F436275

General Info

Members Datasets Scaffolds Average Seq Length
406 197 812 285

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0047820|Ga0395905_0047820_780_1691
Length 293
Sequence MAKRLAEDSVEHGARGGVPPVLFVLAAALLWSTGSLFIKATPLGALELSFGRSLLAAFTVALLTRREGFGINPLTLVAAALANKLTTAANAIFLQYTAPVYVLLLEPLLFKERFRLADLLVVAACVAGMSLFFVGQLRPQDVEGNLTALASGLCFAFFLLLLRHQRAGTVNRASSVIYGNLIICALTAPAFARAVPSLTTRDVAIVSYLGVVQIGLAYTFFTLGIARGVRSLDAGVVGYVEPMLNPVWVFLFLGERPSGWAVVGGCVIIAAVLAHTIALARRGRTKVSASKAG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
150 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
151 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
154 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
163 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
166 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
169 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
172 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
173 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
174 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
175 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
176 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
179 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
182 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
185 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
186 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
187 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
188 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
189 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 29.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0047820 3300037471 Bacteria 4008
2 CNAas_1000270 3300000532 Unclassified 4979
3 JGI25406J46586_10071973 3300003203 Bacteria 1082
4 rootL2_10156465 3300003322 Unclassified 2196
5 Ga0065704_10001508 3300005289 Bacteria 7472
6 Ga0065704_10092649 3300005289 Bacteria 2642
7 Ga0065712_10000113 3300005290 Bacteria 191931
8 Ga0065712_10076787 3300005290 Unclassified 3602
9 Ga0065715_10025933 3300005293 Unclassified 2121
10 Ga0065715_10089989 3300005293 Bacteria 7944
11 Ga0065715_10109096 3300005293 Bacteria 2679
12 Ga0065715_10112186 3300005293 Bacteria 2539
13 Ga0065715_10143354 3300005293 Bacteria 1815
14 Ga0065707_10128746 3300005295 Unclassified 1940
15 Ga0070670_100001515 3300005331 Bacteria 18706
16 Ga0070670_100101216 3300005331 Bacteria 2481
17 Ga0070677_10057468 3300005333 Bacteria 1594
18 Ga0068869_100044164 3300005334 Bacteria 3204
19 Ga0068869_100482841 3300005334 Bacteria 1032
20 Ga0070680_100009102 3300005336 Bacteria 7616
21 Ga0070680_100019946 3300005336 Bacteria 5314
22 Ga0070680_100023301 3300005336 Unclassified 4937
23 Ga0070680_100044379 3300005336 Bacteria 3613
24 Ga0070680_100421283 3300005336 Bacteria 1139
25 Ga0070682_100000076 3300005337 Bacteria 90097
26 Ga0070682_100009886 3300005337 Bacteria 5402
27 Ga0070660_100019397 3300005339 Bacteria 4984
28 Ga0070689_100000349 3300005340 Bacteria 27057
29 Ga0070689_100260958 3300005340 Bacteria 1432
30 Ga0070689_100271278 3300005340 Bacteria 1405
31 Ga0070687_100043049 3300005343 Bacteria 2292
32 Ga0070692_10203606 3300005345 Bacteria 1161
33 Ga0070669_100005541 3300005353 Bacteria 9116
34 Ga0070669_100009659 3300005353 Bacteria 6872
35 Ga0070673_100095225 3300005364 Bacteria 2442
36 Ga0070659_100002627 3300005366 Bacteria 12778
37 Ga0070701_10081868 3300005438 Unclassified 1749
38 Ga0070700_100000146 3300005441 Bacteria 42073
39 Ga0070700_100112003 3300005441 Unclassified 1816
40 Ga0070694_100031421 3300005444 Bacteria 3482
41 Ga0070694_100038123 3300005444 Bacteria 3192
42 Ga0070694_100052392 3300005444 Bacteria 2758
43 Ga0070694_100338504 3300005444 Bacteria 1162
44 Ga0070708_100000257 3300005445 Bacteria 39748
45 Ga0070662_100242866 3300005457 Bacteria 1445
46 Ga0070681_10000273 3300005458 Bacteria 41372
47 Ga0070681_10009579 3300005458 Bacteria 9524
48 Ga0070681_10023581 3300005458 Bacteria 6189
49 Ga0068867_100030050 3300005459 Bacteria 3918
50 Ga0068867_100139928 3300005459 Bacteria 1891
51 Ga0068867_100381146 3300005459 Bacteria 1184
52 Ga0070706_100129938 3300005467 Bacteria 2350
53 Ga0070706_100193945 3300005467 Bacteria 1898
54 Ga0070707_100182177 3300005468 Bacteria 2048
55 Ga0070707_100305617 3300005468 Bacteria 1546
56 Ga0070698_100135713 3300005471 Bacteria 2414
57 Ga0070698_100215438 3300005471 Bacteria 1854
58 Ga0070699_100000196 3300005518 Bacteria 59314
59 Ga0070699_100006584 3300005518 Bacteria 10106
60 Ga0070699_100119641 3300005518 Bacteria 2315
61 Ga0070699_100366012 3300005518 Unclassified 1300
62 Ga0070679_100001215 3300005530 Bacteria 22690
63 Ga0070679_100230085 3300005530 Bacteria 1813
64 Ga0070679_100406103 3300005530 Unclassified 1308
65 Ga0070697_100001275 3300005536 Bacteria 19011
66 Ga0070697_100059747 3300005536 Bacteria 3105
67 Ga0070697_100163007 3300005536 Unclassified 1884
68 Ga0068853_100139374 3300005539 Unclassified 2177
69 Ga0070686_100095545 3300005544 Bacteria 1997
70 Ga0070695_100079066 3300005545 Bacteria 2170
71 Ga0070696_100023739 3300005546 Unclassified 4169
72 Ga0070696_100086996 3300005546 Bacteria 2219
73 Ga0070696_100120845 3300005546 Bacteria 1896
74 Ga0070696_100166918 3300005546 Bacteria 1625
75 Ga0070693_100130133 3300005547 Unclassified 1572
76 Ga0070693_100148352 3300005547 Unclassified 1483
77 Ga0070704_100010948 3300005549 Bacteria 5532
78 Ga0070704_100034880 3300005549 Bacteria 3416
79 Ga0070704_100045651 3300005549 Bacteria 3050
80 Ga0070704_100204100 3300005549 Bacteria 1597
81 Ga0068855_100189909 3300005563 Bacteria 2318
82 Ga0068857_100119099 3300005577 Unclassified 2376
83 Ga0068854_100029121 3300005578 Unclassified 3821
84 Ga0070702_100046566 3300005615 Bacteria 2458
85 Ga0068859_100002136 3300005617 Bacteria 20126
86 Ga0068859_100027795 3300005617 Bacteria 5673
87 Ga0068859_100061584 3300005617 Bacteria 3781
88 Ga0068859_100066256 3300005617 Unclassified 3646
89 Ga0068859_100152367 3300005617 Unclassified 2387
90 Ga0068859_100218157 3300005617 Unclassified 1995
91 Ga0068859_100318697 3300005617 Bacteria 1649
92 Ga0068859_100373981 3300005617 Unclassified 1520
93 Ga0068864_100006993 3300005618 Bacteria 9257
94 Ga0068864_100015693 3300005618 Bacteria 6299
95 Ga0068864_100235760 3300005618 Unclassified 1694
96 Ga0068864_100288216 3300005618 Unclassified 1534
97 Ga0068864_100292109 3300005618 Unclassified 1524
98 Ga0068864_100683442 3300005618 Bacteria 1001
99 Ga0068861_100015390 3300005719 Bacteria 5389
100 Ga0068861_100081170 3300005719 Bacteria 2538
101 Ga0068861_100332819 3300005719 Bacteria 1326
102 Ga0068851_10000641 3300005834 Bacteria 14887
103 Ga0068870_10016897 3300005840 Bacteria 3498
104 Ga0068863_100061668 3300005841 Bacteria 3546
105 Ga0068863_100087329 3300005841 Unclassified 2955
106 Ga0068863_100186684 3300005841 Bacteria 1991
107 Ga0068863_100374460 3300005841 Bacteria 1390
108 Ga0068863_100538803 3300005841 Bacteria 1152
109 Ga0068858_100036842 3300005842 Unclassified 4535
110 Ga0068858_100075892 3300005842 Unclassified 3123
111 Ga0068860_100028259 3300005843 Bacteria 5398
112 Ga0068860_100037025 3300005843 Bacteria 4671
113 Ga0068860_100074096 3300005843 Bacteria 3236
114 Ga0068860_100618379 3300005843 Unclassified 1090
115 Ga0068862_100071844 3300005844 Unclassified 2988
116 Ga0068862_100495196 3300005844 Bacteria 1159
117 Ga0081539_10000514 3300005985 Bacteria 80510
118 Ga0081539_10001769 3300005985 Bacteria 34433
119 Ga0070716_100018937 3300006173 Bacteria 3593
120 Ga0097621_100210990 3300006237 Bacteria 1689
121 Ga0068871_100006877 3300006358 Bacteria 8099
122 Ga0068871_100201380 3300006358 Unclassified 1719
123 Ga0075428_100365636 3300006844 Bacteria 1547
124 Ga0075430_100119853 3300006846 Unclassified 2193
125 Ga0075431_100092378 3300006847 Bacteria 3123
126 Ga0075431_100186887 3300006847 Unclassified 2124
127 Ga0075433_10189725 3300006852 Bacteria 1828
128 Ga0075433_10271684 3300006852 Bacteria 1502
129 Ga0075434_100044123 3300006871 Bacteria 4423
130 Ga0075434_100120990 3300006871 Unclassified 2633
131 Ga0097620_100002136 3300006931 Bacteria 20126
132 Ga0097620_100027795 3300006931 Bacteria 5673
133 Ga0097620_100052956 3300006931 Unclassified 4081
134 Ga0097620_100061582 3300006931 Bacteria 3781
135 Ga0097620_100066258 3300006931 Unclassified 3646
136 Ga0097620_100152379 3300006931 Unclassified 2387
137 Ga0097620_100218154 3300006931 Unclassified 1995
138 Ga0097620_100318714 3300006931 Bacteria 1649
139 Ga0097620_100373976 3300006931 Unclassified 1520
140 Ga0075435_100316993 3300007076 Bacteria 1334
141 Ga0105240_10119098 3300009093 Bacteria 3181
142 Ga0105240_10379151 3300009093 Unclassified 1597
143 Ga0111539_10042544 3300009094 Bacteria 5453
144 Ga0111539_10054124 3300009094 Bacteria 4776
145 Ga0111539_10159849 3300009094 Unclassified 2635
146 Ga0105247_10021708 3300009101 Bacteria 3863
147 Ga0105247_10076549 3300009101 Unclassified 2101
148 Ga0105247_10122227 3300009101 Bacteria 1688
149 Ga0105247_10166436 3300009101 Unclassified 1463
150 Ga0114129_10014022 3300009147 Bacteria 11415
151 Ga0114129_10036154 3300009147 Bacteria 6975
152 Ga0114129_10215535 3300009147 Bacteria 2593
153 Ga0114129_10228835 3300009147 Unclassified 2505
154 Ga0114129_10919364 3300009147 Unclassified 1107
155 Ga0114129_11128124 3300009147 Unclassified 980
156 Ga0105243_10023260 3300009148 Bacteria 4717
157 Ga0105243_10082804 3300009148 Bacteria 2623
158 Ga0105243_10124666 3300009148 Bacteria 2177
159 Ga0105241_10124210 3300009174 Bacteria 2082
160 Ga0105248_10011119 3300009177 Bacteria 9933
161 Ga0105248_10026801 3300009177 Bacteria 6411
162 Ga0105248_10060504 3300009177 Bacteria 4252
163 Ga0105248_10165695 3300009177 Bacteria 2492
164 Ga0105248_10194134 3300009177 Unclassified 2287
165 Ga0105248_10332263 3300009177 Unclassified 1712
166 Ga0105237_10001605 3300009545 Bacteria 29357
167 Ga0105237_10082971 3300009545 Bacteria 3196
168 Ga0105237_10269121 3300009545 Bacteria 1707
169 Ga0105238_10021717 3300009551 Bacteria 6538
170 Ga0105238_10074314 3300009551 Bacteria 3392
171 Ga0105249_10000480 3300009553 Bacteria 37106
172 Ga0105249_10036304 3300009553 Bacteria 4470
173 Ga0105249_10317685 3300009553 Bacteria 1568
174 Ga0105249_10339152 3300009553 Unclassified 1519
175 Ga0157373_10006408 3300013100 Bacteria 8793
176 Ga0157373_10040297 3300013100 Bacteria 3343
177 Ga0157373_10128730 3300013100 Bacteria 1780
178 Ga0157373_10196934 3300013100 Bacteria 1420
179 Ga0157378_10200866 3300013297 Bacteria 1885
180 Ga0157378_10280742 3300013297 Unclassified 1605
181 Ga0157378_10368773 3300013297 Bacteria 1407
182 Ga0163162_10000477 3300013306 Bacteria 37086
183 Ga0163162_10002737 3300013306 Bacteria 16735
184 Ga0163162_10037891 3300013306 Unclassified 4812
185 Ga0163162_10151534 3300013306 Bacteria 2437
186 Ga0157372_10061529 3300013307 Bacteria 4204
187 Ga0157372_10349064 3300013307 Bacteria 1724
188 Ga0157375_10127415 3300013308 Bacteria 2662
189 Ga0157375_10174470 3300013308 Bacteria 2298
190 Ga0157375_10280508 3300013308 Bacteria 1829
191 Ga0157375_10548547 3300013308 Unclassified 1318
192 Ga0157375_10849150 3300013308 Unclassified 1060
193 Ga0163163_10024015 3300014325 Bacteria 5799
194 Ga0163163_10122035 3300014325 Unclassified 2640
195 Ga0163163_10340216 3300014325 Unclassified 1556
196 Ga0157380_10005850 3300014326 Bacteria 8608
197 Ga0157380_10015481 3300014326 Bacteria 5607
198 Ga0157380_10059518 3300014326 Bacteria 3049
199 Ga0157380_10120844 3300014326 Bacteria 2219
200 Ga0157379_10070594 3300014968 Bacteria 3125
201 Ga0157376_10517208 3300014969 Unclassified 1176
202 Ga0207656_10003068 3300025321 Bacteria 5712
203 Ga0207653_10094323 3300025885 Bacteria 1052
204 Ga0207642_10190177 3300025899 Unclassified 1126
205 Ga0207710_10041318 3300025900 Unclassified 2045
206 Ga0207647_10000801 3300025904 Bacteria 24373
207 Ga0207647_10060879 3300025904 Unclassified 2306
208 Ga0207643_10002665 3300025908 Bacteria 9644
209 Ga0207684_10050933 3300025910 Bacteria 3513
210 Ga0207654_10100349 3300025911 Bacteria 1783
211 Ga0207654_10146331 3300025911 Bacteria 1512
212 Ga0207654_10276409 3300025911 Bacteria 1135
213 Ga0207707_10000008 3300025912 Bacteria 330313
214 Ga0207707_10018656 3300025912 Bacteria 6048
215 Ga0207707_10076526 3300025912 Bacteria 2920
216 Ga0207695_10037569 3300025913 Bacteria 5224
217 Ga0207671_10003525 3300025914 Bacteria 15516
218 Ga0207660_10001514 3300025917 Bacteria 15632
219 Ga0207660_10013566 3300025917 Bacteria 5342
220 Ga0207660_10107332 3300025917 Bacteria 2095
221 Ga0207662_10132878 3300025918 Bacteria 1570
222 Ga0207662_10273245 3300025918 Unclassified 1116
223 Ga0207662_10300044 3300025918 Bacteria 1068
224 Ga0207657_10113905 3300025919 Bacteria 2231
225 Ga0207652_10000065 3300025921 Bacteria 111252
226 Ga0207652_10081429 3300025921 Bacteria 2832
227 Ga0207681_10000879 3300025923 Bacteria 19782
228 Ga0207694_10006463 3300025924 Bacteria 8930
229 Ga0207650_10001705 3300025925 Bacteria 15606
230 Ga0207650_10158341 3300025925 Unclassified 1792
231 Ga0207690_10051304 3300025932 Bacteria 2758
232 Ga0207706_10040510 3300025933 Unclassified 4128
233 Ga0207709_10046242 3300025935 Bacteria 2640
234 Ga0207709_10046655 3300025935 Bacteria 2630
235 Ga0207709_10120237 3300025935 Bacteria 1772
236 Ga0207670_10004484 3300025936 Bacteria 7523
237 Ga0207670_10211331 3300025936 Bacteria 1480
238 Ga0207665_10265661 3300025939 Bacteria 1273
239 Ga0207711_10070242 3300025941 Bacteria 3036
240 Ga0207711_10072409 3300025941 Bacteria 2994
241 Ga0207711_10082838 3300025941 Unclassified 2805
242 Ga0207689_10003266 3300025942 Bacteria 14867
243 Ga0207689_10008239 3300025942 Bacteria 9082
244 Ga0207689_10150252 3300025942 Bacteria 1920
245 Ga0207679_10395563 3300025945 Unclassified 1214
246 Ga0207712_10073006 3300025961 Unclassified 2473
247 Ga0207712_10145283 3300025961 Bacteria 1825
248 Ga0207712_10286006 3300025961 Bacteria 1347
249 Ga0207712_10411704 3300025961 Unclassified 1139
250 Ga0207640_10084074 3300025981 Unclassified 2184
251 Ga0207640_10195742 3300025981 Bacteria 1527
252 Ga0207677_10460341 3300026023 Unclassified 1092
253 Ga0207703_10109696 3300026035 Unclassified 2353
254 Ga0207703_10150931 3300026035 Bacteria 2026
255 Ga0207639_10051150 3300026041 Unclassified 3141
256 Ga0207639_10069519 3300026041 Unclassified 2747
257 Ga0207639_10104823 3300026041 Unclassified 2293
258 Ga0207708_10000278 3300026075 Bacteria 40132
259 Ga0207708_10002815 3300026075 Bacteria 12782
260 Ga0207708_10082711 3300026075 Bacteria 2468
261 Ga0207708_10507486 3300026075 Bacteria 1012
262 Ga0207641_10030006 3300026088 Unclassified 4501
263 Ga0207641_10033932 3300026088 Bacteria 4242
264 Ga0207641_10119011 3300026088 Unclassified 2354
265 Ga0207641_10136844 3300026088 Bacteria 2206
266 Ga0207648_10012038 3300026089 Bacteria 8115
267 Ga0207648_10090205 3300026089 Bacteria 2678
268 Ga0207648_10196034 3300026089 Bacteria 1791
269 Ga0207648_10292721 3300026089 Bacteria 1458
270 Ga0207676_10024490 3300026095 Bacteria 4466
271 Ga0207676_10138661 3300026095 Bacteria 2079
272 Ga0207676_10321043 3300026095 Bacteria 1422
273 Ga0207676_10592832 3300026095 Bacteria 1064
274 Ga0207674_10000079 3300026116 Bacteria 102085
275 Ga0207674_10105620 3300026116 Unclassified 2794
276 Ga0207674_10135520 3300026116 Unclassified 2424
277 Ga0207674_10177167 3300026116 Unclassified 2084
278 Ga0207674_10364429 3300026116 Unclassified 1397
279 Ga0207675_100021087 3300026118 Bacteria 6072
280 Ga0207675_100026267 3300026118 Bacteria 5421
281 Ga0207675_100153085 3300026118 Unclassified 2196
282 Ga0207675_100196568 3300026118 Bacteria 1936
283 Ga0207428_10006541 3300027907 Bacteria 10746
284 Ga0207428_10028946 3300027907 Bacteria 4597
285 Ga0268265_10054214 3300028380 Unclassified 3041
286 Ga0268265_10063733 3300028380 Unclassified 2837
287 Ga0268265_10339701 3300028380 Bacteria 1367
288 Ga0268265_10363281 3300028380 Unclassified 1326
289 Ga0268264_10043092 3300028381 Unclassified 3738
290 Ga0268264_10056173 3300028381 Bacteria 3290
291 Ga0268264_10073729 3300028381 Bacteria 2898
292 Ga0268264_10231823 3300028381 Unclassified 1706
293 Ga0314311_1245859 3300030733 Bacteria 1881
294 Ga0307513_10019683 3300031456 Bacteria 8027
295 Ga0307408_100008536 3300031548 Bacteria 6765
296 Ga0307408_100517590 3300031548 Bacteria 1047
297 Ga0307405_10005314 3300031731 Bacteria 6197
298 Ga0307413_10196603 3300031824 Bacteria 1452
299 Ga0307410_10013332 3300031852 Unclassified 4792
300 Ga0307406_10019733 3300031901 Unclassified 3959
301 Ga0307407_10293606 3300031903 Bacteria 1131
302 Ga0307412_10041141 3300031911 Bacteria 2993
303 Ga0307412_10062576 3300031911 Bacteria 2506
304 Ga0307416_100022011 3300032002 Unclassified 4590
305 Ga0307414_10011521 3300032004 Bacteria 5190
306 Ga0307411_10078270 3300032005 Unclassified 2266
307 Ga0307411_10408493 3300032005 Bacteria 1124
308 Ga0307415_100022075 3300032126 Unclassified 3923
309 Ga0307415_100131816 3300032126 Bacteria 1894
310 Ga0373951_0000998 3300035091 Bacteria 7596
311 Ga0395898_0108172 3300037466 Unclassified 2666
312 Ga0395898_0127412 3300037466 Unclassified 2439
313 Ga0395905_0752846 3300037471 Unclassified 877
314 Ga0395901_0267489 3300038443 Bacteria 1779
315 Ga0242422_00658 3300038699 Bacteria 2260
316 Ga0439455_0008006 3300042012 Bacteria 2253
317 Ga0451576_0310692 3300045051 Unclassified 1649
318 Ga0495663_0001026 3300046525 Bacteria 9236
319 Ga0495598_0000315 3300046537 Bacteria 8633
320 Ga0495621_0004390 3300046539 Unclassified 3965
321 Ga0496106_0071558 3300048909 Unclassified 2651
322 Ga0496106_0139213 3300048909 Unclassified 1908
323 Ga0496108_0020452 3300048911 Bacteria 5442
324 Ga0496112_0327035 3300048915 Bacteria 1477
325 Ga0496112_0584738 3300048915 Unclassified 1049
326 Ga0496113_0520301 3300048916 Bacteria 955
327 Ga0501291_002547 3300049514 Bacteria 2191
328 Ga0501291_005229 3300049514 Bacteria 1686
329 Ga0501296_003312 3300049519 Bacteria 1713
330 Ga0501297_000857 3300049520 Unclassified 2725
331 Ga0501298_001083 3300049521 Unclassified 3906
332 Ga0501298_005987 3300049521 Bacteria 1974
333 Ga0501298_007646 3300049521 Unclassified 1796
334 Ga0501300_007364 3300049523 Bacteria 1615
335 Ga0501303_006330 3300049526 Bacteria 1031
336 Ga0501038_0010820 3300049574 Bacteria 8338
337 Ga0501048_0125831 3300049582 Bacteria 1812
338 Ga0501198_001885 3300049649 Bacteria 2769
339 Ga0501198_005450 3300049649 Bacteria 1793
340 Ga0501199_005956 3300049650 Bacteria 1233
341 Ga0501202_000580 3300049652 Bacteria 5329
342 Ga0501202_008330 3300049652 Bacteria 1888
343 Ga0501202_020155 3300049652 Unclassified 1323
344 Ga0501206_005447 3300049653 Bacteria 1638
345 Ga0501207_000815 3300049654 Unclassified 3689
346 Ga0501209_040662 3300049656 Bacteria 1228
347 Ga0501216_000491 3300049660 Unclassified 4709
348 Ga0501216_007085 3300049660 Bacteria 1736
349 Ga0501216_009943 3300049660 Bacteria 1523
350 Ga0501217_001018 3300049661 Bacteria 5083
351 Ga0501217_002601 3300049661 Bacteria 3573
352 Ga0501217_013630 3300049661 Bacteria 1826
353 Ga0501223_001811 3300049663 Unclassified 4824
354 Ga0501223_004736 3300049663 Unclassified 2894
355 Ga0501223_007358 3300049663 Bacteria 2254
356 Ga0501224_000348 3300049664 Bacteria 5391
357 Ga0501224_007014 3300049664 Bacteria 1639
358 Ga0501227_001393 3300049665 Bacteria 5408
359 Ga0501227_021443 3300049665 Bacteria 1490
360 Ga0501230_000408 3300049667 Unclassified 4189
361 Ga0501230_000634 3300049667 Unclassified 3710
362 Ga0501230_016724 3300049667 Unclassified 1233
363 Ga0501233_005174 3300049668 Bacteria 2415
364 Ga0501233_008122 3300049668 Bacteria 2016
365 Ga0501233_009261 3300049668 Bacteria 1918
366 Ga0501235_000877 3300049669 Bacteria 6172
367 Ga0501235_006655 3300049669 Bacteria 2516
368 Ga0501240_000190 3300049673 Unclassified 4425
369 Ga0501243_004316 3300049675 Bacteria 2130
370 Ga0501243_006105 3300049675 Bacteria 1823
371 Ga0501243_012201 3300049675 Bacteria 1354
372 Ga0501246_001893 3300049676 Bacteria 1630
373 Ga0501249_006008 3300049679 Bacteria 2492
374 Ga0501249_029137 3300049679 Bacteria 1227
375 Ga0501250_004779 3300049680 Bacteria 1365
376 Ga0501251_001284 3300049681 Unclassified 2336
377 Ga0501257_012107 3300049686 Bacteria 1971
378 Ga0501261_001759 3300049690 Unclassified 2667
379 Ga0501261_011328 3300049690 Bacteria 1186
380 Ga0501221_001028 3300049704 Unclassified 4585
381 Ga0501225_0001087 3300049705 Bacteria 8532
382 Ga0501229_011551 3300049706 Bacteria 1121
383 Ga0501234_000731 3300049707 Bacteria 5082
384 Ga0501234_006287 3300049707 Bacteria 1858
385 Ga0501234_013743 3300049707 Bacteria 1271
386 Ga0501234_020591 3300049707 Bacteria 1049
387 Ga0501079_0175155 3300049741 Bacteria 1673
388 Ga0501271_004740 3300049768 Bacteria 1302
389 Ga0501273_005282 3300049770 Bacteria 1453
390 Ga0501273_015282 3300049770 Unclassified 995
391 Ga0501279_006859 3300049775 Bacteria 1507
392 Ga0501280_008844 3300049776 Bacteria 1402
393 Ga0501283_001790 3300049779 Bacteria 2785
394 Ga0501226_000806 3300049853 Unclassified 4216
395 nmdc:mga05p37_31617_c1 3300050507 Bacteria 6466
396 nmdc:mga05p37_389915_c1 3300050507 Unclassified 1629
397 nmdc:mga09592_67398_c1 3300050508 Bacteria 3035
398 nmdc:mga0qj67_78718_c1 3300050509 Unclassified 2639
399 nmdc:mga08y16_245332_c1 3300050511 Unclassified 1851
400 nmdc:mga08y16_441744_c1 3300050511 Unclassified 1328
401 nmdc:mga0n895_172753_c1 3300050512 Bacteria 2193
402 nmdc:mga0n895_176423_c1 3300050512 Unclassified 2168
403 nmdc:mga0n895_83674_c1 3300050512 Unclassified 3183
404 nmdc:mga0rr50_57461_c1 3300050513 Bacteria 2911
405 nmdc:mga08x19_1875_c1 3300050514 Bacteria 12876
406 Ga0530510_0042287 3300061734 Bacteria 3292
407 Ga0395905_0047820
408 CNAas_1000270
409 JGI25406J46586_10071973
410 rootL2_10156465
411 Ga0065704_10001508
412 Ga0065704_10092649
413 Ga0065712_10000113
414 Ga0065712_10076787
415 Ga0065715_10025933
416 Ga0065715_10089989
417 Ga0065715_10109096
418 Ga0065715_10112186
419 Ga0065715_10143354
420 Ga0065707_10128746
421 Ga0070670_100001515
422 Ga0070670_100101216
423 Ga0070677_10057468
424 Ga0068869_100044164
425 Ga0068869_100482841
426 Ga0070680_100009102
427 Ga0070680_100019946
428 Ga0070680_100023301
429 Ga0070680_100044379
430 Ga0070680_100421283
431 Ga0070682_100000076
432 Ga0070682_100009886
433 Ga0070660_100019397
434 Ga0070689_100000349
435 Ga0070689_100260958
436 Ga0070689_100271278
437 Ga0070687_100043049
438 Ga0070692_10203606
439 Ga0070669_100005541
440 Ga0070669_100009659
441 Ga0070673_100095225
442 Ga0070659_100002627
443 Ga0070701_10081868
444 Ga0070700_100000146
445 Ga0070700_100112003
446 Ga0070694_100031421
447 Ga0070694_100038123
448 Ga0070694_100052392
449 Ga0070694_100338504
450 Ga0070708_100000257
451 Ga0070662_100242866
452 Ga0070681_10000273
453 Ga0070681_10009579
454 Ga0070681_10023581
455 Ga0068867_100030050
456 Ga0068867_100139928
457 Ga0068867_100381146
458 Ga0070706_100129938
459 Ga0070706_100193945
460 Ga0070707_100182177
461 Ga0070707_100305617
462 Ga0070698_100135713
463 Ga0070698_100215438
464 Ga0070699_100000196
465 Ga0070699_100006584
466 Ga0070699_100119641
467 Ga0070699_100366012
468 Ga0070679_100001215
469 Ga0070679_100230085
470 Ga0070679_100406103
471 Ga0070697_100001275
472 Ga0070697_100059747
473 Ga0070697_100163007
474 Ga0068853_100139374
475 Ga0070686_100095545
476 Ga0070695_100079066
477 Ga0070696_100023739
478 Ga0070696_100086996
479 Ga0070696_100120845
480 Ga0070696_100166918
481 Ga0070693_100130133
482 Ga0070693_100148352
483 Ga0070704_100010948
484 Ga0070704_100034880
485 Ga0070704_100045651
486 Ga0070704_100204100
487 Ga0068855_100189909
488 Ga0068857_100119099
489 Ga0068854_100029121
490 Ga0070702_100046566
491 Ga0068859_100002136
492 Ga0068859_100027795
493 Ga0068859_100061584
494 Ga0068859_100066256
495 Ga0068859_100152367
496 Ga0068859_100218157
497 Ga0068859_100318697
498 Ga0068859_100373981
499 Ga0068864_100006993
500 Ga0068864_100015693
501 Ga0068864_100235760
502 Ga0068864_100288216
503 Ga0068864_100292109
504 Ga0068864_100683442
505 Ga0068861_100015390
506 Ga0068861_100081170
507 Ga0068861_100332819
508 Ga0068851_10000641
509 Ga0068870_10016897
510 Ga0068863_100061668
511 Ga0068863_100087329
512 Ga0068863_100186684
513 Ga0068863_100374460
514 Ga0068863_100538803
515 Ga0068858_100036842
516 Ga0068858_100075892
517 Ga0068860_100028259
518 Ga0068860_100037025
519 Ga0068860_100074096
520 Ga0068860_100618379
521 Ga0068862_100071844
522 Ga0068862_100495196
523 Ga0081539_10000514
524 Ga0081539_10001769
525 Ga0070716_100018937
526 Ga0097621_100210990
527 Ga0068871_100006877
528 Ga0068871_100201380
529 Ga0075428_100365636
530 Ga0075430_100119853
531 Ga0075431_100092378
532 Ga0075431_100186887
533 Ga0075433_10189725
534 Ga0075433_10271684
535 Ga0075434_100044123
536 Ga0075434_100120990
537 Ga0097620_100002136
538 Ga0097620_100027795
539 Ga0097620_100052956
540 Ga0097620_100061582
541 Ga0097620_100066258
542 Ga0097620_100152379
543 Ga0097620_100218154
544 Ga0097620_100318714
545 Ga0097620_100373976
546 Ga0075435_100316993
547 Ga0105240_10119098
548 Ga0105240_10379151
549 Ga0111539_10042544
550 Ga0111539_10054124
551 Ga0111539_10159849
552 Ga0105247_10021708
553 Ga0105247_10076549
554 Ga0105247_10122227
555 Ga0105247_10166436
556 Ga0114129_10014022
557 Ga0114129_10036154
558 Ga0114129_10215535
559 Ga0114129_10228835
560 Ga0114129_10919364
561 Ga0114129_11128124
562 Ga0105243_10023260
563 Ga0105243_10082804
564 Ga0105243_10124666
565 Ga0105241_10124210
566 Ga0105248_10011119
567 Ga0105248_10026801
568 Ga0105248_10060504
569 Ga0105248_10165695
570 Ga0105248_10194134
571 Ga0105248_10332263
572 Ga0105237_10001605
573 Ga0105237_10082971
574 Ga0105237_10269121
575 Ga0105238_10021717
576 Ga0105238_10074314
577 Ga0105249_10000480
578 Ga0105249_10036304
579 Ga0105249_10317685
580 Ga0105249_10339152
581 Ga0157373_10006408
582 Ga0157373_10040297
583 Ga0157373_10128730
584 Ga0157373_10196934
585 Ga0157378_10200866
586 Ga0157378_10280742
587 Ga0157378_10368773
588 Ga0163162_10000477
589 Ga0163162_10002737
590 Ga0163162_10037891
591 Ga0163162_10151534
592 Ga0157372_10061529
593 Ga0157372_10349064
594 Ga0157375_10127415
595 Ga0157375_10174470
596 Ga0157375_10280508
597 Ga0157375_10548547
598 Ga0157375_10849150
599 Ga0163163_10024015
600 Ga0163163_10122035
601 Ga0163163_10340216
602 Ga0157380_10005850
603 Ga0157380_10015481
604 Ga0157380_10059518
605 Ga0157380_10120844
606 Ga0157379_10070594
607 Ga0157376_10517208
608 Ga0207656_10003068
609 Ga0207653_10094323
610 Ga0207642_10190177
611 Ga0207710_10041318
612 Ga0207647_10000801
613 Ga0207647_10060879
614 Ga0207643_10002665
615 Ga0207684_10050933
616 Ga0207654_10100349
617 Ga0207654_10146331
618 Ga0207654_10276409
619 Ga0207707_10000008
620 Ga0207707_10018656
621 Ga0207707_10076526
622 Ga0207695_10037569
623 Ga0207671_10003525
624 Ga0207660_10001514
625 Ga0207660_10013566
626 Ga0207660_10107332
627 Ga0207662_10132878
628 Ga0207662_10273245
629 Ga0207662_10300044
630 Ga0207657_10113905
631 Ga0207652_10000065
632 Ga0207652_10081429
633 Ga0207681_10000879
634 Ga0207694_10006463
635 Ga0207650_10001705
636 Ga0207650_10158341
637 Ga0207690_10051304
638 Ga0207706_10040510
639 Ga0207709_10046242
640 Ga0207709_10046655
641 Ga0207709_10120237
642 Ga0207670_10004484
643 Ga0207670_10211331
644 Ga0207665_10265661
645 Ga0207711_10070242
646 Ga0207711_10072409
647 Ga0207711_10082838
648 Ga0207689_10003266
649 Ga0207689_10008239
650 Ga0207689_10150252
651 Ga0207679_10395563
652 Ga0207712_10073006
653 Ga0207712_10145283
654 Ga0207712_10286006
655 Ga0207712_10411704
656 Ga0207640_10084074
657 Ga0207640_10195742
658 Ga0207677_10460341
659 Ga0207703_10109696
660 Ga0207703_10150931
661 Ga0207639_10051150
662 Ga0207639_10069519
663 Ga0207639_10104823
664 Ga0207708_10000278
665 Ga0207708_10002815
666 Ga0207708_10082711
667 Ga0207708_10507486
668 Ga0207641_10030006
669 Ga0207641_10033932
670 Ga0207641_10119011
671 Ga0207641_10136844
672 Ga0207648_10012038
673 Ga0207648_10090205
674 Ga0207648_10196034
675 Ga0207648_10292721
676 Ga0207676_10024490
677 Ga0207676_10138661
678 Ga0207676_10321043
679 Ga0207676_10592832
680 Ga0207674_10000079
681 Ga0207674_10105620
682 Ga0207674_10135520
683 Ga0207674_10177167
684 Ga0207674_10364429
685 Ga0207675_100021087
686 Ga0207675_100026267
687 Ga0207675_100153085
688 Ga0207675_100196568
689 Ga0207428_10006541
690 Ga0207428_10028946
691 Ga0268265_10054214
692 Ga0268265_10063733
693 Ga0268265_10339701
694 Ga0268265_10363281
695 Ga0268264_10043092
696 Ga0268264_10056173
697 Ga0268264_10073729
698 Ga0268264_10231823
699 Ga0314311_1245859
700 Ga0307513_10019683
701 Ga0307408_100008536
702 Ga0307408_100517590
703 Ga0307405_10005314
704 Ga0307413_10196603
705 Ga0307410_10013332
706 Ga0307406_10019733
707 Ga0307407_10293606
708 Ga0307412_10041141
709 Ga0307412_10062576
710 Ga0307416_100022011
711 Ga0307414_10011521
712 Ga0307411_10078270
713 Ga0307411_10408493
714 Ga0307415_100022075
715 Ga0307415_100131816
716 Ga0373951_0000998
717 Ga0395898_0108172
718 Ga0395898_0127412
719 Ga0395905_0752846
720 Ga0395901_0267489
721 Ga0242422_00658
722 Ga0439455_0008006
723 Ga0451576_0310692
724 Ga0495663_0001026
725 Ga0495598_0000315
726 Ga0495621_0004390
727 Ga0496106_0071558
728 Ga0496106_0139213
729 Ga0496108_0020452
730 Ga0496112_0327035
731 Ga0496112_0584738
732 Ga0496113_0520301
733 Ga0501291_002547
734 Ga0501291_005229
735 Ga0501296_003312
736 Ga0501297_000857
737 Ga0501298_001083
738 Ga0501298_005987
739 Ga0501298_007646
740 Ga0501300_007364
741 Ga0501303_006330
742 Ga0501038_0010820
743 Ga0501048_0125831
744 Ga0501198_001885
745 Ga0501198_005450
746 Ga0501199_005956
747 Ga0501202_000580
748 Ga0501202_008330
749 Ga0501202_020155
750 Ga0501206_005447
751 Ga0501207_000815
752 Ga0501209_040662
753 Ga0501216_000491
754 Ga0501216_007085
755 Ga0501216_009943
756 Ga0501217_001018
757 Ga0501217_002601
758 Ga0501217_013630
759 Ga0501223_001811
760 Ga0501223_004736
761 Ga0501223_007358
762 Ga0501224_000348
763 Ga0501224_007014
764 Ga0501227_001393
765 Ga0501227_021443
766 Ga0501230_000408
767 Ga0501230_000634
768 Ga0501230_016724
769 Ga0501233_005174
770 Ga0501233_008122
771 Ga0501233_009261
772 Ga0501235_000877
773 Ga0501235_006655
774 Ga0501240_000190
775 Ga0501243_004316
776 Ga0501243_006105
777 Ga0501243_012201
778 Ga0501246_001893
779 Ga0501249_006008
780 Ga0501249_029137
781 Ga0501250_004779
782 Ga0501251_001284
783 Ga0501257_012107
784 Ga0501261_001759
785 Ga0501261_011328
786 Ga0501221_001028
787 Ga0501225_0001087
788 Ga0501229_011551
789 Ga0501234_000731
790 Ga0501234_006287
791 Ga0501234_013743
792 Ga0501234_020591
793 Ga0501079_0175155
794 Ga0501271_004740
795 Ga0501273_005282
796 Ga0501273_015282
797 Ga0501279_006859
798 Ga0501280_008844
799 Ga0501283_001790
800 Ga0501226_000806
801 nmdc:mga05p37_31617_c1
802 nmdc:mga05p37_389915_c1
803 nmdc:mga09592_67398_c1
804 nmdc:mga0qj67_78718_c1
805 nmdc:mga08y16_245332_c1
806 nmdc:mga08y16_441744_c1
807 nmdc:mga0n895_172753_c1
808 nmdc:mga0n895_176423_c1
809 nmdc:mga0n895_83674_c1
810 nmdc:mga0rr50_57461_c1
811 nmdc:mga08x19_1875_c1
812 Ga0530510_0042287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

18

134

0.83

PF00892

EamA

EamA-like transporter family

142

276

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.818 11 273
7b0k-assembly1.cif.gz_A membrane protein structure 0.8004 11 273
5i20-assembly6.cif.gz_F crystal structure of protein 0.7949 10 278
5i20-assembly1.cif.gz_A crystal structure of protein 0.7943 10 281
5i20-assembly4.cif.gz_D crystal structure of protein 0.7897 10 278
ID Description Score Start End Superfamily
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7315 10 271 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7066 11 274 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6796 10 285 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6793 10 271 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6625 11 274 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2V9P4H8-F1-model_v4 EamA family transporter 0.9941 14 284 GO:0005886
AF-A0A7V8ZAG4-F1-model_v4 EamA family transporter 0.987 2 285 GO:0016020
AF-A0A7V8ZAG4-F1-model_v4 EamA family transporter 0.9802 2 285 GO:0016020
AF-A0A2V8STN4-F1-model_v4 EamA domain-containing protein 0.9672 1 281 GO:0016020
AF-A0A2V9P4H8-F1-model_v4 EamA family transporter 0.9657 14 284 GO:0005886

Map