F436294

General Info

Members Datasets Scaffolds Average Seq Length
406 217 812 176

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0513568|Ga0466967_0513568_419_1024
Length 201
Sequence LLAVTKRNLGGNGYQRVGGIEMDATYATDPRMVGIGLLSARLVLGLLMAAHGSQKLFGWFGGYGLRTTGEFFVQLGFRPGRLFATAASVGEVTSGLLVALGFLGPVGPALMIAVMLVAAISVHWAHGLFATSNGIEVPLLYATGALGLALVGPGPYSLDALLGIAAEWTPGLTWAVLVLGVAGGVANLLARRRSAQPGGAR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
150 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
151 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
152 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.67
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 9.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0513568 3300045976 Bacteria 1177
2 Ga0065715_10590872 3300005293 Bacteria 714
3 Ga0065715_10749840 3300005293 Bacteria 631
4 Ga0070658_10019699 3300005327 Bacteria 5402
5 Ga0070658_10497650 3300005327 Bacteria 1053
6 Ga0070683_100006326 3300005329 Bacteria 9935
7 Ga0070683_100028427 3300005329 Bacteria 5052
8 Ga0070683_100085687 3300005329 Bacteria 2954
9 Ga0070683_100323595 3300005329 Bacteria 1468
10 Ga0070670_100053146 3300005331 Unclassified 3478
11 Ga0070670_100077204 3300005331 Bacteria 2862
12 Ga0070670_101031174 3300005331 Bacteria 749
13 Ga0070666_10272818 3300005335 Bacteria 1201
14 Ga0070680_100013171 3300005336 Bacteria 6438
15 Ga0070680_100053332 3300005336 Bacteria 3300
16 Ga0070680_100094795 3300005336 Bacteria 2474
17 Ga0070682_100364098 3300005337 Bacteria 1082
18 Ga0068868_100323142 3300005338 Bacteria 1315
19 Ga0070660_100057010 3300005339 Bacteria 3024
20 Ga0070689_100448157 3300005340 Bacteria 1098
21 Ga0070689_100991733 3300005340 Bacteria 747
22 Ga0070661_100018180 3300005344 Bacteria 4995
23 Ga0070661_100453550 3300005344 Bacteria 1020
24 Ga0070661_100609256 3300005344 Bacteria 883
25 Ga0070692_10249924 3300005345 Bacteria 1061
26 Ga0070668_100132219 3300005347 Bacteria 2004
27 Ga0070669_100233441 3300005353 Bacteria 1459
28 Ga0070675_100013823 3300005354 Bacteria 6355
29 Ga0070671_100213205 3300005355 Bacteria 1638
30 Ga0070674_100209319 3300005356 Bacteria 1510
31 Ga0070673_100370085 3300005364 Bacteria 1276
32 Ga0070673_100498522 3300005364 Bacteria 1101
33 Ga0070659_100007057 3300005366 Bacteria 8137
34 Ga0070659_100018772 3300005366 Bacteria 5220
35 Ga0070659_100280454 3300005366 Unclassified 1386
36 Ga0070667_100505913 3300005367 Bacteria 1108
37 Ga0070667_100950990 3300005367 Bacteria 801
38 Ga0070701_10180676 3300005438 Bacteria 1235
39 Ga0070694_100001179 3300005444 Bacteria 15010
40 Ga0070694_100181806 3300005444 Bacteria 1556
41 Ga0070708_100002050 3300005445 Bacteria 15529
42 Ga0070708_101286072 3300005445 Bacteria 683
43 Ga0070662_100009218 3300005457 Bacteria 6444
44 Ga0070662_100027021 3300005457 Bacteria 3980
45 Ga0070662_100166026 3300005457 Bacteria 1730
46 Ga0070681_10000303 3300005458 Bacteria 40005
47 Ga0070681_10096322 3300005458 Bacteria 2907
48 Ga0070681_10107299 3300005458 Bacteria 2733
49 Ga0070681_10698852 3300005458 Bacteria 930
50 Ga0068867_100021660 3300005459 Bacteria 4587
51 Ga0068867_100303952 3300005459 Bacteria 1316
52 Ga0068867_100448473 3300005459 Unclassified 1099
53 Ga0070706_100119990 3300005467 Unclassified 2451
54 Ga0070706_100172906 3300005467 Bacteria 2017
55 Ga0070706_101508751 3300005467 Bacteria 614
56 Ga0070707_100026628 3300005468 Bacteria 5493
57 Ga0070707_100171090 3300005468 Bacteria 2117
58 Ga0070698_100220576 3300005471 Unclassified 1830
59 Ga0070698_100782045 3300005471 Bacteria 898
60 Ga0070698_100877473 3300005471 Unclassified 842
61 Ga0070699_100004345 3300005518 Bacteria 12537
62 Ga0070699_100176091 3300005518 Bacteria 1897
63 Ga0070679_100004979 3300005530 Bacteria 12261
64 Ga0070679_100171045 3300005530 Bacteria 2145
65 Ga0070679_100280837 3300005530 Bacteria 1618
66 Ga0070679_100570224 3300005530 Bacteria 1075
67 Ga0070684_100001320 3300005535 Bacteria 17768
68 Ga0070684_100001946 3300005535 Bacteria 15155
69 Ga0070684_100298654 3300005535 Bacteria 1477
70 Ga0070697_100833633 3300005536 Unclassified 817
71 Ga0068853_100376202 3300005539 Bacteria 1326
72 Ga0068853_100819358 3300005539 Bacteria 892
73 Ga0070672_100022313 3300005543 Bacteria 4648
74 Ga0070672_100152517 3300005543 Bacteria 1912
75 Ga0070672_100171451 3300005543 Bacteria 1805
76 Ga0070672_100266659 3300005543 Bacteria 1445
77 Ga0070672_100327860 3300005543 Bacteria 1302
78 Ga0070695_100002016 3300005545 Bacteria 11586
79 Ga0070695_100603438 3300005545 Bacteria 862
80 Ga0070696_100038439 3300005546 Bacteria 3303
81 Ga0070696_100096853 3300005546 Bacteria 2109
82 Ga0070696_100121402 3300005546 Bacteria 1892
83 Ga0070696_100199710 3300005546 Bacteria 1492
84 Ga0070696_100210508 3300005546 Bacteria 1455
85 Ga0070665_100463978 3300005548 Bacteria 1277
86 Ga0070665_101178938 3300005548 Bacteria 777
87 Ga0070704_100114423 3300005549 Bacteria 2059
88 Ga0070704_100349378 3300005549 Bacteria 1248
89 Ga0070704_100455892 3300005549 Bacteria 1102
90 Ga0070704_100922350 3300005549 Bacteria 786
91 Ga0070664_100000766 3300005564 Bacteria 24779
92 Ga0070664_100002361 3300005564 Bacteria 15162
93 Ga0070664_100016971 3300005564 Bacteria 5976
94 Ga0070664_100023321 3300005564 Bacteria 5110
95 Ga0070664_100183555 3300005564 Bacteria 1861
96 Ga0070664_100291496 3300005564 Unclassified 1473
97 Ga0068857_100018525 3300005577 Bacteria 6106
98 Ga0068857_100020178 3300005577 Bacteria 5858
99 Ga0068854_100324308 3300005578 Bacteria 1253
100 Ga0068854_101081915 3300005578 Bacteria 713
101 Ga0068859_100908536 3300005617 Bacteria 965
102 Ga0068864_100038789 3300005618 Bacteria 4069
103 Ga0068866_10139990 3300005718 Bacteria 1388
104 Ga0068861_100897984 3300005719 Bacteria 839
105 Ga0068861_101947987 3300005719 Bacteria 585
106 Ga0068851_10057572 3300005834 Bacteria 1984
107 Ga0068851_10114515 3300005834 Bacteria 1443
108 Ga0068870_10331881 3300005840 Bacteria 970
109 Ga0068863_100573960 3300005841 Bacteria 1115
110 Ga0068863_101064365 3300005841 Unclassified 813
111 Ga0068858_100279219 3300005842 Bacteria 1590
112 Ga0068862_101178739 3300005844 Viruses 764
113 Ga0097621_100275508 3300006237 Unclassified 1480
114 Ga0097621_101532191 3300006237 Bacteria 633
115 Ga0068871_100654009 3300006358 Bacteria 960
116 Ga0075428_100016640 3300006844 Bacteria 8122
117 Ga0075428_100036544 3300006844 Bacteria 5410
118 Ga0075428_100330345 3300006844 Bacteria 1638
119 Ga0075430_100213341 3300006846 Bacteria 1601
120 Ga0075431_100424925 3300006847 Bacteria 1328
121 Ga0075431_100456490 3300006847 Unclassified 1273
122 Ga0075431_100521325 3300006847 Unclassified 1178
123 Ga0075431_101009002 3300006847 Unclassified 799
124 Ga0075431_101136062 3300006847 Bacteria 745
125 Ga0075434_100316628 3300006871 Unclassified 1581
126 Ga0075434_101357801 3300006871 Bacteria 721
127 Ga0075429_100535076 3300006880 Unclassified 1027
128 Ga0068865_100295939 3300006881 Bacteria 1293
129 Ga0097620_100908522 3300006931 Bacteria 965
130 Ga0075435_100987963 3300007076 Unclassified 735
131 Ga0099794_10142070 3300007265 Unclassified 1216
132 Ga0099794_10341143 3300007265 Unclassified 778
133 Ga0099795_10119217 3300007788 Unclassified 1053
134 Ga0105240_10174418 3300009093 Bacteria 2543
135 Ga0111539_10364671 3300009094 Bacteria 1682
136 Ga0111539_10385099 3300009094 Bacteria 1633
137 Ga0114129_10029523 3300009147 Bacteria 7766
138 Ga0114129_10094349 3300009147 Bacteria 4144
139 Ga0114129_10137023 3300009147 Bacteria 3358
140 Ga0105243_10134285 3300009148 Bacteria 2103
141 Ga0105242_10078353 3300009176 Bacteria 2758
142 Ga0105242_10178431 3300009176 Bacteria 1872
143 Ga0105242_12109883 3300009176 Bacteria 607
144 Ga0105248_10045289 3300009177 Bacteria 4933
145 Ga0105248_10120245 3300009177 Bacteria 2963
146 Ga0105248_10704398 3300009177 Bacteria 1139
147 Ga0105249_10853675 3300009553 Bacteria 976
148 Ga0105246_10817820 3300011119 Bacteria 828
149 Ga0157373_10081104 3300013100 Bacteria 2287
150 Ga0157370_10371857 3300013104 Unclassified 1317
151 Ga0157369_10113942 3300013105 Bacteria 2872
152 Ga0157369_10337040 3300013105 Bacteria 1567
153 Ga0157369_10915382 3300013105 Unclassified 899
154 Ga0157374_10272034 3300013296 Bacteria 1670
155 Ga0157378_10023039 3300013297 Bacteria 5481
156 Ga0157378_10287381 3300013297 Bacteria 1587
157 Ga0163162_10459738 3300013306 Bacteria 1404
158 Ga0157372_11086956 3300013307 Unclassified 925
159 Ga0157372_11594510 3300013307 Bacteria 751
160 Ga0157375_10048372 3300013308 Bacteria 4160
161 Ga0157375_10275496 3300013308 Bacteria 1845
162 Ga0157375_11932772 3300013308 Bacteria 701
163 Ga0163163_10057571 3300014325 Unclassified 3843
164 Ga0157380_10205945 3300014326 Bacteria 1749
165 Ga0157376_11529840 3300014969 Bacteria 700
166 Ga0163161_10207418 3300017792 Bacteria 1513
167 Ga0163161_10229005 3300017792 Bacteria 1442
168 Ga0213876_10014914 3300021384 Bacteria 4119
169 Ga0207682_10022004 3300025893 Bacteria 2510
170 Ga0207642_10151953 3300025899 Bacteria 1233
171 Ga0207680_10823062 3300025903 Bacteria 666
172 Ga0207645_10137244 3300025907 Bacteria 1593
173 Ga0207684_10308730 3300025910 Bacteria 1364
174 Ga0207707_10016252 3300025912 Bacteria 6491
175 Ga0207707_10039089 3300025912 Bacteria 4147
176 Ga0207707_10319250 3300025912 Bacteria 1341
177 Ga0207707_10383792 3300025912 Unclassified 1207
178 Ga0207660_10076841 3300025917 Bacteria 2442
179 Ga0207660_10086378 3300025917 Bacteria 2316
180 Ga0207660_10391354 3300025917 Bacteria 1118
181 Ga0207657_10208434 3300025919 Bacteria 1570
182 Ga0207649_10038028 3300025920 Bacteria 2911
183 Ga0207649_10621621 3300025920 Bacteria 832
184 Ga0207652_10041099 3300025921 Bacteria 3929
185 Ga0207646_10015751 3300025922 Bacteria 7123
186 Ga0207646_10164846 3300025922 Bacteria 2000
187 Ga0207646_10372809 3300025922 Unclassified 1289
188 Ga0207681_10433961 3300025923 Unclassified 1066
189 Ga0207694_10284614 3300025924 Bacteria 1358
190 Ga0207650_10072369 3300025925 Bacteria 2595
191 Ga0207650_10316811 3300025925 Unclassified 1277
192 Ga0207650_11090193 3300025925 Bacteria 680
193 Ga0207659_10019838 3300025926 Bacteria 4433
194 Ga0207659_10224946 3300025926 Bacteria 1511
195 Ga0207690_10018124 3300025932 Bacteria 4314
196 Ga0207690_10059508 3300025932 Bacteria 2588
197 Ga0207706_10072122 3300025933 Bacteria 3038
198 Ga0207706_10342356 3300025933 Bacteria 1301
199 Ga0207706_10434843 3300025933 Unclassified 1136
200 Ga0207686_10019663 3300025934 Bacteria 3845
201 Ga0207686_10039368 3300025934 Bacteria 2868
202 Ga0207709_10302829 3300025935 Bacteria 1189
203 Ga0207670_10608649 3300025936 Bacteria 898
204 Ga0207669_10210042 3300025937 Bacteria 1420
205 Ga0207669_10245677 3300025937 Bacteria 1329
206 Ga0207691_10008344 3300025940 Bacteria 9949
207 Ga0207691_10257684 3300025940 Bacteria 1504
208 Ga0207661_10002434 3300025944 Bacteria 12827
209 Ga0207661_10364076 3300025944 Bacteria 1306
210 Ga0207661_10374793 3300025944 Bacteria 1287
211 Ga0207679_10001018 3300025945 Bacteria 17909
212 Ga0207679_10031122 3300025945 Unclassified 3733
213 Ga0207679_10035044 3300025945 Bacteria 3548
214 Ga0207679_10160005 3300025945 Bacteria 1843
215 Ga0207667_10318260 3300025949 Bacteria 1589
216 Ga0207651_10070933 3300025960 Bacteria 2467
217 Ga0207651_10298473 3300025960 Bacteria 1339
218 Ga0207651_10452607 3300025960 Bacteria 1102
219 Ga0207651_10495848 3300025960 Bacteria 1055
220 Ga0207668_10196541 3300025972 Bacteria 1603
221 Ga0207677_10057012 3300026023 Bacteria 2680
222 Ga0207703_10656234 3300026035 Bacteria 995
223 Ga0207639_10044808 3300026041 Bacteria 3329
224 Ga0207639_11456986 3300026041 Bacteria 643
225 Ga0207678_10184515 3300026067 Bacteria 1782
226 Ga0207648_10047385 3300026089 Bacteria 3767
227 Ga0207648_10150343 3300026089 Bacteria 2054
228 Ga0207648_10486761 3300026089 Unclassified 1127
229 Ga0207676_10046176 3300026095 Bacteria 3369
230 Ga0207676_10249028 3300026095 Bacteria 1598
231 Ga0207676_11066033 3300026095 Unclassified 798
232 Ga0207674_10001729 3300026116 Bacteria 27885
233 Ga0207674_10005023 3300026116 Bacteria 15801
234 Ga0207675_101469365 3300026118 Bacteria 702
235 Ga0207675_101905880 3300026118 Bacteria 613
236 Ga0207683_10381782 3300026121 Bacteria 1295
237 Ga0207698_10057851 3300026142 Bacteria 3001
238 Ga0207698_11059553 3300026142 Bacteria 823
239 Ga0209179_1051393 3300027512 Unclassified 884
240 Ga0207428_10454183 3300027907 Bacteria 934
241 Ga0268266_10249331 3300028379 Bacteria 1642
242 Ga0268266_10292761 3300028379 Unclassified 1517
243 Ga0268266_10928569 3300028379 Bacteria 842
244 Ga0268265_10224588 3300028380 Bacteria 1646
245 Ga0307408_100060109 3300031548 Bacteria 2769
246 Ga0307408_100329973 3300031548 Bacteria 1288
247 Ga0307405_10003921 3300031731 Bacteria 6949
248 Ga0307405_10346443 3300031731 Bacteria 1144
249 Ga0307413_10049759 3300031824 Bacteria 2513
250 Ga0307410_10001609 3300031852 Bacteria 10362
251 Ga0307410_10047485 3300031852 Bacteria 2869
252 Ga0307410_10249761 3300031852 Bacteria 1379
253 Ga0307406_10017833 3300031901 Bacteria 4140
254 Ga0307406_10087121 3300031901 Bacteria 2092
255 Ga0307406_10438114 3300031901 Bacteria 1045
256 Ga0307407_10008436 3300031903 Bacteria 4731
257 Ga0307407_10270119 3300031903 Bacteria 1173
258 Ga0307407_10433076 3300031903 Bacteria 950
259 Ga0307407_10455641 3300031903 Bacteria 929
260 Ga0307412_10015916 3300031911 Bacteria 4468
261 Ga0307412_10077474 3300031911 Bacteria 2287
262 Ga0307412_10238557 3300031911 Bacteria 1405
263 Ga0307412_10573933 3300031911 Bacteria 951
264 Ga0307409_100024603 3300031995 Bacteria 4203
265 Ga0307409_100164852 3300031995 Bacteria 1943
266 Ga0307409_100275538 3300031995 Bacteria 1552
267 Ga0307409_100333255 3300031995 Bacteria 1425
268 Ga0307409_100607558 3300031995 Bacteria 1081
269 Ga0307416_100000456 3300032002 Bacteria 21001
270 Ga0307416_100069039 3300032002 Bacteria 2923
271 Ga0307416_100448173 3300032002 Bacteria 1342
272 Ga0307416_102675290 3300032002 Bacteria 596
273 Ga0307414_10087793 3300032004 Bacteria 2299
274 Ga0307414_10649698 3300032004 Bacteria 951
275 Ga0307411_10021355 3300032005 Bacteria 3786
276 Ga0307411_10058640 3300032005 Bacteria 2548
277 Ga0307415_100006540 3300032126 Bacteria 6298
278 Ga0307415_100025345 3300032126 Bacteria 3719
279 Ga0307415_100082169 3300032126 Bacteria 2304
280 Ga0307415_100561194 3300032126 Bacteria 1009
281 Ga0307415_101017876 3300032126 Bacteria 771
282 Ga0373959_0076435 3300034820 Bacteria 765
283 Ga0373943_0019665 3300035170 Bacteria 3107
284 Ga0373947_0082020 3300035725 Bacteria 1998
285 Ga0395899_0016742 3300037312 Bacteria 5589
286 Ga0395900_0066164 3300037418 Bacteria 3714
287 Ga0395905_0018851 3300037471 Bacteria 6545
288 Ga0395901_0009870 3300038443 Bacteria 9675
289 Ga0436365_0505723 3300039437 Bacteria 1588
290 Ga0436365_1071583 3300039437 Bacteria 6677
291 Ga0436365_1165633 3300039437 Bacteria 712
292 Ga0439439_0076754 3300041406 Bacteria 900
293 Ga0451839_0722268 3300041496 Bacteria 1105
294 Ga0450894_014490 3300042131 Bacteria 1039
295 Ga0450895_001760 3300042132 Bacteria 1543
296 Ga0450896_000466 3300042133 Bacteria 4181
297 Ga0450908_047683 3300042184 Bacteria 745
298 Ga0451576_0236014 3300045051 Bacteria 1910
299 Ga0466958_0209057 3300045836 Bacteria 1243
300 Ga0495582_0133531 3300046473 Bacteria 1403
301 Ga0495594_0167221 3300046499 Bacteria 1251
302 Ga0495630_0229699 3300046517 Bacteria 1417
303 Ga0495663_0071401 3300046525 Bacteria 1106
304 Ga0495659_0018377 3300046664 Bacteria 2329
305 Ga0495657_0246626 3300046675 Bacteria 1076
306 Ga0495669_0031494 3300046684 Unclassified 2330
307 Ga0495670_0153212 3300046691 Bacteria 1209
308 Ga0495600_0128519 3300046809 Bacteria 1647
309 Ga0495581_0151678 3300047315 Bacteria 1353
310 Ga0495674_0061385 3300047319 Bacteria 3276
311 Ga0495675_0116833 3300047444 Bacteria 1663
312 Ga0495677_0093270 3300047445 Bacteria 1136
313 Ga0495684_0050760 3300047471 Bacteria 3166
314 Ga0496100_0201446 3300048903 Bacteria 1451
315 Ga0496101_0070978 3300048904 Bacteria 2552
316 Ga0496104_0003965 3300048907 Bacteria 12813
317 Ga0496104_0127380 3300048907 Bacteria 2445
318 Ga0496104_0674778 3300048907 Bacteria 942
319 Ga0496105_0020324 3300048908 Bacteria 5365
320 Ga0496105_0276759 3300048908 Bacteria 1354
321 Ga0496106_0418670 3300048909 Bacteria 1077
322 Ga0496106_0443668 3300048909 Bacteria 1043
323 Ga0496107_0451280 3300048910 Bacteria 955
324 Ga0496108_0063993 3300048911 Bacteria 3098
325 Ga0496109_0001175 3300048912 Bacteria 21775
326 Ga0496109_1335069 3300048912 Bacteria 653
327 Ga0496110_0006316 3300048913 Bacteria 9360
328 Ga0496111_0010625 3300048914 Bacteria 6187
329 Ga0496111_0439313 3300048914 Bacteria 963
330 Ga0496112_0003297 3300048915 Bacteria 13325
331 Ga0496112_0014440 3300048915 Bacteria 7328
332 Ga0496112_0231498 3300048915 Bacteria 1802
333 Ga0496112_0434031 3300048915 Bacteria 1252
334 Ga0496113_0006704 3300048916 Bacteria 7331
335 Ga0496113_0371729 3300048916 Bacteria 1147
336 Ga0496113_0380102 3300048916 Bacteria 1134
337 Ga0501031_0081332 3300049568 Bacteria 2112
338 Ga0501033_0141799 3300049570 Bacteria 1737
339 Ga0501036_0040726 3300049572 Bacteria 3930
340 Ga0501036_0332124 3300049572 Bacteria 1270
341 Ga0501036_0589791 3300049572 Bacteria 922
342 Ga0501038_0204658 3300049574 Bacteria 1582
343 Ga0501038_0531610 3300049574 Bacteria 896
344 Ga0501039_0118848 3300049575 Bacteria 2070
345 Ga0501039_0910470 3300049575 Unclassified 684
346 Ga0501040_0205663 3300049576 Bacteria 1398
347 Ga0501041_0013260 3300049577 Bacteria 4883
348 Ga0501041_0105887 3300049577 Bacteria 1743
349 Ga0501042_0048960 3300049578 Bacteria 3014
350 Ga0501042_0241810 3300049578 Bacteria 1302
351 Ga0501043_0232979 3300049579 Bacteria 1422
352 Ga0501043_0435706 3300049579 Bacteria 987
353 Ga0501043_0765095 3300049579 Bacteria 701
354 Ga0501046_0039804 3300049580 Bacteria 3761
355 Ga0501046_0440149 3300049580 Bacteria 938
356 Ga0501046_0764411 3300049580 Bacteria 678
357 Ga0501048_0085631 3300049582 Bacteria 2223
358 Ga0501068_0463051 3300049584 Bacteria 821
359 Ga0501069_0019247 3300049585 Bacteria 3690
360 Ga0501070_0206504 3300049586 Bacteria 1613
361 Ga0501071_0326640 3300049587 Bacteria 1165
362 Ga0501072_0140819 3300049588 Bacteria 1923
363 Ga0501072_0210750 3300049588 Bacteria 1548
364 Ga0501072_0236047 3300049588 Bacteria 1456
365 Ga0501074_0641900 3300049590 Bacteria 750
366 Ga0501075_0051142 3300049591 Bacteria 3106
367 Ga0501075_0424362 3300049591 Bacteria 1014
368 Ga0501075_0629158 3300049591 Bacteria 818
369 Ga0501076_0029236 3300049592 Bacteria 4285
370 Ga0501076_0133900 3300049592 Bacteria 2011
371 Ga0501077_0000661 3300049593 Bacteria 20841
372 Ga0501077_0002644 3300049593 Bacteria 10733
373 Ga0501077_0026432 3300049593 Bacteria 3684
374 Ga0501079_0046509 3300049741 Bacteria 3349
375 Ga0501079_0154856 3300049741 Bacteria 1786
376 Ga0501079_0182837 3300049741 Bacteria 1636
377 Ga0501080_0280639 3300049742 Bacteria 1515
378 Ga0501081_0016065 3300049743 Bacteria 4944
379 Ga0501081_0162120 3300049743 Bacteria 1611
380 Ga0501045_0016141 3300049824 Bacteria 5300
381 Ga0501045_0147657 3300049824 Bacteria 1749
382 Ga0501045_0184134 3300049824 Bacteria 1556
383 nmdc:mga05p37_375062_c1 3300050507 Bacteria 1668
384 nmdc:mga05p37_465341_c1 3300050507 Bacteria 1460
385 nmdc:mga05p37_490929_c1 3300050507 Unclassified 1412
386 nmdc:mga05p37_554200_c1 3300050507 Bacteria 1308
387 nmdc:mga05p37_694556_c1 3300050507 Bacteria 1131
388 nmdc:mga09592_727705_c1 3300050508 Unclassified 843
389 nmdc:mga0qj67_57096_c1 3300050509 Bacteria 3094
390 nmdc:mga06r32_243605_c1 3300050510 Bacteria 1785
391 nmdc:mga06r32_383970_c1 3300050510 Bacteria 1387
392 nmdc:mga06r32_572575_c1 3300050510 Bacteria 1102
393 nmdc:mga0n895_1119737_c1 3300050512 Bacteria 764
394 nmdc:mga0rr50_905379_c1 3300050513 Unclassified 752
395 nmdc:mga08x19_49222_c1 3300050514 Bacteria 2702
396 nmdc:mga0a205_45734_c1 3300050515 Bacteria 4221
397 Ga0501084_0004041 3300054114 Bacteria 11950
398 Ga0501084_0085666 3300054114 Bacteria 2645
399 Ga0501084_0268248 3300054114 Bacteria 1441
400 Ga0501084_0501944 3300054114 Bacteria 1025
401 Ga0590074_015712 3300059423 Bacteria 1286
402 Ga0590077_053425 3300059426 Bacteria 909
403 Ga0501082_0016448 3300060353 Bacteria 6367
404 Ga0501082_0200475 3300060353 Bacteria 1736
405 Ga0530510_0046167 3300061734 Bacteria 3147
406 Ga0530510_0130000 3300061734 Bacteria 1852
407 Ga0466967_0513568
408 Ga0065715_10590872
409 Ga0065715_10749840
410 Ga0070658_10019699
411 Ga0070658_10497650
412 Ga0070683_100006326
413 Ga0070683_100028427
414 Ga0070683_100085687
415 Ga0070683_100323595
416 Ga0070670_100053146
417 Ga0070670_100077204
418 Ga0070670_101031174
419 Ga0070666_10272818
420 Ga0070680_100013171
421 Ga0070680_100053332
422 Ga0070680_100094795
423 Ga0070682_100364098
424 Ga0068868_100323142
425 Ga0070660_100057010
426 Ga0070689_100448157
427 Ga0070689_100991733
428 Ga0070661_100018180
429 Ga0070661_100453550
430 Ga0070661_100609256
431 Ga0070692_10249924
432 Ga0070668_100132219
433 Ga0070669_100233441
434 Ga0070675_100013823
435 Ga0070671_100213205
436 Ga0070674_100209319
437 Ga0070673_100370085
438 Ga0070673_100498522
439 Ga0070659_100007057
440 Ga0070659_100018772
441 Ga0070659_100280454
442 Ga0070667_100505913
443 Ga0070667_100950990
444 Ga0070701_10180676
445 Ga0070694_100001179
446 Ga0070694_100181806
447 Ga0070708_100002050
448 Ga0070708_101286072
449 Ga0070662_100009218
450 Ga0070662_100027021
451 Ga0070662_100166026
452 Ga0070681_10000303
453 Ga0070681_10096322
454 Ga0070681_10107299
455 Ga0070681_10698852
456 Ga0068867_100021660
457 Ga0068867_100303952
458 Ga0068867_100448473
459 Ga0070706_100119990
460 Ga0070706_100172906
461 Ga0070706_101508751
462 Ga0070707_100026628
463 Ga0070707_100171090
464 Ga0070698_100220576
465 Ga0070698_100782045
466 Ga0070698_100877473
467 Ga0070699_100004345
468 Ga0070699_100176091
469 Ga0070679_100004979
470 Ga0070679_100171045
471 Ga0070679_100280837
472 Ga0070679_100570224
473 Ga0070684_100001320
474 Ga0070684_100001946
475 Ga0070684_100298654
476 Ga0070697_100833633
477 Ga0068853_100376202
478 Ga0068853_100819358
479 Ga0070672_100022313
480 Ga0070672_100152517
481 Ga0070672_100171451
482 Ga0070672_100266659
483 Ga0070672_100327860
484 Ga0070695_100002016
485 Ga0070695_100603438
486 Ga0070696_100038439
487 Ga0070696_100096853
488 Ga0070696_100121402
489 Ga0070696_100199710
490 Ga0070696_100210508
491 Ga0070665_100463978
492 Ga0070665_101178938
493 Ga0070704_100114423
494 Ga0070704_100349378
495 Ga0070704_100455892
496 Ga0070704_100922350
497 Ga0070664_100000766
498 Ga0070664_100002361
499 Ga0070664_100016971
500 Ga0070664_100023321
501 Ga0070664_100183555
502 Ga0070664_100291496
503 Ga0068857_100018525
504 Ga0068857_100020178
505 Ga0068854_100324308
506 Ga0068854_101081915
507 Ga0068859_100908536
508 Ga0068864_100038789
509 Ga0068866_10139990
510 Ga0068861_100897984
511 Ga0068861_101947987
512 Ga0068851_10057572
513 Ga0068851_10114515
514 Ga0068870_10331881
515 Ga0068863_100573960
516 Ga0068863_101064365
517 Ga0068858_100279219
518 Ga0068862_101178739
519 Ga0097621_100275508
520 Ga0097621_101532191
521 Ga0068871_100654009
522 Ga0075428_100016640
523 Ga0075428_100036544
524 Ga0075428_100330345
525 Ga0075430_100213341
526 Ga0075431_100424925
527 Ga0075431_100456490
528 Ga0075431_100521325
529 Ga0075431_101009002
530 Ga0075431_101136062
531 Ga0075434_100316628
532 Ga0075434_101357801
533 Ga0075429_100535076
534 Ga0068865_100295939
535 Ga0097620_100908522
536 Ga0075435_100987963
537 Ga0099794_10142070
538 Ga0099794_10341143
539 Ga0099795_10119217
540 Ga0105240_10174418
541 Ga0111539_10364671
542 Ga0111539_10385099
543 Ga0114129_10029523
544 Ga0114129_10094349
545 Ga0114129_10137023
546 Ga0105243_10134285
547 Ga0105242_10078353
548 Ga0105242_10178431
549 Ga0105242_12109883
550 Ga0105248_10045289
551 Ga0105248_10120245
552 Ga0105248_10704398
553 Ga0105249_10853675
554 Ga0105246_10817820
555 Ga0157373_10081104
556 Ga0157370_10371857
557 Ga0157369_10113942
558 Ga0157369_10337040
559 Ga0157369_10915382
560 Ga0157374_10272034
561 Ga0157378_10023039
562 Ga0157378_10287381
563 Ga0163162_10459738
564 Ga0157372_11086956
565 Ga0157372_11594510
566 Ga0157375_10048372
567 Ga0157375_10275496
568 Ga0157375_11932772
569 Ga0163163_10057571
570 Ga0157380_10205945
571 Ga0157376_11529840
572 Ga0163161_10207418
573 Ga0163161_10229005
574 Ga0213876_10014914
575 Ga0207682_10022004
576 Ga0207642_10151953
577 Ga0207680_10823062
578 Ga0207645_10137244
579 Ga0207684_10308730
580 Ga0207707_10016252
581 Ga0207707_10039089
582 Ga0207707_10319250
583 Ga0207707_10383792
584 Ga0207660_10076841
585 Ga0207660_10086378
586 Ga0207660_10391354
587 Ga0207657_10208434
588 Ga0207649_10038028
589 Ga0207649_10621621
590 Ga0207652_10041099
591 Ga0207646_10015751
592 Ga0207646_10164846
593 Ga0207646_10372809
594 Ga0207681_10433961
595 Ga0207694_10284614
596 Ga0207650_10072369
597 Ga0207650_10316811
598 Ga0207650_11090193
599 Ga0207659_10019838
600 Ga0207659_10224946
601 Ga0207690_10018124
602 Ga0207690_10059508
603 Ga0207706_10072122
604 Ga0207706_10342356
605 Ga0207706_10434843
606 Ga0207686_10019663
607 Ga0207686_10039368
608 Ga0207709_10302829
609 Ga0207670_10608649
610 Ga0207669_10210042
611 Ga0207669_10245677
612 Ga0207691_10008344
613 Ga0207691_10257684
614 Ga0207661_10002434
615 Ga0207661_10364076
616 Ga0207661_10374793
617 Ga0207679_10001018
618 Ga0207679_10031122
619 Ga0207679_10035044
620 Ga0207679_10160005
621 Ga0207667_10318260
622 Ga0207651_10070933
623 Ga0207651_10298473
624 Ga0207651_10452607
625 Ga0207651_10495848
626 Ga0207668_10196541
627 Ga0207677_10057012
628 Ga0207703_10656234
629 Ga0207639_10044808
630 Ga0207639_11456986
631 Ga0207678_10184515
632 Ga0207648_10047385
633 Ga0207648_10150343
634 Ga0207648_10486761
635 Ga0207676_10046176
636 Ga0207676_10249028
637 Ga0207676_11066033
638 Ga0207674_10001729
639 Ga0207674_10005023
640 Ga0207675_101469365
641 Ga0207675_101905880
642 Ga0207683_10381782
643 Ga0207698_10057851
644 Ga0207698_11059553
645 Ga0209179_1051393
646 Ga0207428_10454183
647 Ga0268266_10249331
648 Ga0268266_10292761
649 Ga0268266_10928569
650 Ga0268265_10224588
651 Ga0307408_100060109
652 Ga0307408_100329973
653 Ga0307405_10003921
654 Ga0307405_10346443
655 Ga0307413_10049759
656 Ga0307410_10001609
657 Ga0307410_10047485
658 Ga0307410_10249761
659 Ga0307406_10017833
660 Ga0307406_10087121
661 Ga0307406_10438114
662 Ga0307407_10008436
663 Ga0307407_10270119
664 Ga0307407_10433076
665 Ga0307407_10455641
666 Ga0307412_10015916
667 Ga0307412_10077474
668 Ga0307412_10238557
669 Ga0307412_10573933
670 Ga0307409_100024603
671 Ga0307409_100164852
672 Ga0307409_100275538
673 Ga0307409_100333255
674 Ga0307409_100607558
675 Ga0307416_100000456
676 Ga0307416_100069039
677 Ga0307416_100448173
678 Ga0307416_102675290
679 Ga0307414_10087793
680 Ga0307414_10649698
681 Ga0307411_10021355
682 Ga0307411_10058640
683 Ga0307415_100006540
684 Ga0307415_100025345
685 Ga0307415_100082169
686 Ga0307415_100561194
687 Ga0307415_101017876
688 Ga0373959_0076435
689 Ga0373943_0019665
690 Ga0373947_0082020
691 Ga0395899_0016742
692 Ga0395900_0066164
693 Ga0395905_0018851
694 Ga0395901_0009870
695 Ga0436365_0505723
696 Ga0436365_1071583
697 Ga0436365_1165633
698 Ga0439439_0076754
699 Ga0451839_0722268
700 Ga0450894_014490
701 Ga0450895_001760
702 Ga0450896_000466
703 Ga0450908_047683
704 Ga0451576_0236014
705 Ga0466958_0209057
706 Ga0495582_0133531
707 Ga0495594_0167221
708 Ga0495630_0229699
709 Ga0495663_0071401
710 Ga0495659_0018377
711 Ga0495657_0246626
712 Ga0495669_0031494
713 Ga0495670_0153212
714 Ga0495600_0128519
715 Ga0495581_0151678
716 Ga0495674_0061385
717 Ga0495675_0116833
718 Ga0495677_0093270
719 Ga0495684_0050760
720 Ga0496100_0201446
721 Ga0496101_0070978
722 Ga0496104_0003965
723 Ga0496104_0127380
724 Ga0496104_0674778
725 Ga0496105_0020324
726 Ga0496105_0276759
727 Ga0496106_0418670
728 Ga0496106_0443668
729 Ga0496107_0451280
730 Ga0496108_0063993
731 Ga0496109_0001175
732 Ga0496109_1335069
733 Ga0496110_0006316
734 Ga0496111_0010625
735 Ga0496111_0439313
736 Ga0496112_0003297
737 Ga0496112_0014440
738 Ga0496112_0231498
739 Ga0496112_0434031
740 Ga0496113_0006704
741 Ga0496113_0371729
742 Ga0496113_0380102
743 Ga0501031_0081332
744 Ga0501033_0141799
745 Ga0501036_0040726
746 Ga0501036_0332124
747 Ga0501036_0589791
748 Ga0501038_0204658
749 Ga0501038_0531610
750 Ga0501039_0118848
751 Ga0501039_0910470
752 Ga0501040_0205663
753 Ga0501041_0013260
754 Ga0501041_0105887
755 Ga0501042_0048960
756 Ga0501042_0241810
757 Ga0501043_0232979
758 Ga0501043_0435706
759 Ga0501043_0765095
760 Ga0501046_0039804
761 Ga0501046_0440149
762 Ga0501046_0764411
763 Ga0501048_0085631
764 Ga0501068_0463051
765 Ga0501069_0019247
766 Ga0501070_0206504
767 Ga0501071_0326640
768 Ga0501072_0140819
769 Ga0501072_0210750
770 Ga0501072_0236047
771 Ga0501074_0641900
772 Ga0501075_0051142
773 Ga0501075_0424362
774 Ga0501075_0629158
775 Ga0501076_0029236
776 Ga0501076_0133900
777 Ga0501077_0000661
778 Ga0501077_0002644
779 Ga0501077_0026432
780 Ga0501079_0046509
781 Ga0501079_0154856
782 Ga0501079_0182837
783 Ga0501080_0280639
784 Ga0501081_0016065
785 Ga0501081_0162120
786 Ga0501045_0016141
787 Ga0501045_0147657
788 Ga0501045_0184134
789 nmdc:mga05p37_375062_c1
790 nmdc:mga05p37_465341_c1
791 nmdc:mga05p37_490929_c1
792 nmdc:mga05p37_554200_c1
793 nmdc:mga05p37_694556_c1
794 nmdc:mga09592_727705_c1
795 nmdc:mga0qj67_57096_c1
796 nmdc:mga06r32_243605_c1
797 nmdc:mga06r32_383970_c1
798 nmdc:mga06r32_572575_c1
799 nmdc:mga0n895_1119737_c1
800 nmdc:mga0rr50_905379_c1
801 nmdc:mga08x19_49222_c1
802 nmdc:mga0a205_45734_c1
803 Ga0501084_0004041
804 Ga0501084_0085666
805 Ga0501084_0268248
806 Ga0501084_0501944
807 Ga0590074_015712
808 Ga0590077_053425
809 Ga0501082_0016448
810 Ga0501082_0200475
811 Ga0530510_0046167
812 Ga0530510_0130000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

36

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d93-assembly2.cif.gz_C crystal structure of the na+,k+-atpase in the e2p state with bound mg2+ and anthroylouabain (p2(1)2(1)2(1) symmetry) 0.4296 71 168
6knm-assembly1.cif.gz_B apelin receptor in complex with single domain antibody 0.3894 13 168
6knm-assembly1.cif.gz_B apelin receptor in complex with single domain antibody 0.3556 13 168
6xi6-assembly1.cif.gz_A-3 hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks 0.3433 20 175
8imk-assembly1.cif.gz_A d3-d4, d1-d2, d'3-d'4, d'1-d'2 cylinder in cyanobacterial phycobilisome from anthocerotibacter panamensis (cluster c) 0.3359 10 155
ID Description Score Start End Superfamily
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7414 19 126 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6986 17 154 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6707 19 126 1.20.120.550
af_Q9LSW5_1_134_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6248 17 130 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6006 17 154 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1Q7AG07-F1-model_v4 DoxX family protein 0.9874 13 175 GO:0005886
AF-A0A2V8D0H7-F1-model_v4 Oxidoreductase 0.9762 14 106 GO:0005886
AF-A0A4R6ADG5-F1-model_v4 deleted 0.9703 11 140
AF-A0A1Q7AG07-F1-model_v4 DoxX family protein 0.9697 13 175 GO:0005886
AF-A0A2V6WT46-F1-model_v4 DoxX family protein 0.9696 11 128 GO:0005886

Map