F436044

General Info

Members Datasets Scaffolds Average Seq Length
405 206 810 305

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0046440|Ga0495676_0046440_2327_3394
Length 355
Sequence MTQALSGASSRQEGRDMTATSTVKPGESPYVDRRKEYLAQSPPPGKKPRPNLVWIPGGDFLMGSDVHYPEEAPARPVRVSGFWMAQTVVTNAQFARFVSATGYVTVAERPPDPALYPGALPDMLVPGGLVFTKPAGRVDMRHIANWWAYVEGADWRHPRGPDSTIKGLERHPVVQVALEDAEAYAAWAGAELPTEAEWEFAARGGLDGAEYVWGAQFMPRGKPLANTWHGEFPWQNLRAGGFEGTAPVTAFPPNGYGLYEMAGNVWEWTADWYRERNGAQHKACCVPSNPRGGAADQSYDPQMPEIRIARRVIKGGSHLCAPNYCRRYRPAARYPHPVDTGTCHVGFRCIVRPSQ

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
101 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
102 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
103 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
206 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.49
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 0.25
Rhizoplane 3.21
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0046440 3300047321 Bacteria 3524
2 JGI25407J50210_10001149 3300003373 Bacteria 5851
3 JGI25407J50210_10004861 3300003373 Bacteria 3279
4 Ga0070683_100072764 3300005329 Bacteria 3209
5 Ga0070680_100060779 3300005336 Bacteria 3092
6 Ga0070680_100110181 3300005336 Bacteria 2292
7 Ga0070682_100014873 3300005337 Bacteria 4504
8 Ga0070659_100089484 3300005366 Bacteria 2466
9 Ga0070709_10004700 3300005434 Bacteria 7375
10 Ga0070709_10030028 3300005434 Bacteria 3258
11 Ga0070714_100000870 3300005435 Bacteria 21408
12 Ga0070714_100302875 3300005435 Bacteria 1490
13 Ga0070713_100029969 3300005436 Bacteria 4315
14 Ga0070713_100160497 3300005436 Bacteria 2006
15 Ga0070713_100346191 3300005436 Bacteria 1378
16 Ga0070713_100351584 3300005436 Bacteria 1367
17 Ga0070710_10057640 3300005437 Bacteria 2202
18 Ga0070711_100120648 3300005439 Bacteria 1938
19 Ga0070708_100018288 3300005445 Bacteria 5865
20 Ga0070663_100433026 3300005455 Bacteria 1081
21 Ga0070681_10003828 3300005458 Bacteria 14146
22 Ga0070681_10009290 3300005458 Bacteria 9669
23 Ga0070706_100048495 3300005467 Bacteria 3919
24 Ga0070706_100232001 3300005467 Bacteria 1723
25 Ga0070707_100124799 3300005468 Bacteria 2501
26 Ga0070698_100004170 3300005471 Bacteria 15888
27 Ga0070679_100003012 3300005530 Bacteria 15391
28 Ga0070679_100008526 3300005530 Bacteria 9657
29 Ga0070684_100036468 3300005535 Bacteria 4213
30 Ga0070684_100041916 3300005535 Bacteria 3949
31 Ga0068863_100156885 3300005841 Bacteria 2179
32 Ga0081538_10000968 3300005981 Bacteria 30658
33 Ga0081538_10001307 3300005981 Bacteria 25759
34 Ga0081538_10011382 3300005981 Bacteria 7209
35 Ga0081538_10011757 3300005981 Bacteria 7064
36 Ga0070717_10075603 3300006028 Bacteria 2818
37 Ga0070715_10027466 3300006163 Bacteria 2273
38 Ga0070716_100026225 3300006173 Bacteria 3119
39 Ga0070712_100007414 3300006175 Bacteria 6846
40 Ga0075433_10039508 3300006852 Bacteria 4081
41 Ga0075434_100118620 3300006871 Bacteria 2660
42 Ga0068865_100206923 3300006881 Bacteria 1527
43 Ga0075436_100016001 3300006914 Bacteria 5135
44 Ga0075435_100028216 3300007076 Bacteria 4400
45 Ga0099795_10010878 3300007788 Bacteria 2697
46 Ga0111539_10231487 3300009094 Bacteria 2152
47 Ga0111539_10263170 3300009094 Bacteria 2008
48 Ga0114129_10034999 3300009147 Bacteria 7094
49 Ga0114129_10043816 3300009147 Bacteria 6296
50 Ga0114129_10142278 3300009147 Bacteria 3287
51 Ga0105243_10412619 3300009148 Bacteria 1257
52 Ga0105249_10095542 3300009553 Bacteria 2787
53 Ga0105239_10171801 3300010375 Bacteria 2424
54 Ga0157370_10040434 3300013104 Bacteria 4502
55 Ga0157380_10097754 3300014326 Bacteria 2437
56 Ga0163161_10016678 3300017792 Bacteria 5131
57 Ga0206353_11615217 3300020082 Bacteria 3139
58 Ga0213872_10005775 3300021361 Bacteria 6287
59 Ga0213876_10001121 3300021384 Bacteria 17067
60 Ga0213876_10008164 3300021384 Bacteria 5669
61 Ga0213875_10009812 3300021388 Bacteria 4828
62 Ga0224712_10010445 3300022467 Bacteria 2841
63 Ga0209147_101860 3300025229 Bacteria 6453
64 Ga0209675_1000248 3300025291 Bacteria 53556
65 Ga0207692_10045393 3300025898 Bacteria 2198
66 Ga0207642_10113135 3300025899 Bacteria 1386
67 Ga0207699_10013297 3300025906 Bacteria 4210
68 Ga0207699_10102034 3300025906 Bacteria 1822
69 Ga0207699_10105554 3300025906 Bacteria 1796
70 Ga0207684_10307420 3300025910 Bacteria 1367
71 Ga0207684_10332119 3300025910 Bacteria 1310
72 Ga0207707_10017114 3300025912 Bacteria 6316
73 Ga0207707_10045074 3300025912 Bacteria 3843
74 Ga0207693_10032469 3300025915 Bacteria 4121
75 Ga0207663_10057005 3300025916 Bacteria 2460
76 Ga0207657_10051228 3300025919 Bacteria 3588
77 Ga0207652_10018531 3300025921 Bacteria 5712
78 Ga0207700_10015231 3300025928 Bacteria 5062
79 Ga0207700_10073289 3300025928 Bacteria 2644
80 Ga0207700_10203297 3300025928 Bacteria 1670
81 Ga0207700_10300188 3300025928 Bacteria 1387
82 Ga0207664_10002698 3300025929 Bacteria 11774
83 Ga0207664_10026861 3300025929 Bacteria 4356
84 Ga0207664_10062012 3300025929 Bacteria 2985
85 Ga0207664_10285941 3300025929 Bacteria 1448
86 Ga0207669_10226919 3300025937 Bacteria 1375
87 Ga0207665_10008959 3300025939 Bacteria 6569
88 Ga0207665_10022183 3300025939 Bacteria 4174
89 Ga0207661_10292907 3300025944 Bacteria 1457
90 Ga0207667_10183858 3300025949 Bacteria 2146
91 Ga0207678_10371920 3300026067 Bacteria 1235
92 Ga0207702_10503798 3300026078 Bacteria 1180
93 Ga0207676_10219584 3300026095 Bacteria 1692
94 Ga0207698_10071328 3300026142 Bacteria 2756
95 Ga0207428_10005573 3300027907 Bacteria 11712
96 Ga0265337_1000366 3300028556 Bacteria 24243
97 Ga0265326_10023009 3300028558 Bacteria 1782
98 Ga0265319_1001035 3300028563 Bacteria 17400
99 Ga0265334_10000343 3300028573 Bacteria 24908
100 Ga0265318_10009147 3300028577 Bacteria 4373
101 Ga0265336_10005895 3300028666 Bacteria 4470
102 Ga0265338_10000936 3300028800 Bacteria 49246
103 Ga0265338_10012500 3300028800 Bacteria 9675
104 Ga0265338_10016096 3300028800 Bacteria 8159
105 Ga0265324_10001443 3300029957 Bacteria 13610
106 Ga0265332_10001782 3300031238 Bacteria 11615
107 Ga0265340_10000913 3300031247 Bacteria 16764
108 Ga0265316_10018132 3300031344 Bacteria 6059
109 Ga0265313_10019186 3300031595 Bacteria 3816
110 Ga0265314_10012037 3300031711 Bacteria 7092
111 Ga0307405_10075017 3300031731 Bacteria 2189
112 Ga0307407_10038509 3300031903 Bacteria 2650
113 Ga0307412_10010876 3300031911 Bacteria 5253
114 Ga0307409_100007094 3300031995 Bacteria 6669
115 Ga0307409_100188162 3300031995 Bacteria 1835
116 Ga0307416_100016750 3300032002 Bacteria 5106
117 Ga0307416_100267491 3300032002 Bacteria 1676
118 Ga0307415_100005200 3300032126 Bacteria 6874
119 Ga0307415_100147796 3300032126 Bacteria 1804
120 Ga0373926_0084496 3300035083 Bacteria 1176
121 Ga0373945_0000616 3300035116 Bacteria 10234
122 Ga0373954_0193315 3300035118 Bacteria 999
123 Ga0373957_0042926 3300035120 Bacteria 1707
124 Ga0373935_0004826 3300035692 Bacteria 7926
125 Ga0373935_0067178 3300035692 Bacteria 2305
126 Ga0373933_0063276 3300035724 Bacteria 2236
127 Ga0373947_0003318 3300035725 Bacteria 9536
128 Ga0373947_0260658 3300035725 Bacteria 1149
129 Ga0373925_0000261 3300037068 Bacteria 54902
130 Ga0373925_0058603 3300037068 Bacteria 2887
131 Ga0395900_0426913 3300037418 Bacteria 1285
132 Ga0395898_0065182 3300037466 Bacteria 3532
133 Ga0436364_0884969 3300037853 Bacteria 2121
134 Ga0395901_0004408 3300038443 Bacteria 14188
135 Ga0436360_0595208 3300039438 Bacteria 1096
136 Ga0436360_1163004 3300039438 Bacteria 1855
137 Ga0436361_0114410 3300039447 Bacteria 7896
138 Ga0436361_0578985 3300039447 Bacteria 3618
139 Ga0436361_0889267 3300039447 Bacteria 1565
140 Ga0436361_1113632 3300039447 Bacteria 2925
141 Ga0439450_052989 3300042008 Bacteria 968
142 Ga0439451_024388 3300042009 Bacteria 1218
143 Ga0439463_058457 3300042016 Bacteria 986
144 Ga0439458_0022518 3300042157 Bacteria 1464
145 Ga0450908_000895 3300042184 Bacteria 5741
146 Ga0495627_002903 3300046453 Bacteria 7889
147 Ga0495603_0014100 3300046455 Bacteria 4835
148 Ga0495590_0001477 3300046457 Bacteria 10129
149 Ga0495629_0003490 3300046459 Bacteria 11894
150 Ga0495641_0002896 3300046461 Bacteria 13230
151 Ga0495653_0007017 3300046463 Bacteria 9246
152 Ga0495580_0017477 3300046472 Bacteria 5364
153 Ga0495582_0007930 3300046473 Bacteria 5866
154 Ga0495582_0011459 3300046473 Bacteria 4883
155 Ga0495662_0019326 3300046476 Bacteria 3294
156 Ga0495584_0009759 3300046491 Bacteria 4938
157 Ga0495584_0038618 3300046491 Bacteria 2413
158 Ga0495585_0000663 3300046492 Bacteria 31622
159 Ga0495610_0033927 3300046512 Bacteria 2633
160 Ga0495630_0003413 3300046517 Bacteria 11055
161 Ga0495630_0038911 3300046517 Bacteria 3557
162 Ga0495648_0013316 3300046524 Bacteria 6087
163 Ga0495648_0018631 3300046524 Bacteria 4906
164 Ga0495666_0004492 3300046526 Bacteria 7046
165 Ga0495652_0365792 3300046529 Bacteria 1029
166 Ga0495665_0006038 3300046531 Bacteria 6529
167 Ga0495665_0185677 3300046531 Bacteria 1080
168 Ga0495665_0191018 3300046531 Bacteria 1063
169 Ga0495586_0002056 3300046535 Bacteria 10927
170 Ga0495586_0049288 3300046535 Bacteria 2277
171 Ga0495586_0050078 3300046535 Bacteria 2259
172 Ga0495587_0027729 3300046536 Bacteria 3448
173 Ga0495587_0053518 3300046536 Bacteria 2380
174 Ga0495609_0173303 3300046538 Bacteria 910
175 Ga0495622_0048159 3300046557 Bacteria 1981
176 Ga0495667_0185929 3300046559 Bacteria 1332
177 Ga0495656_0007971 3300046615 Bacteria 3767
178 Ga0495656_0168681 3300046615 Bacteria 1069
179 Ga0495634_0001573 3300046642 Bacteria 20077
180 Ga0495634_0021406 3300046642 Bacteria 4571
181 Ga0495611_0194804 3300046648 Bacteria 946
182 Ga0495588_0000414 3300046674 Bacteria 23131
183 Ga0495588_0023219 3300046674 Bacteria 3070
184 Ga0495657_0094359 3300046675 Bacteria 1914
185 Ga0495599_0049214 3300046678 Bacteria 2642
186 Ga0495613_0025371 3300046689 Bacteria 4416
187 Ga0495624_0137439 3300046690 Bacteria 1498
188 Ga0495670_0031642 3300046691 Bacteria 2630
189 Ga0495581_0157378 3300047315 Bacteria 1328
190 Ga0495604_0058036 3300047317 Bacteria 2973
191 Ga0495604_0064813 3300047317 Bacteria 2783
192 Ga0495674_0056671 3300047319 Bacteria 3431
193 Ga0495674_0087988 3300047319 Bacteria 2657
194 Ga0495672_0030033 3300047320 Bacteria 3415
195 Ga0495676_0216628 3300047321 Bacteria 1321
196 Ga0495676_0216632 3300047321 Bacteria 1321
197 Ga0495683_0151368 3300047323 Unclassified 1080
198 Ga0495675_0020154 3300047444 Bacteria 4238
199 Ga0495675_0176034 3300047444 Bacteria 1312
200 Ga0495681_0000891 3300047470 Bacteria 23066
201 Ga0495684_0093351 3300047471 Bacteria 2279
202 Ga0495686_0011796 3300047472 Bacteria 6148
203 Ga0495593_0230932 3300047673 Bacteria 928
204 Ga0496101_0043260 3300048904 Bacteria 3219
205 Ga0496102_0029376 3300048905 Bacteria 4920
206 Ga0496105_0000477 3300048908 Bacteria 26263
207 Ga0496105_0464829 3300048908 Bacteria 997
208 Ga0496109_0008638 3300048912 Bacteria 8669
209 Ga0496109_0104268 3300048912 Bacteria 2633
210 Ga0496110_0003137 3300048913 Bacteria 12557
211 Ga0496111_0000329 3300048914 Bacteria 23559
212 Ga0496112_0060617 3300048915 Bacteria 3729
213 Ga0496112_0330270 3300048915 Bacteria 1469
214 Ga0496113_0001449 3300048916 Bacteria 13197
215 Ga0496114_0021549 3300048917 Bacteria 5243
216 Ga0496115_0002106 3300048918 Bacteria 14243
217 Ga0496124_0000800 3300048927 Bacteria 51160
218 Ga0501031_0001793 3300049568 Bacteria 13469
219 Ga0501031_0008266 3300049568 Bacteria 6768
220 Ga0501032_0002648 3300049569 Bacteria 13966
221 Ga0501032_0020053 3300049569 Bacteria 4662
222 Ga0501033_0014343 3300049570 Bacteria 6021
223 Ga0501033_0025738 3300049570 Bacteria 4432
224 Ga0501034_0009517 3300049571 Bacteria 10171
225 Ga0501034_0058777 3300049571 Bacteria 3863
226 Ga0501034_0116171 3300049571 Bacteria 2664
227 Ga0501036_0011710 3300049572 Bacteria 7268
228 Ga0501036_0017794 3300049572 Bacteria 5950
229 Ga0501036_0024408 3300049572 Bacteria 5096
230 Ga0501036_0135261 3300049572 Bacteria 2080
231 Ga0501037_0012994 3300049573 Bacteria 6137
232 Ga0501037_0047820 3300049573 Bacteria 3135
233 Ga0501037_0178478 3300049573 Bacteria 1507
234 Ga0501037_0203272 3300049573 Bacteria 1399
235 Ga0501038_0030080 3300049574 Bacteria 4808
236 Ga0501038_0046923 3300049574 Bacteria 3744
237 Ga0501038_0162967 3300049574 Bacteria 1810
238 Ga0501038_0193279 3300049574 Bacteria 1636
239 Ga0501038_0324596 3300049574 Bacteria 1203
240 Ga0501039_0002483 3300049575 Bacteria 13727
241 Ga0501039_0010983 3300049575 Bacteria 6902
242 Ga0501039_0019771 3300049575 Bacteria 5162
243 Ga0501039_0061510 3300049575 Bacteria 2908
244 Ga0501039_0064135 3300049575 Bacteria 2847
245 Ga0501040_0002236 3300049576 Bacteria 12469
246 Ga0501040_0005491 3300049576 Bacteria 8205
247 Ga0501040_0011378 3300049576 Bacteria 5826
248 Ga0501040_0014746 3300049576 Bacteria 5156
249 Ga0501040_0023712 3300049576 Bacteria 4115
250 Ga0501040_0065447 3300049576 Bacteria 2503
251 Ga0501040_0084198 3300049576 Bacteria 2206
252 Ga0501040_0354576 3300049576 Bacteria 1051
253 Ga0501041_0001742 3300049577 Bacteria 12214
254 Ga0501041_0004965 3300049577 Bacteria 7739
255 Ga0501041_0005767 3300049577 Bacteria 7235
256 Ga0501041_0012754 3300049577 Bacteria 4980
257 Ga0501041_0068306 3300049577 Bacteria 2178
258 Ga0501041_0147785 3300049577 Bacteria 1467
259 Ga0501042_0000951 3300049578 Bacteria 16334
260 Ga0501042_0014401 3300049578 Bacteria 5398
261 Ga0501042_0040541 3300049578 Bacteria 3310
262 Ga0501042_0106466 3300049578 Bacteria 2018
263 Ga0501042_0179458 3300049578 Bacteria 1527
264 Ga0501042_0302875 3300049578 Bacteria 1155
265 Ga0501043_0000750 3300049579 Bacteria 28826
266 Ga0501043_0012050 3300049579 Bacteria 6760
267 Ga0501043_0113064 3300049579 Bacteria 2132
268 Ga0501043_0120089 3300049579 Bacteria 2061
269 Ga0501043_0138560 3300049579 Bacteria 1905
270 Ga0501043_0151435 3300049579 Bacteria 1815
271 Ga0501046_0000475 3300049580 Bacteria 40215
272 Ga0501046_0003275 3300049580 Bacteria 14866
273 Ga0501046_0010607 3300049580 Bacteria 7907
274 Ga0501046_0014993 3300049580 Bacteria 6519
275 Ga0501046_0200123 3300049580 Bacteria 1486
276 Ga0501046_0207789 3300049580 Bacteria 1454
277 Ga0501047_0015380 3300049581 Bacteria 7288
278 Ga0501047_0326783 3300049581 Bacteria 1372
279 Ga0501048_0002002 3300049582 Bacteria 15478
280 Ga0501048_0003329 3300049582 Bacteria 12230
281 Ga0501048_0005330 3300049582 Bacteria 9786
282 Ga0501048_0009255 3300049582 Bacteria 7401
283 Ga0501048_0018541 3300049582 Bacteria 5116
284 Ga0501068_0014848 3300049584 Bacteria 4460
285 Ga0501068_0088639 3300049584 Bacteria 1906
286 Ga0501069_0001284 3300049585 Bacteria 12301
287 Ga0501069_0002966 3300049585 Bacteria 8728
288 Ga0501069_0203740 3300049585 Bacteria 1147
289 Ga0501070_0002558 3300049586 Bacteria 15924
290 Ga0501070_0055979 3300049586 Bacteria 3269
291 Ga0501070_0198251 3300049586 Bacteria 1649
292 Ga0501071_0003209 3300049587 Bacteria 10181
293 Ga0501071_0017495 3300049587 Bacteria 4945
294 Ga0501071_0035321 3300049587 Bacteria 3560
295 Ga0501071_0084336 3300049587 Bacteria 2328
296 Ga0501072_0000365 3300049588 Bacteria 32224
297 Ga0501072_0000860 3300049588 Bacteria 22296
298 Ga0501072_0001343 3300049588 Bacteria 18416
299 Ga0501072_0070623 3300049588 Bacteria 2758
300 Ga0501072_0099014 3300049588 Bacteria 2317
301 Ga0501072_0300695 3300049588 Bacteria 1275
302 Ga0501073_0012015 3300049589 Bacteria 6323
303 Ga0501073_0066392 3300049589 Bacteria 2515
304 Ga0501074_0006543 3300049590 Bacteria 8417
305 Ga0501074_0025499 3300049590 Bacteria 4293
306 Ga0501074_0028238 3300049590 Bacteria 4065
307 Ga0501074_0031894 3300049590 Bacteria 3819
308 Ga0501074_0089048 3300049590 Bacteria 2210
309 Ga0501074_0301645 3300049590 Bacteria 1138
310 Ga0501075_0006861 3300049591 Bacteria 7862
311 Ga0501075_0008589 3300049591 Bacteria 7121
312 Ga0501075_0017592 3300049591 Bacteria 5162
313 Ga0501075_0052109 3300049591 Bacteria 3077
314 Ga0501075_0111669 3300049591 Bacteria 2078
315 Ga0501075_0113062 3300049591 Bacteria 2064
316 Ga0501075_0360837 3300049591 Bacteria 1107
317 Ga0501076_0000349 3300049592 Bacteria 28511
318 Ga0501076_0000471 3300049592 Bacteria 25443
319 Ga0501076_0002969 3300049592 Bacteria 11767
320 Ga0501076_0004344 3300049592 Bacteria 10060
321 Ga0501076_0033676 3300049592 Bacteria 4000
322 Ga0501076_0057600 3300049592 Bacteria 3086
323 Ga0501076_0140007 3300049592 Bacteria 1965
324 Ga0501077_0001801 3300049593 Bacteria 12964
325 Ga0501077_0002935 3300049593 Bacteria 10234
326 Ga0501077_0011109 3300049593 Bacteria 5617
327 Ga0501077_0013007 3300049593 Bacteria 5213
328 Ga0501077_0018663 3300049593 Bacteria 4386
329 Ga0501077_0138093 3300049593 Bacteria 1545
330 Ga0501077_0202244 3300049593 Bacteria 1262
331 Ga0501079_0004557 3300049741 Bacteria 10274
332 Ga0501079_0007609 3300049741 Bacteria 8205
333 Ga0501079_0045568 3300049741 Bacteria 3384
334 Ga0501079_0072670 3300049741 Bacteria 2658
335 Ga0501079_0174665 3300049741 Bacteria 1675
336 Ga0501079_0502970 3300049741 Bacteria 953
337 Ga0501080_0004713 3300049742 Bacteria 12173
338 Ga0501080_0017368 3300049742 Bacteria 6652
339 Ga0501080_0056400 3300049742 Bacteria 3658
340 Ga0501080_0187127 3300049742 Bacteria 1903
341 Ga0501081_0002582 3300049743 Bacteria 11444
342 Ga0501081_0003376 3300049743 Bacteria 10161
343 Ga0501081_0007130 3300049743 Bacteria 7265
344 Ga0501081_0013856 3300049743 Bacteria 5305
345 Ga0501081_0071042 3300049743 Bacteria 2426
346 Ga0501081_0126498 3300049743 Bacteria 1823
347 Ga0501081_0146869 3300049743 Bacteria 1692
348 Ga0501083_0002556 3300049744 Bacteria 12502
349 Ga0501083_0007199 3300049744 Bacteria 7900
350 Ga0501083_0020935 3300049744 Bacteria 4545
351 Ga0501083_0031701 3300049744 Bacteria 3628
352 Ga0501083_0234867 3300049744 Bacteria 1194
353 Ga0501035_0000561 3300049822 Bacteria 41148
354 Ga0501035_0021386 3300049822 Bacteria 5948
355 Ga0501035_0121706 3300049822 Bacteria 2280
356 Ga0501035_0386702 3300049822 Bacteria 1166
357 Ga0501044_0010890 3300049823 Bacteria 9869
358 Ga0501044_0015047 3300049823 Bacteria 8337
359 Ga0501044_0021532 3300049823 Bacteria 6876
360 Ga0501044_0292596 3300049823 Bacteria 1560
361 Ga0501044_0435474 3300049823 Bacteria 1220
362 Ga0501045_0003869 3300049824 Bacteria 10300
363 Ga0501045_0005248 3300049824 Bacteria 8962
364 Ga0501045_0007727 3300049824 Bacteria 7480
365 Ga0501045_0063086 3300049824 Bacteria 2719
366 Ga0501045_0072430 3300049824 Bacteria 2537
367 Ga0501045_0337495 3300049824 Bacteria 1121
368 Ga0501045_0388291 3300049824 Bacteria 1039
369 nmdc:mga05p37_119858_c1 3300050507 Bacteria 3232
370 nmdc:mga05p37_9747_c1 3300050507 Bacteria 11391
371 nmdc:mga08y16_86620_c1 3300050511 Bacteria 3265
372 nmdc:mga0n895_119199_c1 3300050512 Bacteria 2660
373 nmdc:mga0n895_39756_c1 3300050512 Bacteria 4567
374 nmdc:mga0a205_1365_c1 3300050515 Bacteria 20601
375 nmdc:mga0a205_5117_c1 3300050515 Bacteria 11790
376 Ga0500643_014253 3300053087 Bacteria 2771
377 Ga0500643_024714 3300053087 Bacteria 1903
378 Ga0500647_0030077 3300053091 Bacteria 2578
379 Ga0500641_0007725 3300053096 Bacteria 3833
380 Ga0500562_000385 3300053108 Bacteria 10732
381 Ga0500608_036250 3300053122 Bacteria 2353
382 Ga0500636_0000619 3300053177 Bacteria 19207
383 Ga0500625_000012 3300053729 Bacteria 127269
384 Ga0501084_0000493 3300054114 Bacteria 30265
385 Ga0501084_0000557 3300054114 Bacteria 28483
386 Ga0501084_0025938 3300054114 Bacteria 4887
387 Ga0501084_0028356 3300054114 Bacteria 4679
388 Ga0501084_0040499 3300054114 Bacteria 3898
389 Ga0501084_0208093 3300054114 Bacteria 1650
390 Ga0501084_0232146 3300054114 Bacteria 1557
391 Ga0590071_010193 3300059421 Bacteria 2201
392 Ga0590074_003736 3300059423 Bacteria 2520
393 Ga0501082_0001026 3300060353 Bacteria 24703
394 Ga0501082_0016883 3300060353 Bacteria 6286
395 Ga0501082_0017653 3300060353 Bacteria 6146
396 Ga0501082_0021936 3300060353 Bacteria 5505
397 Ga0501082_0057090 3300060353 Bacteria 3363
398 Ga0501082_0345573 3300060353 Bacteria 1296
399 Ga0530510_0008261 3300061734 Bacteria 7258
400 Ga0530510_0010467 3300061734 Bacteria 6504
401 Ga0530510_0058194 3300061734 Bacteria 2794
402 Ga0530510_0064002 3300061734 Bacteria 2663
403 Ga0530510_0082795 3300061734 Bacteria 2336
404 8024489148 8024486573 Bacteria 6540512
405 8057104230 8057101203 Bacteria 5034064
406 Ga0495676_0046440
407 JGI25407J50210_10001149
408 JGI25407J50210_10004861
409 Ga0070683_100072764
410 Ga0070680_100060779
411 Ga0070680_100110181
412 Ga0070682_100014873
413 Ga0070659_100089484
414 Ga0070709_10004700
415 Ga0070709_10030028
416 Ga0070714_100000870
417 Ga0070714_100302875
418 Ga0070713_100029969
419 Ga0070713_100160497
420 Ga0070713_100346191
421 Ga0070713_100351584
422 Ga0070710_10057640
423 Ga0070711_100120648
424 Ga0070708_100018288
425 Ga0070663_100433026
426 Ga0070681_10003828
427 Ga0070681_10009290
428 Ga0070706_100048495
429 Ga0070706_100232001
430 Ga0070707_100124799
431 Ga0070698_100004170
432 Ga0070679_100003012
433 Ga0070679_100008526
434 Ga0070684_100036468
435 Ga0070684_100041916
436 Ga0068863_100156885
437 Ga0081538_10000968
438 Ga0081538_10001307
439 Ga0081538_10011382
440 Ga0081538_10011757
441 Ga0070717_10075603
442 Ga0070715_10027466
443 Ga0070716_100026225
444 Ga0070712_100007414
445 Ga0075433_10039508
446 Ga0075434_100118620
447 Ga0068865_100206923
448 Ga0075436_100016001
449 Ga0075435_100028216
450 Ga0099795_10010878
451 Ga0111539_10231487
452 Ga0111539_10263170
453 Ga0114129_10034999
454 Ga0114129_10043816
455 Ga0114129_10142278
456 Ga0105243_10412619
457 Ga0105249_10095542
458 Ga0105239_10171801
459 Ga0157370_10040434
460 Ga0157380_10097754
461 Ga0163161_10016678
462 Ga0206353_11615217
463 Ga0213872_10005775
464 Ga0213876_10001121
465 Ga0213876_10008164
466 Ga0213875_10009812
467 Ga0224712_10010445
468 Ga0209147_101860
469 Ga0209675_1000248
470 Ga0207692_10045393
471 Ga0207642_10113135
472 Ga0207699_10013297
473 Ga0207699_10102034
474 Ga0207699_10105554
475 Ga0207684_10307420
476 Ga0207684_10332119
477 Ga0207707_10017114
478 Ga0207707_10045074
479 Ga0207693_10032469
480 Ga0207663_10057005
481 Ga0207657_10051228
482 Ga0207652_10018531
483 Ga0207700_10015231
484 Ga0207700_10073289
485 Ga0207700_10203297
486 Ga0207700_10300188
487 Ga0207664_10002698
488 Ga0207664_10026861
489 Ga0207664_10062012
490 Ga0207664_10285941
491 Ga0207669_10226919
492 Ga0207665_10008959
493 Ga0207665_10022183
494 Ga0207661_10292907
495 Ga0207667_10183858
496 Ga0207678_10371920
497 Ga0207702_10503798
498 Ga0207676_10219584
499 Ga0207698_10071328
500 Ga0207428_10005573
501 Ga0265337_1000366
502 Ga0265326_10023009
503 Ga0265319_1001035
504 Ga0265334_10000343
505 Ga0265318_10009147
506 Ga0265336_10005895
507 Ga0265338_10000936
508 Ga0265338_10012500
509 Ga0265338_10016096
510 Ga0265324_10001443
511 Ga0265332_10001782
512 Ga0265340_10000913
513 Ga0265316_10018132
514 Ga0265313_10019186
515 Ga0265314_10012037
516 Ga0307405_10075017
517 Ga0307407_10038509
518 Ga0307412_10010876
519 Ga0307409_100007094
520 Ga0307409_100188162
521 Ga0307416_100016750
522 Ga0307416_100267491
523 Ga0307415_100005200
524 Ga0307415_100147796
525 Ga0373926_0084496
526 Ga0373945_0000616
527 Ga0373954_0193315
528 Ga0373957_0042926
529 Ga0373935_0004826
530 Ga0373935_0067178
531 Ga0373933_0063276
532 Ga0373947_0003318
533 Ga0373947_0260658
534 Ga0373925_0000261
535 Ga0373925_0058603
536 Ga0395900_0426913
537 Ga0395898_0065182
538 Ga0436364_0884969
539 Ga0395901_0004408
540 Ga0436360_0595208
541 Ga0436360_1163004
542 Ga0436361_0114410
543 Ga0436361_0578985
544 Ga0436361_0889267
545 Ga0436361_1113632
546 Ga0439450_052989
547 Ga0439451_024388
548 Ga0439463_058457
549 Ga0439458_0022518
550 Ga0450908_000895
551 Ga0495627_002903
552 Ga0495603_0014100
553 Ga0495590_0001477
554 Ga0495629_0003490
555 Ga0495641_0002896
556 Ga0495653_0007017
557 Ga0495580_0017477
558 Ga0495582_0007930
559 Ga0495582_0011459
560 Ga0495662_0019326
561 Ga0495584_0009759
562 Ga0495584_0038618
563 Ga0495585_0000663
564 Ga0495610_0033927
565 Ga0495630_0003413
566 Ga0495630_0038911
567 Ga0495648_0013316
568 Ga0495648_0018631
569 Ga0495666_0004492
570 Ga0495652_0365792
571 Ga0495665_0006038
572 Ga0495665_0185677
573 Ga0495665_0191018
574 Ga0495586_0002056
575 Ga0495586_0049288
576 Ga0495586_0050078
577 Ga0495587_0027729
578 Ga0495587_0053518
579 Ga0495609_0173303
580 Ga0495622_0048159
581 Ga0495667_0185929
582 Ga0495656_0007971
583 Ga0495656_0168681
584 Ga0495634_0001573
585 Ga0495634_0021406
586 Ga0495611_0194804
587 Ga0495588_0000414
588 Ga0495588_0023219
589 Ga0495657_0094359
590 Ga0495599_0049214
591 Ga0495613_0025371
592 Ga0495624_0137439
593 Ga0495670_0031642
594 Ga0495581_0157378
595 Ga0495604_0058036
596 Ga0495604_0064813
597 Ga0495674_0056671
598 Ga0495674_0087988
599 Ga0495672_0030033
600 Ga0495676_0216628
601 Ga0495676_0216632
602 Ga0495683_0151368
603 Ga0495675_0020154
604 Ga0495675_0176034
605 Ga0495681_0000891
606 Ga0495684_0093351
607 Ga0495686_0011796
608 Ga0495593_0230932
609 Ga0496101_0043260
610 Ga0496102_0029376
611 Ga0496105_0000477
612 Ga0496105_0464829
613 Ga0496109_0008638
614 Ga0496109_0104268
615 Ga0496110_0003137
616 Ga0496111_0000329
617 Ga0496112_0060617
618 Ga0496112_0330270
619 Ga0496113_0001449
620 Ga0496114_0021549
621 Ga0496115_0002106
622 Ga0496124_0000800
623 Ga0501031_0001793
624 Ga0501031_0008266
625 Ga0501032_0002648
626 Ga0501032_0020053
627 Ga0501033_0014343
628 Ga0501033_0025738
629 Ga0501034_0009517
630 Ga0501034_0058777
631 Ga0501034_0116171
632 Ga0501036_0011710
633 Ga0501036_0017794
634 Ga0501036_0024408
635 Ga0501036_0135261
636 Ga0501037_0012994
637 Ga0501037_0047820
638 Ga0501037_0178478
639 Ga0501037_0203272
640 Ga0501038_0030080
641 Ga0501038_0046923
642 Ga0501038_0162967
643 Ga0501038_0193279
644 Ga0501038_0324596
645 Ga0501039_0002483
646 Ga0501039_0010983
647 Ga0501039_0019771
648 Ga0501039_0061510
649 Ga0501039_0064135
650 Ga0501040_0002236
651 Ga0501040_0005491
652 Ga0501040_0011378
653 Ga0501040_0014746
654 Ga0501040_0023712
655 Ga0501040_0065447
656 Ga0501040_0084198
657 Ga0501040_0354576
658 Ga0501041_0001742
659 Ga0501041_0004965
660 Ga0501041_0005767
661 Ga0501041_0012754
662 Ga0501041_0068306
663 Ga0501041_0147785
664 Ga0501042_0000951
665 Ga0501042_0014401
666 Ga0501042_0040541
667 Ga0501042_0106466
668 Ga0501042_0179458
669 Ga0501042_0302875
670 Ga0501043_0000750
671 Ga0501043_0012050
672 Ga0501043_0113064
673 Ga0501043_0120089
674 Ga0501043_0138560
675 Ga0501043_0151435
676 Ga0501046_0000475
677 Ga0501046_0003275
678 Ga0501046_0010607
679 Ga0501046_0014993
680 Ga0501046_0200123
681 Ga0501046_0207789
682 Ga0501047_0015380
683 Ga0501047_0326783
684 Ga0501048_0002002
685 Ga0501048_0003329
686 Ga0501048_0005330
687 Ga0501048_0009255
688 Ga0501048_0018541
689 Ga0501068_0014848
690 Ga0501068_0088639
691 Ga0501069_0001284
692 Ga0501069_0002966
693 Ga0501069_0203740
694 Ga0501070_0002558
695 Ga0501070_0055979
696 Ga0501070_0198251
697 Ga0501071_0003209
698 Ga0501071_0017495
699 Ga0501071_0035321
700 Ga0501071_0084336
701 Ga0501072_0000365
702 Ga0501072_0000860
703 Ga0501072_0001343
704 Ga0501072_0070623
705 Ga0501072_0099014
706 Ga0501072_0300695
707 Ga0501073_0012015
708 Ga0501073_0066392
709 Ga0501074_0006543
710 Ga0501074_0025499
711 Ga0501074_0028238
712 Ga0501074_0031894
713 Ga0501074_0089048
714 Ga0501074_0301645
715 Ga0501075_0006861
716 Ga0501075_0008589
717 Ga0501075_0017592
718 Ga0501075_0052109
719 Ga0501075_0111669
720 Ga0501075_0113062
721 Ga0501075_0360837
722 Ga0501076_0000349
723 Ga0501076_0000471
724 Ga0501076_0002969
725 Ga0501076_0004344
726 Ga0501076_0033676
727 Ga0501076_0057600
728 Ga0501076_0140007
729 Ga0501077_0001801
730 Ga0501077_0002935
731 Ga0501077_0011109
732 Ga0501077_0013007
733 Ga0501077_0018663
734 Ga0501077_0138093
735 Ga0501077_0202244
736 Ga0501079_0004557
737 Ga0501079_0007609
738 Ga0501079_0045568
739 Ga0501079_0072670
740 Ga0501079_0174665
741 Ga0501079_0502970
742 Ga0501080_0004713
743 Ga0501080_0017368
744 Ga0501080_0056400
745 Ga0501080_0187127
746 Ga0501081_0002582
747 Ga0501081_0003376
748 Ga0501081_0007130
749 Ga0501081_0013856
750 Ga0501081_0071042
751 Ga0501081_0126498
752 Ga0501081_0146869
753 Ga0501083_0002556
754 Ga0501083_0007199
755 Ga0501083_0020935
756 Ga0501083_0031701
757 Ga0501083_0234867
758 Ga0501035_0000561
759 Ga0501035_0021386
760 Ga0501035_0121706
761 Ga0501035_0386702
762 Ga0501044_0010890
763 Ga0501044_0015047
764 Ga0501044_0021532
765 Ga0501044_0292596
766 Ga0501044_0435474
767 Ga0501045_0003869
768 Ga0501045_0005248
769 Ga0501045_0007727
770 Ga0501045_0063086
771 Ga0501045_0072430
772 Ga0501045_0337495
773 Ga0501045_0388291
774 nmdc:mga05p37_119858_c1
775 nmdc:mga05p37_9747_c1
776 nmdc:mga08y16_86620_c1
777 nmdc:mga0n895_119199_c1
778 nmdc:mga0n895_39756_c1
779 nmdc:mga0a205_1365_c1
780 nmdc:mga0a205_5117_c1
781 Ga0500643_014253
782 Ga0500643_024714
783 Ga0500647_0030077
784 Ga0500641_0007725
785 Ga0500562_000385
786 Ga0500608_036250
787 Ga0500636_0000619
788 Ga0500625_000012
789 Ga0501084_0000493
790 Ga0501084_0000557
791 Ga0501084_0025938
792 Ga0501084_0028356
793 Ga0501084_0040499
794 Ga0501084_0208093
795 Ga0501084_0232146
796 Ga0590071_010193
797 Ga0590074_003736
798 Ga0501082_0001026
799 Ga0501082_0016883
800 Ga0501082_0017653
801 Ga0501082_0021936
802 Ga0501082_0057090
803 Ga0501082_0345573
804 Ga0530510_0008261
805 Ga0530510_0010467
806 Ga0530510_0058194
807 Ga0530510_0064002
808 Ga0530510_0082795
809 8024489148
810 8057104230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

48

351

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y1f-assembly1.cif.gz_X human formylglycine generating enzyme with cysteine sulfenic acid 0.8916 2 296
8aru-assembly1.cif.gz_A crystal structure of human formylglycine generating enzyme 0.8907 2 296
2afy-assembly1.cif.gz_X formylglycine generating enzyme c341s mutant 0.8904 2 296
2aii-assembly1.cif.gz_X wild-type formylglycine generating enzyme reacted with iodoacetamide 0.8902 2 296
2hib-assembly1.cif.gz_X human formylglycine generating enzyme, c336s mutant, iodide co-crystallization 0.8898 2 296
ID Description Score Start End Superfamily
af_I6Y8I5_2_297_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.9173 2 296 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8653 2 296 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8586 2 295 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.843 2 295 3.90.1580.10
af_O69671_154_424_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7113 2 294 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A554TSQ7-F1-model_v4 deleted 0.994 80 214
AF-A0A3D6D300-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9891 2 224 GO:0120147
AF-A0A7Y4XD41-F1-model_v4 Formylglycine-generating enzyme family protein 0.9889 2 224 GO:0120147
AF-A0A554TVS7-F1-model_v4 deleted 0.9879 1 214
AF-A0A554TSQ7-F1-model_v4 deleted 0.9868 80 214

Map