F435947

General Info

Members Datasets Scaffolds Average Seq Length
405 233 810 163

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10467639|Ga0157379_104676392
Length 164
Sequence MSNSISSELDETDLKILAVLQEDASLENQHVAARVHLSPAACLRRTRKLREDGVITGFVALVDAGRLGLAVQAYAFVALENQRPSSASQFEGMIRRRPEVTECVRLSGAQDFMVRVVVTSMSAYTEFLDKHLLPLPAVRSVSTSFELGVLKRTTAVPVAVRRSG

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
146 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
147 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
204 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
221 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
222 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
228 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
232 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 0
Rhizoplane 2.72
Rhizosphere 60.99
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10467639 3300014968 Bacteria 1166
2 JGI25156J39149_1000278 3300002705 Bacteria 34709
3 JGI25156J39149_1000973 3300002705 Bacteria 13642
4 JGI25154J39366_1000221 3300002738 Bacteria 38916
5 JGI25157J39369_1000049 3300002741 Bacteria 115611
6 JGI25164J39214_1002323 3300002772 Bacteria 3034
7 rootH1_10004123 3300003316 Bacteria 1430
8 rootH1_10086098 3300003316 Bacteria 1581
9 rootH2_10155345 3300003320 Bacteria 1873
10 rootL2_10016201 3300003322 Bacteria 1156
11 Ga0055539_1000583 3300003752 Bacteria 10242
12 Ga0055539_1001490 3300003752 Bacteria 4304
13 Ga0055533_1000010 3300003756 Bacteria 491196
14 Ga0055525_1001515 3300003759 Bacteria 3979
15 Ga0055535_1000607 3300003761 Bacteria 29519
16 Ga0055535_1000906 3300003761 Bacteria 20145
17 Ga0055535_1019507 3300003761 Bacteria 859
18 Ga0055529_1000731 3300003763 Bacteria 21383
19 Ga0055540_1007341 3300003792 Bacteria 4181
20 Ga0070658_10115828 3300005327 Bacteria 2223
21 Ga0070658_10120116 3300005327 Bacteria 2183
22 Ga0070658_10124299 3300005327 Bacteria 2146
23 Ga0070658_10212457 3300005327 Bacteria 1634
24 Ga0070683_100389150 3300005329 Bacteria 1329
25 Ga0070690_100005620 3300005330 Bacteria 7056
26 Ga0070690_100937111 3300005330 Bacteria 679
27 Ga0068869_101000701 3300005334 Bacteria 728
28 Ga0068868_100577020 3300005338 Bacteria 994
29 Ga0070660_100079967 3300005339 Bacteria 2564
30 Ga0070660_100085551 3300005339 Bacteria 2480
31 Ga0070660_100627437 3300005339 Bacteria 899
32 Ga0070671_100016221 3300005355 Bacteria 6024
33 Ga0070673_100042978 3300005364 Bacteria 3488
34 Ga0070659_100125814 3300005366 Bacteria 2079
35 Ga0070667_100005528 3300005367 Bacteria 10550
36 Ga0070667_100207645 3300005367 Bacteria 1740
37 Ga0070662_100001654 3300005457 Bacteria 13712
38 Ga0070706_100002403 3300005467 Bacteria 18889
39 Ga0070707_100273857 3300005468 Bacteria 1641
40 Ga0070698_101019666 3300005471 Bacteria 775
41 Ga0070684_100312952 3300005535 Bacteria 1442
42 Ga0070693_100728423 3300005547 Bacteria 729
43 Ga0070665_100001453 3300005548 Bacteria 27739
44 Ga0068855_100028522 3300005563 Bacteria 6677
45 Ga0068855_100274813 3300005563 Bacteria 1872
46 Ga0068855_100551419 3300005563 Bacteria 1248
47 Ga0068857_100003345 3300005577 Bacteria 13354
48 Ga0068854_100071082 3300005578 Bacteria 2545
49 Ga0068856_100059311 3300005614 Bacteria 3780
50 Ga0068852_100176291 3300005616 Bacteria 2007
51 Ga0068852_101677738 3300005616 Bacteria 658
52 Ga0068859_100129872 3300005617 Bacteria 2591
53 Ga0068859_100152412 3300005617 Bacteria 2387
54 Ga0068864_100007643 3300005618 Bacteria 8905
55 Ga0068861_100076547 3300005719 Bacteria 2608
56 Ga0068863_100008865 3300005841 Bacteria 9823
57 Ga0068858_101154446 3300005842 Bacteria 761
58 Ga0068860_100858555 3300005843 Bacteria 923
59 Ga0075363_100606630 3300006048 Bacteria 656
60 Ga0075362_10159085 3300006177 Bacteria 1087
61 Ga0075362_10402072 3300006177 Bacteria 691
62 Ga0075362_10555287 3300006177 Bacteria 591
63 Ga0075367_10113997 3300006178 Bacteria 1661
64 Ga0075369_10051633 3300006186 Bacteria 1780
65 Ga0075366_10027995 3300006195 Bacteria 3306
66 Ga0075366_10042233 3300006195 Bacteria 2699
67 Ga0075366_10055245 3300006195 Bacteria 2359
68 Ga0075366_10141477 3300006195 Bacteria 1455
69 Ga0075366_10149356 3300006195 Bacteria 1415
70 Ga0075366_10168239 3300006195 Bacteria 1330
71 Ga0075366_10173979 3300006195 Bacteria 1307
72 Ga0075366_10186036 3300006195 Bacteria 1262
73 Ga0075370_10000978 3300006353 Bacteria 11818
74 Ga0075370_10009479 3300006353 Bacteria 5058
75 Ga0075370_10030893 3300006353 Bacteria 2990
76 Ga0075370_10078685 3300006353 Bacteria 1894
77 Ga0075370_10144886 3300006353 Bacteria 1390
78 Ga0068871_100642387 3300006358 Bacteria 968
79 Ga0068871_101065668 3300006358 Bacteria 755
80 Ga0068865_100224707 3300006881 Bacteria 1469
81 Ga0097620_100129864 3300006931 Bacteria 2591
82 Ga0097620_100152410 3300006931 Bacteria 2387
83 Ga0105240_10058223 3300009093 Bacteria 4824
84 Ga0105240_10067999 3300009093 Bacteria 4414
85 Ga0105240_11737891 3300009093 Bacteria 651
86 Ga0111539_11209018 3300009094 Bacteria 878
87 Ga0105247_10517232 3300009101 Bacteria 872
88 Ga0114129_10230294 3300009147 Bacteria 2496
89 Ga0105243_11011320 3300009148 Bacteria 834
90 Ga0105243_11114148 3300009148 Bacteria 798
91 Ga0105241_10129051 3300009174 Bacteria 2045
92 Ga0105241_10746108 3300009174 Bacteria 897
93 Ga0105242_10064907 3300009176 Bacteria 3010
94 Ga0105242_11534180 3300009176 Bacteria 698
95 Ga0105248_10878978 3300009177 Bacteria 1012
96 Ga0105237_10026894 3300009545 Bacteria 5879
97 Ga0105237_11997603 3300009545 Bacteria 588
98 Ga0105238_10223622 3300009551 Bacteria 1859
99 Ga0105238_10607516 3300009551 Bacteria 1102
100 Ga0105239_10021816 3300010375 Bacteria 7059
101 Ga0105239_11163711 3300010375 Bacteria 888
102 Ga0105239_11403099 3300010375 Bacteria 806
103 Ga0105246_10372289 3300011119 Bacteria 1177
104 Ga0157373_10156995 3300013100 Bacteria 1600
105 Ga0157369_10023106 3300013105 Bacteria 6929
106 Ga0157374_10917494 3300013296 Bacteria 894
107 Ga0157374_11036552 3300013296 Bacteria 840
108 Ga0157374_11316675 3300013296 Bacteria 744
109 Ga0157378_10356462 3300013297 Bacteria 1430
110 Ga0157378_10520422 3300013297 Bacteria 1191
111 Ga0163162_11295480 3300013306 Bacteria 828
112 Ga0157372_10036875 3300013307 Bacteria 5391
113 Ga0157375_10115834 3300013308 Bacteria 2783
114 Ga0157375_10615011 3300013308 Bacteria 1245
115 Ga0163163_10236647 3300014325 Bacteria 1875
116 Ga0163163_10297519 3300014325 Bacteria 1666
117 Ga0163163_10703053 3300014325 Bacteria 1074
118 Ga0163163_11073815 3300014325 Bacteria 868
119 Ga0182008_10422319 3300014497 Bacteria 720
120 Ga0157377_11457339 3300014745 Bacteria 542
121 Ga0157379_10012835 3300014968 Bacteria 7326
122 Ga0157379_10063308 3300014968 Bacteria 3307
123 Ga0157379_10111286 3300014968 Bacteria 2460
124 Ga0157379_10400586 3300014968 Bacteria 1261
125 Ga0157379_10675752 3300014968 Bacteria 968
126 Ga0157376_10823636 3300014969 Bacteria 942
127 Ga0213872_10000013 3300021361 Bacteria 182866
128 Ga0213872_10000066 3300021361 Bacteria 93052
129 Ga0213872_10000187 3300021361 Bacteria 55101
130 Ga0213872_10000575 3300021361 Bacteria 28427
131 Ga0213872_10022030 3300021361 Bacteria 2935
132 Ga0213872_10059293 3300021361 Bacteria 1732
133 Ga0209674_100003 3300025226 Bacteria 2196646
134 Ga0209672_106149 3300025228 Bacteria 1982
135 Ga0209563_100049 3300025230 Bacteria 358472
136 Ga0207427_100280 3300025231 Bacteria 37213
137 Ga0209258_100163 3300025242 Bacteria 149677
138 Ga0209258_104311 3300025242 Bacteria 2734
139 Ga0209646_1000138 3300025246 Bacteria 114892
140 Ga0209026_1000021 3300025250 Bacteria 375165
141 Ga0209677_100145 3300025253 Bacteria 65577
142 Ga0209677_100209 3300025253 Bacteria 45370
143 Ga0209677_102489 3300025253 Bacteria 6881
144 Ga0209148_1009701 3300025254 Bacteria 1858
145 Ga0209759_1000025 3300025256 Bacteria 317082
146 Ga0209759_1001401 3300025256 Bacteria 13807
147 Ga0209759_1003020 3300025256 Bacteria 6953
148 Ga0209759_1007272 3300025256 Bacteria 3585
149 Ga0209759_1021924 3300025256 Bacteria 1441
150 Ga0209455_1000059 3300025272 Bacteria 339995
151 Ga0209051_1003535 3300025303 Bacteria 10187
152 Ga0207705_10265631 3300025909 Bacteria 1311
153 Ga0207705_10272412 3300025909 Bacteria 1295
154 Ga0207684_10030077 3300025910 Bacteria 4624
155 Ga0207654_10022004 3300025911 Bacteria 3397
156 Ga0207695_10042749 3300025913 Bacteria 4835
157 Ga0207695_10085739 3300025913 Bacteria 3178
158 Ga0207695_11148303 3300025913 Bacteria 657
159 Ga0207671_10174416 3300025914 Bacteria 1671
160 Ga0207657_10180931 3300025919 Bacteria 1704
161 Ga0207649_10134858 3300025920 Bacteria 1682
162 Ga0207694_10076697 3300025924 Bacteria 2618
163 Ga0207644_10024748 3300025931 Bacteria 4124
164 Ga0207690_10067790 3300025932 Bacteria 2449
165 Ga0207706_10000754 3300025933 Bacteria 33680
166 Ga0207669_10284023 3300025937 Bacteria 1250
167 Ga0207704_10226032 3300025938 Bacteria 1388
168 Ga0207704_10229857 3300025938 Bacteria 1378
169 Ga0207689_10364752 3300025942 Bacteria 1201
170 Ga0207661_10276118 3300025944 Bacteria 1501
171 Ga0207667_10009539 3300025949 Bacteria 11420
172 Ga0207667_10144803 3300025949 Bacteria 2446
173 Ga0207667_10497375 3300025949 Bacteria 1237
174 Ga0207667_10718235 3300025949 Bacteria 1001
175 Ga0207651_10104538 3300025960 Bacteria 2110
176 Ga0207651_11169971 3300025960 Bacteria 690
177 Ga0207640_10038149 3300025981 Bacteria 3029
178 Ga0207658_10000919 3300025986 Bacteria 24357
179 Ga0207658_10277686 3300025986 Bacteria 1435
180 Ga0207658_11089423 3300025986 Bacteria 730
181 Ga0207677_11182818 3300026023 Bacteria 699
182 Ga0207703_10711717 3300026035 Bacteria 955
183 Ga0207678_10333237 3300026067 Bacteria 1307
184 Ga0207702_10046352 3300026078 Bacteria 3659
185 Ga0207702_11093869 3300026078 Bacteria 791
186 Ga0207641_10063480 3300026088 Bacteria 3155
187 Ga0207641_11229157 3300026088 Bacteria 749
188 Ga0207676_10104980 3300026095 Bacteria 2351
189 Ga0207674_10006321 3300026116 Bacteria 13962
190 Ga0207674_11445967 3300026116 Bacteria 657
191 Ga0207698_10121349 3300026142 Bacteria 2213
192 Ga0209983_1057239 3300027665 Bacteria 858
193 Ga0209813_10091302 3300027866 Bacteria 1023
194 Ga0268266_10006311 3300028379 Bacteria 10863
195 Ga0268266_10061890 3300028379 Bacteria 3228
196 Ga0268264_10554750 3300028381 Bacteria 1127
197 Ga0268264_10803717 3300028381 Bacteria 940
198 Ga0265336_10000006 3300028666 Bacteria 348453
199 Ga0307517_10003945 3300028786 Bacteria 22979
200 Ga0307517_10130894 3300028786 Bacteria 1807
201 Ga0307517_10350143 3300028786 Bacteria 802
202 Ga0307515_10000043 3300028794 Bacteria 304612
203 Ga0307515_10031745 3300028794 Bacteria 8784
204 Ga0307515_10047906 3300028794 Bacteria 6478
205 Ga0307515_10102941 3300028794 Bacteria 3428
206 Ga0307515_10178958 3300028794 Bacteria 2079
207 Ga0307515_10602791 3300028794 Bacteria 709
208 Ga0265324_10002529 3300029957 Bacteria 9267
209 Ga0265324_10049120 3300029957 Bacteria 1451
210 Ga0265324_10131884 3300029957 Bacteria 848
211 Ga0307511_10067532 3300030521 Bacteria 2652
212 Ga0307512_10034998 3300030522 Bacteria 4288
213 Ga0307512_10165591 3300030522 Bacteria 1282
214 Ga0307512_10197418 3300030522 Bacteria 1096
215 Ga0307513_10027318 3300031456 Bacteria 6556
216 Ga0307513_10433343 3300031456 Bacteria 1042
217 Ga0307509_10000120 3300031507 Bacteria 114238
218 Ga0307509_10003007 3300031507 Bacteria 26366
219 Ga0307509_10015374 3300031507 Bacteria 8929
220 Ga0307509_10099842 3300031507 Bacteria 2943
221 Ga0307509_10127775 3300031507 Bacteria 2504
222 Ga0307509_10315319 3300031507 Bacteria 1304
223 Ga0307509_10373566 3300031507 Bacteria 1141
224 Ga0307508_10000163 3300031616 Bacteria 80086
225 Ga0307508_10001852 3300031616 Bacteria 23364
226 Ga0307508_10901360 3300031616 Bacteria 511
227 Ga0307514_10001133 3300031649 Bacteria 36650
228 Ga0307514_10046822 3300031649 Bacteria 3378
229 Ga0307514_10184808 3300031649 Bacteria 1338
230 Ga0307514_10227714 3300031649 Bacteria 1134
231 Ga0307516_10000860 3300031730 Bacteria 41628
232 Ga0307516_10009468 3300031730 Bacteria 10852
233 Ga0307516_10021446 3300031730 Bacteria 6646
234 Ga0307516_10201787 3300031730 Bacteria 1708
235 Ga0307516_10805012 3300031730 Bacteria 601
236 Ga0307416_101383619 3300032002 Bacteria 809
237 Ga0307507_10314449 3300033179 Bacteria 948
238 Ga0307510_10021393 3300033180 Bacteria 7537
239 Ga0307510_10178262 3300033180 Bacteria 1692
240 Ga0307510_10239398 3300033180 Bacteria 1310
241 Ga0307510_10251092 3300033180 Bacteria 1256
242 Ga0373939_0102940 3300035114 Bacteria 983
243 Ga0373946_0166218 3300035171 Bacteria 1039
244 Ga0373931_0025715 3300035691 Bacteria 2990
245 Ga0373931_0039449 3300035691 Bacteria 2474
246 Ga0373931_0377373 3300035691 Bacteria 893
247 Ga0373937_0065726 3300036401 Bacteria 3339
248 Ga0373925_0113550 3300037068 Bacteria 2095
249 Ga0373925_0276456 3300037068 Bacteria 1352
250 Ga0395899_0120607 3300037312 Bacteria 1879
251 Ga0395905_0001560 3300037471 Bacteria 27402
252 Ga0395905_0149608 3300037471 Bacteria 2196
253 Ga0395905_0430109 3300037471 Bacteria 1217
254 Ga0395901_0040951 3300038443 Bacteria 4799
255 Ga0436361_0194657 3300039447 Bacteria 16315
256 Ga0436361_0313405 3300039447 Bacteria 87904
257 Ga0436361_0374925 3300039447 Bacteria 2199
258 Ga0436361_0412068 3300039447 Bacteria 9476
259 Ga0436361_0414241 3300039447 Bacteria 51685
260 Ga0436361_0450257 3300039447 Bacteria 1459
261 Ga0436361_0451283 3300039447 Bacteria 1549
262 Ga0436361_0595153 3300039447 Bacteria 1369
263 Ga0439465_0063038 3300041413 Bacteria 1231
264 Ga0451849_0258522 3300041505 Bacteria 796
265 Ga0451853_2456410 3300041512 Bacteria 1428
266 Ga0450894_019120 3300042131 Bacteria 919
267 Ga0450899_032678 3300042135 Bacteria 636
268 Ga0450906_017210 3300042145 Bacteria 1305
269 Ga0439446_0067691 3300042156 Bacteria 1088
270 Ga0439434_0065051 3300042435 Bacteria 1144
271 Ga0450893_0039140 3300042532 Bacteria 865
272 Ga0450893_0112204 3300042532 Bacteria 563
273 Ga0451577_0001772 3300042876 Bacteria 27758
274 Ga0451577_0338251 3300042876 Bacteria 1365
275 Ga0466969_0020716 3300044656 Bacteria 3403
276 Ga0466969_0021680 3300044656 Bacteria 3321
277 Ga0466972_0001178 3300044658 Bacteria 12542
278 Ga0466972_0107765 3300044658 Bacteria 1317
279 Ga0453683_0348774 3300044673 Bacteria 951
280 Ga0453683_0423549 3300044673 Bacteria 859
281 Ga0466965_0012765 3300044683 Bacteria 3955
282 Ga0466965_0028560 3300044683 Bacteria 2710
283 Ga0466965_0112277 3300044683 Bacteria 1401
284 Ga0466966_0004241 3300044684 Bacteria 9461
285 Ga0466966_0005876 3300044684 Bacteria 8094
286 Ga0466961_0032768 3300044693 Bacteria 3338
287 Ga0466961_0137150 3300044693 Bacteria 1532
288 Ga0466961_0223356 3300044693 Bacteria 1160
289 Ga0466963_0081694 3300044694 Bacteria 2189
290 Ga0466964_0001646 3300044706 Bacteria 7720
291 Ga0453684_0006975 3300044712 Bacteria 21145
292 Ga0453684_0097276 3300044712 Bacteria 3613
293 Ga0453684_0639635 3300044712 Bacteria 1162
294 Ga0453684_0743302 3300044712 Bacteria 1062
295 Ga0453684_0891234 3300044712 Bacteria 953
296 Ga0466971_0013726 3300044719 Bacteria 3561
297 Ga0466971_0069005 3300044719 Bacteria 1603
298 Ga0466971_0095766 3300044719 Bacteria 1361
299 Ga0466970_0071563 3300044765 Bacteria 1865
300 Ga0466957_0011036 3300044842 Bacteria 5197
301 Ga0466957_0147054 3300044842 Bacteria 1522
302 Ga0466960_0078767 3300044901 Bacteria 1655
303 Ga0466960_0823420 3300044901 Bacteria 563
304 Ga0466959_0003818 3300045049 Bacteria 9988
305 Ga0466959_0013162 3300045049 Bacteria 5992
306 Ga0451576_0010372 3300045051 Bacteria 10697
307 Ga0451576_0577190 3300045051 Bacteria 1181
308 Ga0451576_1015642 3300045051 Bacteria 869
309 Ga0451576_1658591 3300045051 Bacteria 662
310 Ga0466958_0226403 3300045836 Bacteria 1193
311 Ga0466967_0233916 3300045976 Bacteria 1750
312 Ga0495592_0000222 3300046454 Bacteria 48902
313 Ga0495650_0017208 3300046471 Bacteria 3629
314 Ga0495650_0050164 3300046471 Bacteria 1727
315 Ga0495639_0019675 3300046475 Bacteria 2946
316 Ga0495585_0007178 3300046492 Bacteria 6843
317 Ga0495583_0000927 3300046506 Bacteria 34448
318 Ga0495606_0003050 3300046507 Bacteria 18259
319 Ga0495606_0119520 3300046507 Bacteria 1579
320 Ga0495632_0094032 3300046519 Bacteria 1418
321 Ga0495648_0345217 3300046524 Bacteria 682
322 Ga0495666_0030223 3300046526 Bacteria 2661
323 Ga0495598_0105650 3300046537 Bacteria 937
324 Ga0495621_0004457 3300046539 Bacteria 3938
325 Ga0495597_0224920 3300046542 Unclassified 744
326 Ga0495668_0020218 3300046616 Bacteria 3830
327 Ga0495668_0027429 3300046616 Bacteria 3227
328 Ga0495625_0021054 3300046660 Bacteria 5027
329 Ga0495625_0448021 3300046660 Bacteria 798
330 Ga0495671_0128239 3300046692 Bacteria 1237
331 Ga0495649_0000464 3300046694 Bacteria 34868
332 Ga0495649_0247596 3300046694 Bacteria 916
333 Ga0495589_0008473 3300046794 Bacteria 5366
334 Ga0495676_0563441 3300047321 Bacteria 744
335 Ga0495673_0322962 3300047469 Bacteria 549
336 Ga0495686_0040532 3300047472 Bacteria 2969
337 Ga0495614_0178783 3300048089 Bacteria 954
338 Ga0496100_0547768 3300048903 Bacteria 895
339 Ga0496101_0754921 3300048904 Bacteria 768
340 Ga0496102_0019722 3300048905 Bacteria 5943
341 Ga0496105_0878200 3300048908 Bacteria 677
342 Ga0496106_0109255 3300048909 Bacteria 2152
343 Ga0496108_0213162 3300048911 Bacteria 1677
344 Ga0496109_0731541 3300048912 Bacteria 927
345 Ga0496110_0309520 3300048913 Unclassified 1439
346 Ga0496111_0119223 3300048914 Unclassified 1949
347 Ga0496113_0727296 3300048916 Bacteria 791
348 Ga0496114_1148136 3300048917 Bacteria 662
349 Ga0496126_0396798 3300048929 Bacteria 1120
350 Ga0495682_0113046 3300049460 Bacteria 973
351 Ga0501199_010115 3300049650 Bacteria 1005
352 Ga0501265_021572 3300049762 Bacteria 874
353 nmdc:mga03683_484016_c1 3300050489 Bacteria 598
354 nmdc:mga03683_576286_c1 3300050489 Bacteria 549
355 nmdc:mga03683_6923_c2 3300050489 Bacteria 2405
356 nmdc:mga0k408_1301_c1 3300050493 Bacteria 13499
357 nmdc:mga0k408_17227_c1 3300050493 Bacteria 4022
358 nmdc:mga0k408_206442_c1 3300050493 Bacteria 1173
359 nmdc:mga0k408_240911_c1 3300050493 Bacteria 1080
360 nmdc:mga0k408_251808_c1 3300050493 Bacteria 1055
361 nmdc:mga0k408_27156_c2 3300050493 Bacteria 2717
362 nmdc:mga0k408_46815_c1 3300050493 Bacteria 2498
363 nmdc:mga0k408_74736_c1 3300050493 Bacteria 1980
364 nmdc:mga0k408_75899_c1 3300050493 Bacteria 1964
365 nmdc:mga04h51_106870_c1 3300050495 Bacteria 1027
366 nmdc:mga07m45_130639_c1 3300050496 Bacteria 1453
367 nmdc:mga07m45_206706_c1 3300050496 Bacteria 1142
368 nmdc:mga07m45_29245_c1 3300050496 Bacteria 3045
369 nmdc:mga07m45_44384_c1 3300050496 Bacteria 2495
370 nmdc:mga07m45_80410_c1 3300050496 Bacteria 1861
371 nmdc:mga07m45_86384_c1 3300050496 Bacteria 1795
372 nmdc:mga05p37_107600_c1 3300050507 Bacteria 3430
373 nmdc:mga08y16_1317791_c1 3300050511 Unclassified 688
374 nmdc:mga0sz30_101057_c1 3300050516 Bacteria 1260
375 nmdc:mga0sz30_361653_c1 3300050516 Bacteria 649
376 Ga0500635_0000017 3300053080 Bacteria 113720
377 Ga0500635_0208778 3300053080 Bacteria 760
378 Ga0495619_0529885 3300053085 Bacteria 809
379 Ga0500578_0134624 3300053086 Bacteria 1548
380 Ga0500644_0026430 3300053088 Bacteria 1796
381 Ga0500583_0043904 3300053092 Bacteria 2044
382 Ga0500583_0318359 3300053092 Bacteria 759
383 Ga0500651_0061013 3300053093 Bacteria 2356
384 Ga0500651_0072371 3300053093 Bacteria 2143
385 Ga0500651_0130468 3300053093 Bacteria 1520
386 Ga0500594_0000988 3300053118 Bacteria 6110
387 Ga0500608_192470 3300053122 Bacteria 851
388 Ga0500621_082647 3300053126 Bacteria 1286
389 Ga0500652_151546 3300053131 Bacteria 962
390 Ga0500655_004929 3300053133 Bacteria 2398
391 Ga0500559_0000011 3300053136 Bacteria 164751
392 Ga0500559_0012833 3300053136 Bacteria 3555
393 Ga0500559_0082781 3300053136 Bacteria 1461
394 Ga0500564_140127 3300053138 Bacteria 1039
395 Ga0500577_0140175 3300053142 Bacteria 1019
396 Ga0500616_0093951 3300053153 Bacteria 1479
397 Ga0500619_017810 3300053154 Bacteria 1983
398 Ga0500620_077217 3300053155 Bacteria 1151
399 Ga0500622_0002322 3300053156 Bacteria 13902
400 Ga0500636_0011321 3300053177 Bacteria 5222
401 Ga0500636_0219418 3300053177 Bacteria 992
402 Ga0500599_039107 3300053736 Bacteria 727
403 Ga0500587_002239 3300053739 Bacteria 2754
404 Ga0466962_0002081 3300061719 Bacteria 9473
405 Ga0466962_0017214 3300061719 Bacteria 3482
406 Ga0157379_10467639
407 JGI25156J39149_1000278
408 JGI25156J39149_1000973
409 JGI25154J39366_1000221
410 JGI25157J39369_1000049
411 JGI25164J39214_1002323
412 rootH1_10004123
413 rootH1_10086098
414 rootH2_10155345
415 rootL2_10016201
416 Ga0055539_1000583
417 Ga0055539_1001490
418 Ga0055533_1000010
419 Ga0055525_1001515
420 Ga0055535_1000607
421 Ga0055535_1000906
422 Ga0055535_1019507
423 Ga0055529_1000731
424 Ga0055540_1007341
425 Ga0070658_10115828
426 Ga0070658_10120116
427 Ga0070658_10124299
428 Ga0070658_10212457
429 Ga0070683_100389150
430 Ga0070690_100005620
431 Ga0070690_100937111
432 Ga0068869_101000701
433 Ga0068868_100577020
434 Ga0070660_100079967
435 Ga0070660_100085551
436 Ga0070660_100627437
437 Ga0070671_100016221
438 Ga0070673_100042978
439 Ga0070659_100125814
440 Ga0070667_100005528
441 Ga0070667_100207645
442 Ga0070662_100001654
443 Ga0070706_100002403
444 Ga0070707_100273857
445 Ga0070698_101019666
446 Ga0070684_100312952
447 Ga0070693_100728423
448 Ga0070665_100001453
449 Ga0068855_100028522
450 Ga0068855_100274813
451 Ga0068855_100551419
452 Ga0068857_100003345
453 Ga0068854_100071082
454 Ga0068856_100059311
455 Ga0068852_100176291
456 Ga0068852_101677738
457 Ga0068859_100129872
458 Ga0068859_100152412
459 Ga0068864_100007643
460 Ga0068861_100076547
461 Ga0068863_100008865
462 Ga0068858_101154446
463 Ga0068860_100858555
464 Ga0075363_100606630
465 Ga0075362_10159085
466 Ga0075362_10402072
467 Ga0075362_10555287
468 Ga0075367_10113997
469 Ga0075369_10051633
470 Ga0075366_10027995
471 Ga0075366_10042233
472 Ga0075366_10055245
473 Ga0075366_10141477
474 Ga0075366_10149356
475 Ga0075366_10168239
476 Ga0075366_10173979
477 Ga0075366_10186036
478 Ga0075370_10000978
479 Ga0075370_10009479
480 Ga0075370_10030893
481 Ga0075370_10078685
482 Ga0075370_10144886
483 Ga0068871_100642387
484 Ga0068871_101065668
485 Ga0068865_100224707
486 Ga0097620_100129864
487 Ga0097620_100152410
488 Ga0105240_10058223
489 Ga0105240_10067999
490 Ga0105240_11737891
491 Ga0111539_11209018
492 Ga0105247_10517232
493 Ga0114129_10230294
494 Ga0105243_11011320
495 Ga0105243_11114148
496 Ga0105241_10129051
497 Ga0105241_10746108
498 Ga0105242_10064907
499 Ga0105242_11534180
500 Ga0105248_10878978
501 Ga0105237_10026894
502 Ga0105237_11997603
503 Ga0105238_10223622
504 Ga0105238_10607516
505 Ga0105239_10021816
506 Ga0105239_11163711
507 Ga0105239_11403099
508 Ga0105246_10372289
509 Ga0157373_10156995
510 Ga0157369_10023106
511 Ga0157374_10917494
512 Ga0157374_11036552
513 Ga0157374_11316675
514 Ga0157378_10356462
515 Ga0157378_10520422
516 Ga0163162_11295480
517 Ga0157372_10036875
518 Ga0157375_10115834
519 Ga0157375_10615011
520 Ga0163163_10236647
521 Ga0163163_10297519
522 Ga0163163_10703053
523 Ga0163163_11073815
524 Ga0182008_10422319
525 Ga0157377_11457339
526 Ga0157379_10012835
527 Ga0157379_10063308
528 Ga0157379_10111286
529 Ga0157379_10400586
530 Ga0157379_10675752
531 Ga0157376_10823636
532 Ga0213872_10000013
533 Ga0213872_10000066
534 Ga0213872_10000187
535 Ga0213872_10000575
536 Ga0213872_10022030
537 Ga0213872_10059293
538 Ga0209674_100003
539 Ga0209672_106149
540 Ga0209563_100049
541 Ga0207427_100280
542 Ga0209258_100163
543 Ga0209258_104311
544 Ga0209646_1000138
545 Ga0209026_1000021
546 Ga0209677_100145
547 Ga0209677_100209
548 Ga0209677_102489
549 Ga0209148_1009701
550 Ga0209759_1000025
551 Ga0209759_1001401
552 Ga0209759_1003020
553 Ga0209759_1007272
554 Ga0209759_1021924
555 Ga0209455_1000059
556 Ga0209051_1003535
557 Ga0207705_10265631
558 Ga0207705_10272412
559 Ga0207684_10030077
560 Ga0207654_10022004
561 Ga0207695_10042749
562 Ga0207695_10085739
563 Ga0207695_11148303
564 Ga0207671_10174416
565 Ga0207657_10180931
566 Ga0207649_10134858
567 Ga0207694_10076697
568 Ga0207644_10024748
569 Ga0207690_10067790
570 Ga0207706_10000754
571 Ga0207669_10284023
572 Ga0207704_10226032
573 Ga0207704_10229857
574 Ga0207689_10364752
575 Ga0207661_10276118
576 Ga0207667_10009539
577 Ga0207667_10144803
578 Ga0207667_10497375
579 Ga0207667_10718235
580 Ga0207651_10104538
581 Ga0207651_11169971
582 Ga0207640_10038149
583 Ga0207658_10000919
584 Ga0207658_10277686
585 Ga0207658_11089423
586 Ga0207677_11182818
587 Ga0207703_10711717
588 Ga0207678_10333237
589 Ga0207702_10046352
590 Ga0207702_11093869
591 Ga0207641_10063480
592 Ga0207641_11229157
593 Ga0207676_10104980
594 Ga0207674_10006321
595 Ga0207674_11445967
596 Ga0207698_10121349
597 Ga0209983_1057239
598 Ga0209813_10091302
599 Ga0268266_10006311
600 Ga0268266_10061890
601 Ga0268264_10554750
602 Ga0268264_10803717
603 Ga0265336_10000006
604 Ga0307517_10003945
605 Ga0307517_10130894
606 Ga0307517_10350143
607 Ga0307515_10000043
608 Ga0307515_10031745
609 Ga0307515_10047906
610 Ga0307515_10102941
611 Ga0307515_10178958
612 Ga0307515_10602791
613 Ga0265324_10002529
614 Ga0265324_10049120
615 Ga0265324_10131884
616 Ga0307511_10067532
617 Ga0307512_10034998
618 Ga0307512_10165591
619 Ga0307512_10197418
620 Ga0307513_10027318
621 Ga0307513_10433343
622 Ga0307509_10000120
623 Ga0307509_10003007
624 Ga0307509_10015374
625 Ga0307509_10099842
626 Ga0307509_10127775
627 Ga0307509_10315319
628 Ga0307509_10373566
629 Ga0307508_10000163
630 Ga0307508_10001852
631 Ga0307508_10901360
632 Ga0307514_10001133
633 Ga0307514_10046822
634 Ga0307514_10184808
635 Ga0307514_10227714
636 Ga0307516_10000860
637 Ga0307516_10009468
638 Ga0307516_10021446
639 Ga0307516_10201787
640 Ga0307516_10805012
641 Ga0307416_101383619
642 Ga0307507_10314449
643 Ga0307510_10021393
644 Ga0307510_10178262
645 Ga0307510_10239398
646 Ga0307510_10251092
647 Ga0373939_0102940
648 Ga0373946_0166218
649 Ga0373931_0025715
650 Ga0373931_0039449
651 Ga0373931_0377373
652 Ga0373937_0065726
653 Ga0373925_0113550
654 Ga0373925_0276456
655 Ga0395899_0120607
656 Ga0395905_0001560
657 Ga0395905_0149608
658 Ga0395905_0430109
659 Ga0395901_0040951
660 Ga0436361_0194657
661 Ga0436361_0313405
662 Ga0436361_0374925
663 Ga0436361_0412068
664 Ga0436361_0414241
665 Ga0436361_0450257
666 Ga0436361_0451283
667 Ga0436361_0595153
668 Ga0439465_0063038
669 Ga0451849_0258522
670 Ga0451853_2456410
671 Ga0450894_019120
672 Ga0450899_032678
673 Ga0450906_017210
674 Ga0439446_0067691
675 Ga0439434_0065051
676 Ga0450893_0039140
677 Ga0450893_0112204
678 Ga0451577_0001772
679 Ga0451577_0338251
680 Ga0466969_0020716
681 Ga0466969_0021680
682 Ga0466972_0001178
683 Ga0466972_0107765
684 Ga0453683_0348774
685 Ga0453683_0423549
686 Ga0466965_0012765
687 Ga0466965_0028560
688 Ga0466965_0112277
689 Ga0466966_0004241
690 Ga0466966_0005876
691 Ga0466961_0032768
692 Ga0466961_0137150
693 Ga0466961_0223356
694 Ga0466963_0081694
695 Ga0466964_0001646
696 Ga0453684_0006975
697 Ga0453684_0097276
698 Ga0453684_0639635
699 Ga0453684_0743302
700 Ga0453684_0891234
701 Ga0466971_0013726
702 Ga0466971_0069005
703 Ga0466971_0095766
704 Ga0466970_0071563
705 Ga0466957_0011036
706 Ga0466957_0147054
707 Ga0466960_0078767
708 Ga0466960_0823420
709 Ga0466959_0003818
710 Ga0466959_0013162
711 Ga0451576_0010372
712 Ga0451576_0577190
713 Ga0451576_1015642
714 Ga0451576_1658591
715 Ga0466958_0226403
716 Ga0466967_0233916
717 Ga0495592_0000222
718 Ga0495650_0017208
719 Ga0495650_0050164
720 Ga0495639_0019675
721 Ga0495585_0007178
722 Ga0495583_0000927
723 Ga0495606_0003050
724 Ga0495606_0119520
725 Ga0495632_0094032
726 Ga0495648_0345217
727 Ga0495666_0030223
728 Ga0495598_0105650
729 Ga0495621_0004457
730 Ga0495597_0224920
731 Ga0495668_0020218
732 Ga0495668_0027429
733 Ga0495625_0021054
734 Ga0495625_0448021
735 Ga0495671_0128239
736 Ga0495649_0000464
737 Ga0495649_0247596
738 Ga0495589_0008473
739 Ga0495676_0563441
740 Ga0495673_0322962
741 Ga0495686_0040532
742 Ga0495614_0178783
743 Ga0496100_0547768
744 Ga0496101_0754921
745 Ga0496102_0019722
746 Ga0496105_0878200
747 Ga0496106_0109255
748 Ga0496108_0213162
749 Ga0496109_0731541
750 Ga0496110_0309520
751 Ga0496111_0119223
752 Ga0496113_0727296
753 Ga0496114_1148136
754 Ga0496126_0396798
755 Ga0495682_0113046
756 Ga0501199_010115
757 Ga0501265_021572
758 nmdc:mga03683_484016_c1
759 nmdc:mga03683_576286_c1
760 nmdc:mga03683_6923_c2
761 nmdc:mga0k408_1301_c1
762 nmdc:mga0k408_17227_c1
763 nmdc:mga0k408_206442_c1
764 nmdc:mga0k408_240911_c1
765 nmdc:mga0k408_251808_c1
766 nmdc:mga0k408_27156_c2
767 nmdc:mga0k408_46815_c1
768 nmdc:mga0k408_74736_c1
769 nmdc:mga0k408_75899_c1
770 nmdc:mga04h51_106870_c1
771 nmdc:mga07m45_130639_c1
772 nmdc:mga07m45_206706_c1
773 nmdc:mga07m45_29245_c1
774 nmdc:mga07m45_44384_c1
775 nmdc:mga07m45_80410_c1
776 nmdc:mga07m45_86384_c1
777 nmdc:mga05p37_107600_c1
778 nmdc:mga08y16_1317791_c1
779 nmdc:mga0sz30_101057_c1
780 nmdc:mga0sz30_361653_c1
781 Ga0500635_0000017
782 Ga0500635_0208778
783 Ga0495619_0529885
784 Ga0500578_0134624
785 Ga0500644_0026430
786 Ga0500583_0043904
787 Ga0500583_0318359
788 Ga0500651_0061013
789 Ga0500651_0072371
790 Ga0500651_0130468
791 Ga0500594_0000988
792 Ga0500608_192470
793 Ga0500621_082647
794 Ga0500652_151546
795 Ga0500655_004929
796 Ga0500559_0000011
797 Ga0500559_0012833
798 Ga0500559_0082781
799 Ga0500564_140127
800 Ga0500577_0140175
801 Ga0500616_0093951
802 Ga0500619_017810
803 Ga0500620_077217
804 Ga0500622_0002322
805 Ga0500636_0011321
806 Ga0500636_0219418
807 Ga0500599_039107
808 Ga0500587_002239
809 Ga0466962_0002081
810 Ga0466962_0017214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

9

50

0.99

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

9

56

0.98

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

76

148

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fx0-assembly1.cif.gz_A crystal structure of m. tuberculosis transcriptional regulator mosr 0.9263 36 81
1u2w-assembly2.cif.gz_D crystal structure of the staphylococcus aureus pi258 cadc 0.9243 37 76
1lnw-assembly4.cif.gz_G crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa 0.924 35 83
5x7z-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with p-aminosalicylic acid 0.9165 36 83
4rgx-assembly1.cif.gz_B-2 crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid 0.9145 36 83
ID Description Score Start End Superfamily
2cfxF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9489 34 83 1.10.10.10
2ia0A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9488 35 81 1.10.10.10
2cfxE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.948 34 83 1.10.10.10
af_A4HZ77_361_438_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9457 39 83 1.10.10.10
2cfxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9455 34 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6P1B4N1-F1-model_v4 deleted 0.9465 100 173
AF-A0A6P1B4N1-F1-model_v4 deleted 0.8998 100 173
AF-A0A2A4LLI5-F1-model_v4 Transcription regulator AsnC/Lrp ligand binding domain-containing protein 0.898 97 173
AF-A0A3C0PLW3-F1-model_v4 AsnC family transcriptional regulator 0.8933 98 174 GO:0005829
GO:0043200
GO:0043565
AF-A0A3M1JNE7-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.8925 96 171

Map