ga0070661_101443639 3300005344 Bacteria 579
34 Ga0070668_100009486 3300005347 Bacteria 7221
35 Ga0070668_100048029 3300005347 Bacteria 3282
36 Ga0070668_100479170 3300005347 Bacteria 1074
37 Ga0070668_100559166 3300005347 Bacteria 997
38 Ga0070669_100001129 3300005353 Bacteria 19498
39 Ga0070669_100068304 3300005353 Bacteria 2623
40 Ga0070669_100664524 3300005353 Unclassified 877
41 Ga0070669_100947896 3300005353 Unclassified 737
42 Ga0070675_100047604 3300005354 Bacteria 3513
43 Ga0070675_100258805 3300005354 Unclassified 1524
44 Ga0070675_100406007 3300005354 Bacteria 1216
45 Ga0070671_100031452 3300005355 Bacteria 4384
46 Ga0070671_100083523 3300005355 Bacteria 2670
47 Ga0070671_100706199 3300005355 Bacteria 875
48 Ga0070674_100001512 3300005356 Bacteria 12398
49 Ga0070674_100288684 3300005356 Bacteria 1303
50 Ga0070673_100015051 3300005364 Bacteria 5414
51 Ga0070673_100279849 3300005364 Bacteria 1463
52 Ga0070673_100557565 3300005364 Bacteria 1041
53 Ga0070688_100000319 3300005365 Bacteria 24587
54 Ga0070688_100060708 3300005365 Bacteria 2388
55 Ga0070688_100186711 3300005365 Unclassified 1441
56 Ga0070688_100662707 3300005365 Bacteria 805
57 Ga0070667_100012384 3300005367 Bacteria 7056
58 Ga0070713_102073799 3300005436 Bacteria 551
59 Ga0070700_100199158 3300005441 Unclassified 1406
60 Ga0070700_101424984 3300005441 Bacteria 586
61 Ga0070678_101000666 3300005456 Bacteria 768
62 Ga0068867_100058753 3300005459 Bacteria 2850
63 Ga0068867_100276573 3300005459 Bacteria 1375
64 Ga0070698_100007666 3300005471 Bacteria 11677
65 Ga0070698_100845560 3300005471 Bacteria 860
66 Ga0070672_100012659 3300005543 Bacteria 5935
67 Ga0070672_100061012 3300005543 Bacteria 2971
68 Ga0070672_100157508 3300005543 Bacteria 1882
69 Ga0070672_100760694 3300005543 Unclassified 851
70 Ga0070672_100837329 3300005543 Bacteria 811
71 Ga0070672_100904371 3300005543 Bacteria 780
72 Ga0070686_100011207 3300005544 Bacteria 5080
73 Ga0070686_100534266 3300005544 Bacteria 915
74 Ga0070695_100286624 3300005545 Bacteria 1212
75 Ga0070704_100150977 3300005549 Bacteria 1826
76 Ga0070664_101842057 3300005564 Bacteria 574
77 Ga0068857_100439085 3300005577 Bacteria 1219
78 Ga0068857_102264811 3300005577 Unclassified 533
79 Ga0068854_100622814 3300005578 Bacteria 924
80 Ga0068854_101160557 3300005578 Bacteria 690
81 Ga0070702_100012344 3300005615 Bacteria 4277
82 Ga0070702_101121087 3300005615 Bacteria 630
83 Ga0068852_100014410 3300005616 Bacteria 6087
84 Ga0068852_100265794 3300005616 Bacteria 1649
85 Ga0068852_100510063 3300005616 Bacteria 1199
86 Ga0068859_100001806 3300005617 Bacteria 21791
87 Ga0068859_100007017 3300005617 Bacteria 11435
88 Ga0068859_100971008 3300005617 Bacteria 932
89 Ga0068859_101200885 3300005617 Unclassified 835
90 Ga0068864_100019334 3300005618 Bacteria 5694
91 Ga0068864_100483094 3300005618 Bacteria 1189
92 Ga0068864_100545889 3300005618 Unclassified 1120
93 Ga0068866_10541761 3300005718 Bacteria 777
94 Ga0068861_100001569 3300005719 Bacteria 14529
95 Ga0068861_101485206 3300005719 Bacteria 664
96 Ga0068861_101616700 3300005719 Bacteria 639
97 Ga0068851_10129381 3300005834 Bacteria 1364
98 Ga0068870_10579283 3300005840 Unclassified 760
99 Ga0068863_100012123 3300005841 Bacteria 8328
100 Ga0068863_100153197 3300005841 Unclassified 2206
101 Ga0068863_100176857 3300005841 Bacteria 2048
102 Ga0068863_100394574 3300005841 Unclassified 1353
103 Ga0068863_100839195 3300005841 Unclassified 917
104 Ga0068858_100022807 3300005842 Bacteria 5838
105 Ga0068860_100003164 3300005843 Bacteria 16987
106 Ga0068860_100903384 3300005843 Bacteria 899
107 Ga0068860_101067638 3300005843 Unclassified 826
108 Ga0068860_101125479 3300005843 Bacteria 805
109 Ga0075366_10075755 3300006195 Bacteria 2007
110 Ga0075366_10079092 3300006195 Bacteria 1962
111 Ga0075366_10645415 3300006195 Bacteria 657
112 Ga0097621_100046644 3300006237 Bacteria 3507
113 Ga0097621_100287132 3300006237 Unclassified 1449
114 Ga0068871_100321717 3300006358 Unclassified 1362
115 Ga0068871_100618053 3300006358 Bacteria 987
116 Ga0075428_100202469 3300006844 Bacteria 2146
117 Ga0075430_100492146 3300006846 Bacteria 1012
118 Ga0075433_10732368 3300006852 Bacteria 865
119 Ga0075429_100003044 3300006880 Bacteria 14212
120 Ga0075429_100547934 3300006880 Bacteria 1014
121 Ga0068865_100036345 3300006881 Bacteria 3320
122 Ga0068865_100054789 3300006881 Bacteria 2773
123 Ga0068865_100297155 3300006881 Bacteria 1291
124 Ga0097620_100001806 3300006931 Bacteria 21791
125 Ga0097620_100007017 3300006931 Bacteria 11435
126 Ga0097620_100970838 3300006931 Bacteria 932
127 Ga0097620_101200778 3300006931 Unclassified 835
128 Ga0111539_10002979 3300009094 Bacteria 22456
129 Ga0111539_10074541 3300009094 Bacteria 3998
130 Ga0111539_12057238 3300009094 Unclassified 662
131 Ga0105247_10004746 3300009101 Bacteria 8654
132 Ga0105247_10166753 3300009101 Bacteria 1462
133 Ga0105241_10003004 3300009174 Bacteria 12606
134 Ga0105241_10942169 3300009174 Unclassified 804
135 Ga0105242_10487290 3300009176 Unclassified 1170
136 Ga0105242_12133173 3300009176 Bacteria 605
137 Ga0105242_12214596 3300009176 Unclassified 595
138 Ga0105238_10250469 3300009551 Bacteria 1749
139 Ga0105249_10001076 3300009553 Bacteria 24251
140 Ga0105249_10269201 3300009553 Bacteria 1697
141 Ga0105249_10583625 3300009553 Bacteria 1171
142 Ga0105249_11405958 3300009553 Unclassified 770
143 Ga0105249_13372253 3300009553 Bacteria 514
144 Ga0105239_10264606 3300010375 Bacteria 1933
145 Ga0105239_10997156 3300010375 Bacteria 963
146 Ga0105246_10019544 3300011119 Unclassified 4331
147 Ga0105246_11098304 3300011119 Bacteria 726
148 Ga0105246_11293347 3300011119 Bacteria 675
149 Ga0157371_10881489 3300013102 Bacteria 678
150 Ga0157370_10340910 3300013104 Bacteria 1381
151 Ga0157369_10143425 3300013105 Bacteria 2526
152 Ga0157374_10819383 3300013296 Bacteria 947
153 Ga0157374_11505591 3300013296 Unclassified 696
154 Ga0157378_10071517 3300013297 Bacteria 3115
155 Ga0157378_10270027 3300013297 Bacteria 1636
156 Ga0157378_10507216 3300013297 Unclassified 1206
157 Ga0157378_11478305 3300013297 Bacteria 724
158 Ga0157378_12694891 3300013297 Bacteria 550
159 Ga0163162_10004364 3300013306 Bacteria 13614
160 Ga0163162_10444287 3300013306 Bacteria 1429
161 Ga0163162_10492970 3300013306 Bacteria 1356
162 Ga0163162_10501575 3300013306 Unclassified 1344
163 Ga0157372_10163251 3300013307 Bacteria 2575
164 Ga0157372_10859930 3300013307 Bacteria 1053
165 Ga0157372_11589046 3300013307 Unclassified 753
166 Ga0157375_10011377 3300013308 Bacteria 7855
167 Ga0157375_10145387 3300013308 Unclassified 2501
168 Ga0157375_10505955 3300013308 Unclassified 1372
169 Ga0157375_13807535 3300013308 Unclassified 501
170 Ga0163163_10030669 3300014325 Bacteria 5183
171 Ga0163163_10341385 3300014325 Bacteria 1553
172 Ga0157380_10000401 3300014326 Bacteria 26189
173 Ga0157380_10832157 3300014326 Bacteria 943
174 Ga0157380_11225458 3300014326 Bacteria 795
175 Ga0157380_11394317 3300014326 Bacteria 751
176 Ga0157377_10145613 3300014745 Bacteria 1460
177 Ga0157377_10218925 3300014745 Bacteria 1218
178 Ga0157379_10485269 3300014968 Bacteria 1144
179 Ga0157379_11159243 3300014968 Bacteria 742
180 Ga0157376_10056976 3300014969 Bacteria 3267
181 Ga0157376_10444185 3300014969 Bacteria 1264
182 Ga0157376_10898361 3300014969 Bacteria 904
183 Ga0157376_11573368 3300014969 Unclassified 691
184 Ga0163161_10168242 3300017792 Bacteria 1675
185 Ga0163161_10315768 3300017792 Bacteria 1234
186 Ga0163161_10518688 3300017792 Unclassified 973
187 Ga0213875_10297881 3300021388 Bacteria 763
188 Ga0207697_10004597 3300025315 Bacteria 6561
189 Ga0207697_10209983 3300025315 Bacteria 858
190 Ga0207656_10188775 3300025321 Bacteria 992
191 Ga0207642_10177509 3300025899 Bacteria 1158
192 Ga0207642_10991004 3300025899 Unclassified 541
193 Ga0207710_10065404 3300025900 Bacteria 1657
194 Ga0207680_10000898 3300025903 Bacteria 14063
195 Ga0207680_10333666 3300025903 Bacteria 1063
196 Ga0207645_10032548 3300025907 Unclassified 3352
197 Ga0207645_10765474 3300025907 Bacteria 656
198 Ga0207643_10003768 3300025908 Bacteria 8149
199 Ga0207643_10007450 3300025908 Bacteria 5872
200 Ga0207643_10163036 3300025908 Bacteria 1342
201 Ga0207643_10388622 3300025908 Unclassified 881
202 Ga0207684_10990444 3300025910 Bacteria 704
203 Ga0207654_10003199 3300025911 Bacteria 8278
204 Ga0207671_10005837 3300025914 Bacteria 11188
205 Ga0207681_10008923 3300025923 Bacteria 6121
206 Ga0207650_10040429 3300025925 Bacteria 3412
207 Ga0207650_10137228 3300025925 Bacteria 1920
208 Ga0207659_10027987 3300025926 Bacteria 3824
209 Ga0207659_11256404 3300025926 Unclassified 636
210 Ga0207687_10228784 3300025927 Bacteria 1468
211 Ga0207644_10090404 3300025931 Bacteria 2281
212 Ga0207706_10126708 3300025933 Bacteria 2245
213 Ga0207686_10658379 3300025934 Bacteria 829
214 Ga0207686_10948436 3300025934 Bacteria 696
215 Ga0207686_11716213 3300025934 Bacteria 519
216 Ga0207670_10031065 3300025936 Bacteria 3417
217 Ga0207670_10074206 3300025936 Bacteria 2360
218 Ga0207670_10143611 3300025936 Unclassified 1762
219 Ga0207669_10048394 3300025937 Bacteria 2525
220 Ga0207669_10392249 3300025937 Bacteria 1085
221 Ga0207704_10233067 3300025938 Bacteria 1370
222 Ga0207691_10012859 3300025940 Bacteria 8013
223 Ga0207691_10057585 3300025940 Bacteria 3536
224 Ga0207691_10822333 3300025940 Bacteria 780
225 Ga0207689_10028171 3300025942 Bacteria 4698
226 Ga0207689_10030077 3300025942 Bacteria 4527
227 Ga0207689_10170587 3300025942 Unclassified 1793
228 Ga0207689_10270303 3300025942 Bacteria 1407
229 Ga0207651_10090794 3300025960 Bacteria 2234
230 Ga0207651_10122678 3300025960 Unclassified 1973
231 Ga0207712_10002438 3300025961 Bacteria 12023
232 Ga0207712_10606743 3300025961 Bacteria 947
233 Ga0207668_10042514 3300025972 Bacteria 3078
234 Ga0207668_10187065 3300025972 Unclassified 1638
235 Ga0207668_10341836 3300025972 Bacteria 1248
236 Ga0207640_10608293 3300025981 Bacteria 926
237 Ga0207640_10749973 3300025981 Bacteria 841
238 Ga0207658_10250272 3300025986 Bacteria 1505
239 Ga0207658_10621659 3300025986 Unclassified 972
240 Ga0207658_11085768 3300025986 Bacteria 731
241 Ga0207658_12065590 3300025986 Bacteria 518
242 Ga0207677_10206911 3300026023 Unclassified 1564
243 Ga0207677_10945355 3300026023 Bacteria 779
244 Ga0207703_10032139 3300026035 Bacteria 4153
245 Ga0207708_10008560 3300026075 Bacteria 7569
246 Ga0207708_10208576 3300026075 Bacteria 1561
247 Ga0207708_11076456 3300026075 Bacteria 700
248 Ga0207708_11308872 3300026075 Bacteria 635
249 Ga0207641_10000132 3300026088 Bacteria 109247
250 Ga0207641_10041244 3300026088 Bacteria 3867
251 Ga0207641_10131598 3300026088 Unclassified 2247
252 Ga0207641_11529035 3300026088 Unclassified 669
253 Ga0207648_10090160 3300026089 Bacteria 2679
254 Ga0207648_10090711 3300026089 Bacteria 2671
255 Ga0207648_10157733 3300026089 Bacteria 2003
256 Ga0207648_10256261 3300026089 Bacteria 1560
257 Ga0207648_10293207 3300026089 Unclassified 1457
258 Ga0207648_11481833 3300026089 Bacteria 638
259 Ga0207676_10469029 3300026095 Bacteria 1190
260 Ga0207674_10775257 3300026116 Bacteria 926
261 Ga0207675_100005539 3300026118 Bacteria 12077
262 Ga0207675_100142022 3300026118 Bacteria 2281
263 Ga0207675_100303517 3300026118 Unclassified 1555
264 Ga0207675_100972506 3300026118 Bacteria 867
265 Ga0207683_10109552 3300026121 Bacteria 2472
266 Ga0207683_11858478 3300026121 Bacteria 551
267 Ga0207698_10011014 3300026142 Bacteria 5846
268 Ga0207698_10077768 3300026142 Bacteria 2661
269 Ga0207698_10166739 3300026142 Bacteria 1934
270 Ga0207428_10049460 3300027907 Bacteria 3368
271 Ga0268265_10006021 3300028380 Bacteria 8252
272 Ga0268265_10223327 3300028380 Bacteria 1650
273 Ga0268265_11327143 3300028380 Bacteria 720
274 Ga0268264_10008250 3300028381 Bacteria 8650
275 Ga0268264_10461424 3300028381 Bacteria 1232
276 Ga0268264_10848694 3300028381 Unclassified 915
277 Ga0268264_11383586 3300028381 Bacteria 714
278 Ga0307509_10051174 3300031507 Bacteria 4420
279 Ga0307509_10123350 3300031507 Bacteria 2563
280 Ga0307509_10136672 3300031507 Bacteria 2395
281 Ga0316576_10060855 3300031727 Bacteria 2767
282 Ga0316576_10602785 3300031727 Unclassified 802
283 Ga0316578_10277328 3300031728 Bacteria 1004
284 Ga0316578_10564980 3300031728 Bacteria 668
285 Ga0307405_10152066 3300031731 Bacteria 1629
286 Ga0307409_100160489 3300031995 Bacteria 1965
287 Ga0307416_100056364 3300032002 Bacteria 3171
288 Ga0307414_10151587 3300032004 Unclassified 1830
289 Ga0316574_0379277 3300035398 Bacteria 892
290 Ga0316574_0536748 3300035398 Bacteria 727
291 Ga0373927_0138807 3300035695 Bacteria 1589
292 Ga0373937_0180569 3300036401 Bacteria 1982
293 Ga0316582_0023212 3300036647 Bacteria 3695
294 Ga0373925_0114290 3300037068 Bacteria 2089
295 Ga0395899_0000559 3300037312 Bacteria 39854
296 Ga0395900_0000014 3300037418 Bacteria 386513
297 Ga0395900_0690466 3300037418 Bacteria 955
298 Ga0395898_0041310 3300037466 Bacteria 4556
299 Ga0395898_0274508 3300037466 Bacteria 1608
300 Ga0395905_0000241 3300037471 Bacteria 82847
301 Ga0436364_0857186 3300037853 Bacteria 2021
302 Ga0436364_0934225 3300037853 Bacteria 2754
303 Ga0436364_1514411 3300037853 Bacteria 3351
304 Ga0395901_0000582 3300038443 Bacteria 42425
305 Ga0395901_0341216 3300038443 Bacteria 1548
306 Ga0436365_0082408 3300039437 Bacteria 806
307 Ga0436365_0636216 3300039437 Bacteria 569
308 Ga0439436_0005529 3300041404 Bacteria 3871
309 Ga0439439_0003493 3300041406 Bacteria 3470
310 Ga0439439_0155517 3300041406 Unclassified 651
311 Ga0451802_1586851 3300041460 Unclassified 788
312 Ga0451804_0115230 3300041463 Bacteria 695
313 Ga0451807_0947831 3300041486 Unclassified 668
314 Ga0451837_0610407 3300041494 Bacteria 2042
315 Ga0451851_0042473 3300041507 Bacteria 614
316 Ga0451855_1951533 3300041511 Bacteria 589
317 Ga0451853_0706202 3300041512 Bacteria 524
318 Ga0451853_2894767 3300041512 Unclassified 1317
319 Ga0439449_0045202 3300042007 Bacteria 1632
320 Ga0439449_0115410 3300042007 Bacteria 996
321 Ga0439457_005889 3300042014 Bacteria 3038
322 Ga0439462_0034321 3300042015 Bacteria 1346
323 Ga0450923_016667 3300042125 Bacteria 1387
324 Ga0450894_004484 3300042131 Bacteria 1809
325 Ga0450898_001784 3300042134 Bacteria 2896
326 Ga0439446_0030252 3300042156 Bacteria 1565
327 Ga0450908_089042 3300042184 Bacteria 558
328 Ga0439434_0008781 3300042435 Bacteria 2969
329 Ga0466969_0000208 3300044656 Bacteria 32016
330 Ga0466972_0000212 3300044658 Bacteria 41192
331 Ga0453683_0290844 3300044673 Bacteria 1044
332 Ga0453683_0453593 3300044673 Unclassified 829
333 Ga0466961_0011742 3300044693 Bacteria 5597
334 Ga0453684_0335003 3300044712 Bacteria 1710
335 Ga0466971_0256719 3300044719 Bacteria 833
336 Ga0466957_0009565 3300044842 Bacteria 5537
337 Ga0466959_0000852 3300045049 Bacteria 18026
338 Ga0451576_0781023 3300045051 Bacteria 1003
339 Ga0466958_0023790 3300045836 Bacteria 3600
340 Ga0495603_0102344 3300046455 Bacteria 1672
341 Ga0495638_0132275 3300046460 Bacteria 1464
342 Ga0495668_0001096 3300046616 Bacteria 28039
343 Ga0495658_0467902 3300046683 Unclassified 806
344 Ga0495672_0070684 3300047320 Bacteria 1977
345 Ga0496110_0000084 3300048913 Bacteria 49140
346 Ga0496111_0007636 3300048914 Bacteria 7107
347 Ga0496113_0813263 3300048916 Bacteria 742
348 Ga0501295_031702 3300049518 Bacteria 1047
349 Ga0501031_0001894 3300049568 Bacteria 13194
350 Ga0501032_0089611 3300049569 Unclassified 2042
351 Ga0501034_0157214 3300049571 Bacteria 2246
352 Ga0501036_0011813 3300049572 Bacteria 7237
353 Ga0501038_0241611 3300049574 Unclassified 1433
354 Ga0501046_0006163 3300049580 Bacteria 10648
355 Ga0501047_0031458 3300049581 Bacteria 5118
356 Ga0501072_0308490 3300049588 Unclassified 1258
357 Ga0501207_038751 3300049654 Bacteria 823
358 Ga0501221_108514 3300049704 Bacteria 697
359 Ga0501225_0002409 3300049705 Bacteria 5770
360 Ga0501269_007177 3300049766 Bacteria 1345
361 Ga0501279_031299 3300049775 Bacteria 790
362 Ga0501044_0133546 3300049823 Bacteria 2474
363 nmdc:mga0k408_202142_c1 3300050493 Bacteria 1186
364 nmdc:mga0k408_320357_c1 3300050493 Bacteria 925
365 nmdc:mga07m45_89437_c1 3300050496 Bacteria 1763
366 nmdc:mga09592_11914_c1 3300050508 Bacteria 7074
367 nmdc:mga09592_1487193_c1 3300050508 Unclassified 551
368 nmdc:mga0qj67_544311_c1 3300050509 Bacteria 931
369 nmdc:mga08y16_109416_c1 3300050511 Bacteria 2877
370 nmdc:mga08y16_2620_c1 3300050511 Bacteria 18482
371 Ga0500578_0086382 3300053086 Bacteria 1993
372 Ga0500583_0005875 3300053092 Bacteria 4162
373 Ga0500583_0037142 3300053092 Bacteria 2186
374 Ga0500651_0107868 3300053093 Bacteria 1702
375 Ga0500651_0433482 3300053093 Unclassified 734
376 Ga0500650_0213243 3300053098 Unclassified 876
377 Ga0500556_0020367 3300053104 Unclassified 2122
378 Ga0500594_0053773 3300053118 Bacteria 1142
379 Ga0500642_0105759 3300053130 Bacteria 1312
380 Ga0500652_036099 3300053131 Bacteria 1966
381 Ga0500658_0171014 3300053134 Unclassified 987
382 Ga0500658_0378406 3300053134 Bacteria 649
383 Ga0500589_046355 3300053147 Bacteria 2024
384 Ga0500604_0244201 3300053151 Bacteria 621
385 Ga0500616_0001059 3300053153 Bacteria 28979
386 Ga0500622_0136453 3300053156 Bacteria 1174
387 Ga0500622_0158356 3300053156 Bacteria 1064
388 Ga0500633_0268662 3300053160 Bacteria 632
389 Ga0500636_0484121 3300053177 Bacteria 551
390 Ga0500637_0331403 3300053178 Bacteria 818
391 Ga0500611_082451 3300053727 Bacteria 805
392 Ga0501082_0847116 3300060353 Bacteria 800
393 Ga0466962_0000822 3300061719 Bacteria 13959
394 2511180035 2510917027 Bacteria 5287437
395 2599477253 2599185184 Bacteria 6430550
396 2738724628 2738541278 Bacteria 9755573
397 2831905723 2831905167 Bacteria 3319172
398 2857581722 2857581216 Bacteria 5522813
399 2857582417 2857581216 Bacteria 5522813
400 2857591668 2857591370 Bacteria 6569758
401 2857610871 2857609550 Bacteria 3753890
402 2915607253 2915606848 Bacteria 6032732
403 2956901926 2956897341 Bacteria 5447711
404 3001268286 3001267043 Bacteria 4823521
405 3001273782 3001272096 Bacteria 4729684
406 3006972844 3006969106 Bacteria 4739423
407 Ga0501079_1534432
408 JGI24740J21852_10025860
409 rootH2_10021908
410 rootL2_10131882
411 rootL2_10184537
412 rootL2_10338352
413 rootH1_10107858
414 rootH1_10127229
415 Ga0055531_10000212
416 Ga0065704_10311843
417 Ga0065712_10006494
418 Ga0065712_10023990
419 Ga0065712_10372696
420 Ga0065715_10233535
421 Ga0065707_10026114
422 Ga0065707_10417628
423 Ga0070676_10265602
424 Ga0070683_101530395
425 Ga0070670_100380465
426 Ga0070677_10387736
427 Ga0068869_100010086
428 Ga0068869_100051880
429 Ga0068869_100105836
430 Ga0070666_10000086
431 Ga0070666_10354613
432 Ga0068868_100054791
433 Ga0068868_100257150
434 Ga0068868_100266609
435 Ga0068868_100349397
436 Ga0070689_100096235
437 Ga0070689_100963566
438 Ga0070689_101455947
439 Ga0070661_101443639
440 Ga0070668_100009486
441 Ga0070668_100048029
442 Ga0070668_100479170
443 Ga0070668_100559166
444 Ga0070669_100001129
445 Ga0070669_100068304
446 Ga0070669_100664524
447 Ga0070669_100947896
448 Ga0070675_100047604
449 Ga0070675_100258805
450 Ga0070675_100406007
451 Ga0070671_100031452
452 Ga0070671_100083523
453 Ga0070671_100706199
454 Ga0070674_100001512
455 Ga0070674_100288684
456 Ga0070673_100015051
457 Ga0070673_100279849
458 Ga0070673_100557565
459 Ga0070688_100000319
460 Ga0070688_100060708
461 Ga0070688_100186711
462 Ga0070688_100662707
463 Ga0070667_100012384
464 Ga0070713_102073799
465 Ga0070700_100199158
466 Ga0070700_101424984
467 Ga0070678_101000666
468 Ga0068867_100058753
469 Ga0068867_100276573
470 Ga0070698_100007666
471 Ga0070698_100845560
472 Ga0070672_100012659
473 Ga0070672_100061012
474 Ga0070672_100157508
475 Ga0070672_100760694
476 Ga0070672_100837329
477 Ga0070672_100904371
478 Ga0070686_100011207
479 Ga0070686_100534266
480 Ga0070695_100286624
481 Ga0070704_100150977
482 Ga0070664_101842057
483 Ga0068857_100439085
484 Ga0068857_102264811
485 Ga0068854_100622814
486 Ga0068854_101160557
487 Ga0070702_100012344
488 Ga0070702_101121087
489 Ga0068852_100014410
490 Ga0068852_100265794
491 Ga0068852_100510063
492 Ga0068859_100001806
493 Ga0068859_100007017
494 Ga0068859_100971008
495 Ga0068859_101200885
496 Ga0068864_100019334
497 Ga0068864_100483094
498 Ga0068864_100545889
499 Ga0068866_10541761
500 Ga0068861_100001569
501 Ga0068861_101485206
502 Ga0068861_101616700
503 Ga0068851_10129381
504 Ga0068870_10579283
505 Ga0068863_100012123
506 Ga0068863_100153197
507 Ga0068863_100176857
508 Ga0068863_100394574
509 Ga0068863_100839195
510 Ga0068858_100022807
511 Ga0068860_100003164
512 Ga0068860_100903384
513 Ga0068860_101067638
514 Ga0068860_101125479
515 Ga0075366_10075755
516 Ga0075366_10079092
517 Ga0075366_10645415
518 Ga0097621_100046644
519 Ga0097621_100287132
520 Ga0068871_100321717
521 Ga0068871_100618053
522 Ga0075428_100202469
523 Ga0075430_100492146
524 Ga0075433_10732368
525 Ga0075429_100003044
526 Ga0075429_100547934
527 Ga0068865_100036345
528 Ga0068865_100054789
529 Ga0068865_100297155
530 Ga0097620_100001806
531 Ga0097620_100007017
532 Ga0097620_100970838
533 Ga0097620_101200778
534 Ga0111539_10002979
535 Ga0111539_10074541
536 Ga0111539_12057238
537 Ga0105247_10004746
538 Ga0105247_10166753
539 Ga0105241_10003004
540 Ga0105241_10942169
541 Ga0105242_10487290
542 Ga0105242_12133173
543 Ga0105242_12214596
544 Ga0105238_10250469
545 Ga0105249_10001076
546 Ga0105249_10269201
547 Ga0105249_10583625
548 Ga0105249_11405958
549 Ga0105249_13372253
550 Ga0105239_10264606
551 Ga0105239_10997156
552 Ga0105246_10019544
553 Ga0105246_11098304
554 Ga0105246_11293347
555 Ga0157371_10881489
556 Ga0157370_10340910
557 Ga0157369_10143425
558 Ga0157374_10819383
559 Ga0157374_11505591
560 Ga0157378_10071517
561 Ga0157378_10270027
562 Ga0157378_10507216
563 Ga0157378_11478305
564 Ga0157378_12694891
565 Ga0163162_10004364
566 Ga0163162_10444287
567 Ga0163162_10492970
568 Ga0163162_10501575
569 Ga0157372_10163251
570 Ga0157372_10859930
571 Ga0157372_11589046
572 Ga0157375_10011377
573 Ga0157375_10145387
574 Ga0157375_10505955
575 Ga0157375_13807535
576 Ga0163163_10030669
577 Ga0163163_10341385
578 Ga0157380_10000401
579 Ga0157380_10832157
580 Ga0157380_11225458
581 Ga0157380_11394317
582 Ga0157377_10145613
583 Ga0157377_10218925
584 Ga0157379_10485269
585 Ga0157379_11159243
586 Ga0157376_10056976
587 Ga0157376_10444185
588 Ga0157376_10898361
589 Ga0157376_11573368
590 Ga0163161_10168242
591 Ga0163161_10315768
592 Ga0163161_10518688
593 Ga0213875_10297881
594 Ga0207697_10004597
595 Ga0207697_10209983
596 Ga0207656_10188775
597 Ga0207642_10177509
598 Ga0207642_10991004
599 Ga0207710_10065404
600 Ga0207680_10000898
601 Ga0207680_10333666
602 Ga0207645_10032548
603 Ga0207645_10765474
604 Ga0207643_10003768
605 Ga0207643_10007450
606 Ga0207643_10163036
607 Ga0207643_10388622
608 Ga0207684_10990444
609 Ga0207654_10003199
610 Ga0207671_10005837
611 Ga0207681_10008923
612 Ga0207650_10040429
613 Ga0207650_10137228
614 Ga0207659_10027987
615 Ga0207659_11256404
616 Ga0207687_10228784
617 Ga0207644_10090404
618 Ga0207706_10126708
619 Ga0207686_10658379
620 Ga0207686_10948436
621 Ga0207686_11716213
622 Ga0207670_10031065
623 Ga0207670_10074206
624 Ga0207670_10143611
625 Ga0207669_10048394
626 Ga0207669_10392249
627 Ga0207704_10233067
628 Ga0207691_10012859
629 Ga0207691_10057585
630 Ga0207691_10822333
631 Ga0207689_10028171
632 Ga0207689_10030077
633 Ga0207689_10170587
634 Ga0207689_10270303
635 Ga0207651_10090794
636 Ga0207651_10122678
637 Ga0207712_10002438
638 Ga0207712_10606743
639 Ga0207668_10042514
640 Ga0207668_10187065
641 Ga0207668_10341836
642 Ga0207640_10608293
643 Ga0207640_10749973
644 Ga0207658_10250272
645 Ga0207658_10621659
646 Ga0207658_11085768
647 Ga0207658_12065590
648 Ga0207677_10206911
649 Ga0207677_10945355
650 Ga0207703_10032139
651 Ga0207708_10008560
652 Ga0207708_10208576
653 Ga0207708_11076456
654 Ga0207708_11308872
655 Ga0207641_10000132
656 Ga0207641_10041244
657 Ga0207641_10131598
658 Ga0207641_11529035
659 Ga0207648_10090160
660 Ga0207648_10090711
661 Ga0207648_10157733
662 Ga0207648_10256261
663 Ga0207648_10293207
664 Ga0207648_11481833
665 Ga0207676_10469029
666 Ga0207674_10775257
667 Ga0207675_100005539
668 Ga0207675_100142022
669 Ga0207675_100303517
670 Ga0207675_100972506
671 Ga0207683_10109552
672 Ga0207683_11858478
673 Ga0207698_10011014
674 Ga0207698_10077768
675 Ga0207698_10166739
676 Ga0207428_10049460
677 Ga0268265_10006021
678 Ga0268265_10223327
679 Ga0268265_11327143
680 Ga0268264_10008250
681 Ga0268264_10461424
682 Ga0268264_10848694
683 Ga0268264_11383586
684 Ga0307509_10051174
685 Ga0307509_10123350
686 Ga0307509_10136672
687 Ga0316576_10060855
688 Ga0316576_10602785
689 Ga0316578_10277328
690 Ga0316578_10564980
691 Ga0307405_10152066
692 Ga0307409_100160489
693 Ga0307416_100056364
694 Ga0307414_10151587
695 Ga0316574_0379277
696 Ga0316574_0536748
697 Ga0373927_0138807
698 Ga0373937_0180569
699 Ga0316582_0023212
700 Ga0373925_0114290
701 Ga0395899_0000559
702 Ga0395900_0000014
703 Ga0395900_0690466
704 Ga0395898_0041310
705 Ga0395898_0274508
706 Ga0395905_0000241
707 Ga0436364_0857186
708 Ga0436364_0934225
709 Ga0436364_1514411
710 Ga0395901_0000582
711 Ga0395901_0341216
712 Ga0436365_0082408
713 Ga0436365_0636216
714 Ga0439436_0005529
715 Ga0439439_0003493
716 Ga0439439_0155517
717 Ga0451802_1586851
718 Ga0451804_0115230
719 Ga0451807_0947831
720 Ga0451837_0610407
721 Ga0451851_0042473
722 Ga0451855_1951533
723 Ga0451853_0706202
724 Ga0451853_2894767
725 Ga0439449_0045202
726 Ga0439449_0115410
727 Ga0439457_005889
728 Ga0439462_0034321
729 Ga0450923_016667
730 Ga0450894_004484
731 Ga0450898_001784
732 Ga0439446_0030252
733 Ga0450908_089042
734 Ga0439434_0008781
735 Ga0466969_0000208
736 Ga0466972_0000212
737 Ga0453683_0290844
738 Ga0453683_0453593
739 Ga0466961_0011742
740 Ga0453684_0335003
741 Ga0466971_0256719
742 Ga0466957_0009565
743 Ga0466959_0000852
744 Ga0451576_0781023
745 Ga0466958_0023790
746 Ga0495603_0102344
747 Ga0495638_0132275
748 Ga0495668_0001096
749 Ga0495658_0467902
750 Ga0495672_0070684
751 Ga0496110_0000084
752 Ga0496111_0007636
753 Ga0496113_0813263
754 Ga0501295_031702
755 Ga0501031_0001894
756 Ga0501032_0089611
757 Ga0501034_0157214
758 Ga0501036_0011813
759 Ga0501038_0241611
760 Ga0501046_0006163
761 Ga0501047_0031458
762 Ga0501072_0308490
763 Ga0501207_038751
764 Ga0501221_108514
765 Ga0501225_0002409
766 Ga0501269_007177
767 Ga0501279_031299
768 Ga0501044_0133546
769 nmdc:mga0k408_202142_c1
770 nmdc:mga0k408_320357_c1
771 nmdc:mga07m45_89437_c1
772 nmdc:mga09592_11914_c1
773 nmdc:mga09592_1487193_c1
774 nmdc:mga0qj67_544311_c1
775 nmdc:mga08y16_109416_c1
776 nmdc:mga08y16_2620_c1
777 Ga0500578_0086382
778 Ga0500583_0005875
779 Ga0500583_0037142
780 Ga0500651_0107868
781 Ga0500651_0433482
782 Ga0500650_0213243
783 Ga0500556_0020367
784 Ga0500594_0053773
785 Ga0500642_0105759
786 Ga0500652_036099
787 Ga0500658_0171014
788 Ga0500658_0378406
789 Ga0500589_046355
790 Ga0500604_0244201
791 Ga0500616_0001059
792 Ga0500622_0136453
793 Ga0500622_0158356
794 Ga0500633_0268662
795 Ga0500636_0484121
796 Ga0500637_0331403
797 Ga0500611_082451
798 Ga0501082_0847116
799 Ga0466962_0000822
800 2511180035
801 2599477253
802 2738724628
803 2831905723
804 2857581722
805 2857582417
806 2857591668
807 2857610871
808 2915607253
809 2956901926
810 3001268286
811 3001273782
812 3006972844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

135

0.97

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

148

0.94

PF13468

Glyoxalase_3

Glyoxalase-like domain

24

164

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9664 2 134
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.9586 4 133
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9524 2 134
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9497 1 133
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.9493 1 133
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9748 2 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9629 4 133 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9534 2 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9283 4 133 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.91 2 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A318VBB2-F1-model_v4 deleted 1 1 131
AF-A0A7X0CLV5-F1-model_v4 Methylmalonyl-CoA epimerase 1 1 133 GO:0004493
GO:0046491
GO:0046872
AF-A0A285X3N8-F1-model_v4 Methylmalonyl-CoA epimerase 0.9986 1 133 GO:0004493
GO:0046491
GO:0046872
AF-A0A327VN19-F1-model_v4 Methylmalonyl-CoA/ethylmalonyl-CoA epimerase 0.9971 1 133 GO:0004493
GO:0046491
GO:0046872
AF-A0A3S9MVD8-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9971 1 134 GO:0004493
GO:0046491
GO:0046872

Map