F435746

General Info

Members Datasets Scaffolds Average Seq Length
404 267 381 196

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0392876|Ga0466967_0392876_386_1039
Length 217
Sequence MVYASSPDPGRGQGPDAGRRAPGARPAAPRTSVKIVVAGGFGVGKTTLVEAISEIPAVNTEAWMTQAARTVDPLADAGGKTTTTVAMDFGRVTLASDLVLYLFGTPGQPRFWPMWDDLCRGASGALVLVDTRRLDVSFAAVNYFENDSDVPFIVAVNLFDGRQTHTLEQVAEALRLDPGVPVVACDARDRGSVVGTLTATLGHTLDRTAGLGGVASR

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2671180195 Frankia sp. CcI49 Isolate Nodule
5 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
6 2687453737 Frankia sp. BMG5.36 Isolate Nodule
7 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
8 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
9 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
10 2773857922 Frankia sp. CcI49 Isolate Nodule
11 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
12 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
13 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
14 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
15 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
16 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
17 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
18 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
19 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
151 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 8002775197 Frankia nepalensis CN7 Isolate Nodule
265 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
266 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
267 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 1.73
Isolates 5.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 1.73
Rhizoplane 7.43
Rhizosphere 81.19
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10048066 3300001989 Bacteria 1389
2 JGI24737J22298_10048134 3300001990 Bacteria 1298
3 JGI24737J22298_10063229 3300001990 Bacteria 1111
4 JGI24735J21928_10105930 3300002067 Bacteria 808
5 JGI24745J21846_1012350 3300002073 Bacteria 979
6 JGI25406J46586_10002608 3300003203 Bacteria 8496
7 Ga0070658_10096598 3300005327 Bacteria 2439
8 Ga0070658_10662521 3300005327 Bacteria 906
9 Ga0070683_100078499 3300005329 Bacteria 3088
10 Ga0070683_100144083 3300005329 Bacteria 2257
11 Ga0070683_100255347 3300005329 Bacteria 1667
12 Ga0070670_100411660 3300005331 Bacteria 1195
13 Ga0068869_100021289 3300005334 Bacteria 4459
14 Ga0068869_100139641 3300005334 Bacteria 1870
15 Ga0070680_100033412 3300005336 Bacteria 4146
16 Ga0070680_100274861 3300005336 Bacteria 1427
17 Ga0070682_100077293 3300005337 Bacteria 2144
18 Ga0070682_100115987 3300005337 Bacteria 1791
19 Ga0068868_100022630 3300005338 Bacteria 4747
20 Ga0070660_100574761 3300005339 Bacteria 941
21 Ga0070691_10183676 3300005341 Bacteria 1090
22 Ga0070661_100393122 3300005344 Bacteria 1095
23 Ga0070692_10126469 3300005345 Bacteria 1432
24 Ga0070669_100124658 3300005353 Bacteria 1970
25 Ga0070673_100085602 3300005364 Bacteria 2566
26 Ga0070688_100165220 3300005365 Bacteria 1523
27 Ga0070659_100102711 3300005366 Bacteria 2302
28 Ga0070667_100340860 3300005367 Bacteria 1355
29 Ga0070709_10030578 3300005434 Bacteria 3232
30 Ga0070714_100006484 3300005435 Bacteria 9043
31 Ga0070714_100085493 3300005435 Bacteria 2755
32 Ga0070713_100003156 3300005436 Bacteria 10849
33 Ga0070713_100571872 3300005436 Bacteria 1072
34 Ga0070713_100651028 3300005436 Bacteria 1003
35 Ga0070713_100666635 3300005436 Bacteria 991
36 Ga0070663_100007830 3300005455 Bacteria 6533
37 Ga0070663_100029927 3300005455 Bacteria 3726
38 Ga0070662_100305970 3300005457 Bacteria 1293
39 Ga0070681_10353984 3300005458 Bacteria 1378
40 Ga0068867_100054425 3300005459 Bacteria 2956
41 Ga0070679_100009721 3300005530 Bacteria 9098
42 Ga0070679_100125631 3300005530 Bacteria 2547
43 Ga0070684_100099296 3300005535 Bacteria 2598
44 Ga0070684_100360954 3300005535 Bacteria 1337
45 Ga0070684_100478413 3300005535 Bacteria 1152
46 Ga0068853_100128809 3300005539 Bacteria 2264
47 Ga0068853_101472031 3300005539 Bacteria 659
48 Ga0070672_100363986 3300005543 Bacteria 1235
49 Ga0070686_100044871 3300005544 Bacteria 2781
50 Ga0070665_100078671 3300005548 Bacteria 3304
51 Ga0070665_100086729 3300005548 Bacteria 3136
52 Ga0070665_100143000 3300005548 Bacteria 2395
53 Ga0070665_100251214 3300005548 Bacteria 1769
54 Ga0068855_100002257 3300005563 Bacteria 23802
55 Ga0068857_100049739 3300005577 Bacteria 3719
56 Ga0068857_100102424 3300005577 Bacteria 2570
57 Ga0068854_100003083 3300005578 Bacteria 10378
58 Ga0068854_100011904 3300005578 Bacteria 5684
59 Ga0068854_100224592 3300005578 Bacteria 1487
60 Ga0068856_100021934 3300005614 Bacteria 6208
61 Ga0068856_100356064 3300005614 Bacteria 1482
62 Ga0070702_100052626 3300005615 Bacteria 2335
63 Ga0068852_100031952 3300005616 Bacteria 4353
64 Ga0068852_100064934 3300005616 Bacteria 3183
65 Ga0068852_100860342 3300005616 Bacteria 922
66 Ga0068859_100012910 3300005617 Bacteria 8391
67 Ga0068859_100043138 3300005617 Bacteria 4533
68 Ga0068864_100026900 3300005618 Bacteria 4852
69 Ga0068866_10005193 3300005718 Bacteria 5363
70 Ga0068861_100264167 3300005719 Bacteria 1475
71 Ga0068851_10283091 3300005834 Bacteria 949
72 Ga0068863_100010729 3300005841 Bacteria 8894
73 Ga0068858_100543496 3300005842 Bacteria 1124
74 Ga0068860_100488755 3300005843 Bacteria 1227
75 Ga0068862_100000337 3300005844 Bacteria 51008
76 Ga0068862_100201307 3300005844 Bacteria 1795
77 Ga0081455_10124125 3300005937 Bacteria 2029
78 Ga0081539_10001378 3300005985 Bacteria 42067
79 Ga0081539_10148358 3300005985 Bacteria 1131
80 Ga0070717_10425568 3300006028 Bacteria 1195
81 Ga0070712_100841421 3300006175 Bacteria 789
82 Ga0097621_100203247 3300006237 Bacteria 1721
83 Ga0097620_100012909 3300006931 Bacteria 8391
84 Ga0105240_10061637 3300009093 Bacteria 4674
85 Ga0111539_10223576 3300009094 Bacteria 2192
86 Ga0111539_11946054 3300009094 Bacteria 682
87 Ga0105245_10018853 3300009098 Bacteria 6038
88 Ga0105245_10092929 3300009098 Bacteria 2779
89 Ga0105243_10563958 3300009148 Bacteria 1090
90 Ga0105241_10003503 3300009174 Bacteria 11673
91 Ga0105241_10004168 3300009174 Bacteria 10674
92 Ga0105241_10618765 3300009174 Bacteria 980
93 Ga0105242_11591589 3300009176 Bacteria 687
94 Ga0105237_10013756 3300009545 Bacteria 8473
95 Ga0105237_10016477 3300009545 Bacteria 7677
96 Ga0105237_10351730 3300009545 Bacteria 1478
97 Ga0105237_10902174 3300009545 Bacteria 891
98 Ga0105238_10002336 3300009551 Bacteria 19078
99 Ga0105238_10034820 3300009551 Bacteria 5122
100 Ga0105238_10198868 3300009551 Bacteria 1980
101 Ga0105249_10077841 3300009553 Bacteria 3076
102 Ga0105239_10020841 3300010375 Bacteria 7231
103 Ga0105239_10218672 3300010375 Bacteria 2136
104 Ga0105239_10507868 3300010375 Bacteria 1371
105 Ga0105239_10793098 3300010375 Bacteria 1085
106 Ga0157370_10012112 3300013104 Bacteria 8971
107 Ga0157369_10232037 3300013105 Bacteria 1929
108 Ga0157374_10047076 3300013296 Bacteria 3997
109 Ga0157374_10248005 3300013296 Bacteria 1752
110 Ga0157374_10249998 3300013296 Bacteria 1745
111 Ga0163162_10343990 3300013306 Bacteria 1624
112 Ga0157372_10100217 3300013307 Bacteria 3305
113 Ga0157372_10848105 3300013307 Bacteria 1061
114 Ga0157375_10735353 3300013308 Bacteria 1139
115 Ga0163163_10052021 3300014325 Bacteria 4039
116 Ga0163163_10236072 3300014325 Bacteria 1878
117 Ga0157380_10192877 3300014326 Bacteria 1800
118 Ga0157377_10193235 3300014745 Bacteria 1287
119 Ga0157379_10067044 3300014968 Bacteria 3209
120 Ga0157379_10749028 3300014968 Bacteria 919
121 Ga0197907_10297500 3300020069 Bacteria 1409
122 Ga0206356_10222281 3300020070 Bacteria 2524
123 Ga0206356_11536716 3300020070 Bacteria 2219
124 Ga0206354_10990128 3300020081 Bacteria 1064
125 Ga0206353_10204930 3300020082 Bacteria 1891
126 Ga0206353_10646142 3300020082 Bacteria 1417
127 Ga0213875_10000204 3300021388 Bacteria 60760
128 Ga0224712_10007517 3300022467 Bacteria 3177
129 Ga0207642_10044584 3300025899 Bacteria 1964
130 Ga0207688_10041401 3300025901 Bacteria 2562
131 Ga0207680_10135337 3300025903 Bacteria 1628
132 Ga0207647_10003175 3300025904 Bacteria 12334
133 Ga0207647_10005939 3300025904 Bacteria 8901
134 Ga0207647_10150147 3300025904 Bacteria 1362
135 Ga0207699_10084212 3300025906 Bacteria 1980
136 Ga0207705_10026893 3300025909 Bacteria 4100
137 Ga0207654_10033798 3300025911 Bacteria 2837
138 Ga0207654_10199269 3300025911 Bacteria 1317
139 Ga0207707_10094086 3300025912 Bacteria 2618
140 Ga0207695_10006773 3300025913 Bacteria 14773
141 Ga0207695_10022530 3300025913 Bacteria 7147
142 Ga0207671_10000666 3300025914 Bacteria 44894
143 Ga0207671_10001245 3300025914 Bacteria 30022
144 Ga0207660_10014557 3300025917 Bacteria 5176
145 Ga0207660_10212803 3300025917 Bacteria 1514
146 Ga0207657_10365001 3300025919 Bacteria 1138
147 Ga0207652_10004208 3300025921 Bacteria 11748
148 Ga0207652_10256513 3300025921 Bacteria 1577
149 Ga0207681_10075916 3300025923 Bacteria 2359
150 Ga0207681_10396984 3300025923 Bacteria 1113
151 Ga0207694_10002582 3300025924 Bacteria 14684
152 Ga0207694_10010042 3300025924 Bacteria 7135
153 Ga0207659_10104171 3300025926 Bacteria 2145
154 Ga0207687_10020433 3300025927 Bacteria 4392
155 Ga0207700_10043443 3300025928 Bacteria 3301
156 Ga0207700_10114156 3300025928 Bacteria 2179
157 Ga0207700_10114195 3300025928 Bacteria 2179
158 Ga0207700_10145965 3300025928 Bacteria 1950
159 Ga0207700_10665001 3300025928 Bacteria 929
160 Ga0207664_10050442 3300025929 Bacteria 3282
161 Ga0207664_10102321 3300025929 Bacteria 2368
162 Ga0207664_10242430 3300025929 Bacteria 1570
163 Ga0207690_10162408 3300025932 Bacteria 1666
164 Ga0207690_10345369 3300025932 Bacteria 1175
165 Ga0207690_10345562 3300025932 Bacteria 1175
166 Ga0207706_10101993 3300025933 Bacteria 2525
167 Ga0207704_10623489 3300025938 Bacteria 885
168 Ga0207691_10223263 3300025940 Bacteria 1633
169 Ga0207689_10021795 3300025942 Bacteria 5387
170 Ga0207661_10099196 3300025944 Bacteria 2442
171 Ga0207661_10111258 3300025944 Bacteria 2317
172 Ga0207661_10493092 3300025944 Bacteria 1119
173 Ga0207667_10084682 3300025949 Bacteria 3282
174 Ga0207667_10091828 3300025949 Bacteria 3136
175 Ga0207712_10143895 3300025961 Bacteria 1833
176 Ga0207640_10010265 3300025981 Bacteria 5269
177 Ga0207640_10014998 3300025981 Bacteria 4474
178 Ga0207658_10004559 3300025986 Bacteria 9611
179 Ga0207658_10711465 3300025986 Bacteria 908
180 Ga0207703_10045814 3300026035 Bacteria 3519
181 Ga0207703_10423742 3300026035 Bacteria 1239
182 Ga0207639_10033757 3300026041 Bacteria 3777
183 Ga0207639_10216022 3300026041 Bacteria 1653
184 Ga0207678_10006493 3300026067 Bacteria 10380
185 Ga0207678_10014807 3300026067 Bacteria 6862
186 Ga0207678_10046933 3300026067 Bacteria 3736
187 Ga0207678_10142534 3300026067 Bacteria 2045
188 Ga0207678_10255239 3300026067 Bacteria 1502
189 Ga0207708_10223713 3300026075 Bacteria 1509
190 Ga0207702_10107771 3300026078 Bacteria 2471
191 Ga0207702_10147236 3300026078 Bacteria 2138
192 Ga0207702_10228483 3300026078 Bacteria 1738
193 Ga0207702_10984046 3300026078 Bacteria 837
194 Ga0207648_10048058 3300026089 Bacteria 3737
195 Ga0207676_10139180 3300026095 Bacteria 2075
196 Ga0207674_10014824 3300026116 Bacteria 8597
197 Ga0207674_10049110 3300026116 Bacteria 4317
198 Ga0207675_100080852 3300026118 Bacteria 3047
199 Ga0207698_10301962 3300026142 Bacteria 1490
200 Ga0268266_10022863 3300028379 Bacteria 5321
201 Ga0268266_10054811 3300028379 Bacteria 3427
202 Ga0268266_10153286 3300028379 Bacteria 2079
203 Ga0268265_10000057 3300028380 Bacteria 155346
204 Ga0268265_10038386 3300028380 Bacteria 3523
205 Ga0268264_10457659 3300028381 Bacteria 1237
206 Ga0265337_1000724 3300028556 Bacteria 17359
207 Ga0265326_10000766 3300028558 Bacteria 11914
208 Ga0265319_1000344 3300028563 Bacteria 34100
209 Ga0265334_10000169 3300028573 Bacteria 39242
210 Ga0265323_10015591 3300028653 Bacteria 2986
211 Ga0265338_10001043 3300028800 Bacteria 46320
212 Ga0265338_10003552 3300028800 Bacteria 21794
213 Ga0265338_10025091 3300028800 Bacteria 6065
214 Ga0265324_10001071 3300029957 Bacteria 16485
215 Ga0307512_10073283 3300030522 Bacteria 2524
216 Ga0316181_1098672 3300030744 Bacteria 2055
217 Ga0265332_10000552 3300031238 Bacteria 25311
218 Ga0265320_10000904 3300031240 Bacteria 22273
219 Ga0265325_10001947 3300031241 Bacteria 14242
220 Ga0265340_10006823 3300031247 Bacteria 6247
221 Ga0265316_10029134 3300031344 Bacteria 4544
222 Ga0307513_10069726 3300031456 Bacteria 3678
223 Ga0265313_10011900 3300031595 Bacteria 5370
224 Ga0265314_10074529 3300031711 Bacteria 2260
225 Ga0265342_10004560 3300031712 Bacteria 10837
226 Ga0307405_10007908 3300031731 Bacteria 5358
227 Ga0307405_10278990 3300031731 Bacteria 1257
228 Ga0307413_10201841 3300031824 Bacteria 1437
229 Ga0307413_10227776 3300031824 Bacteria 1366
230 Ga0307410_10042319 3300031852 Bacteria 3010
231 Ga0307407_10163504 3300031903 Bacteria 1459
232 Ga0307412_10646975 3300031911 Bacteria 901
233 Ga0307409_100024767 3300031995 Bacteria 4193
234 Ga0307409_100277396 3300031995 Bacteria 1547
235 Ga0307409_100748021 3300031995 Bacteria 981
236 Ga0307416_100119124 3300032002 Bacteria 2348
237 Ga0307416_100403912 3300032002 Bacteria 1405
238 Ga0307414_10368621 3300032004 Bacteria 1238
239 Ga0307507_10030660 3300033179 Bacteria 5663
240 Ga0307507_10133450 3300033179 Bacteria 1933
241 Ga0307507_10231093 3300033179 Bacteria 1226
242 Ga0373926_0002542 3300035083 Bacteria 5797
243 Ga0373946_0170847 3300035171 Bacteria 1026
244 Ga0373935_0000832 3300035692 Bacteria 16609
245 Ga0373947_0000002 3300035725 Bacteria 383924
246 Ga0373925_0000237 3300037068 Bacteria 58351
247 Ga0373925_0252213 3300037068 Bacteria 1415
248 Ga0436364_0232790 3300037853 Bacteria 45876
249 Ga0395901_0099270 3300038443 Bacteria 3053
250 Ga0395901_0112842 3300038443 Bacteria 2854
251 Ga0451802_0832920 3300041460 Bacteria 1265
252 Ga0451837_1540203 3300041494 Bacteria 841
253 Ga0451843_0089849 3300041509 Bacteria 2379
254 Ga0466969_0022174 3300044656 Bacteria 3280
255 Ga0466972_0309299 3300044658 Bacteria 738
256 Ga0466965_0106881 3300044683 Bacteria 1436
257 Ga0466965_0176043 3300044683 Bacteria 1127
258 Ga0466966_0000168 3300044684 Bacteria 43039
259 Ga0466961_0133115 3300044693 Bacteria 1558
260 Ga0466961_0220536 3300044693 Bacteria 1169
261 Ga0466963_0030122 3300044694 Bacteria 3499
262 Ga0466971_0016695 3300044719 Bacteria 3243
263 Ga0466968_0034983 3300044735 Bacteria 2100
264 Ga0466970_0003133 3300044765 Bacteria 8036
265 Ga0466970_0123953 3300044765 Bacteria 1416
266 Ga0466970_0427674 3300044765 Bacteria 757
267 Ga0466957_0001221 3300044842 Bacteria 13404
268 Ga0466959_0002276 3300045049 Bacteria 12244
269 Ga0466958_0005413 3300045836 Bacteria 6865
270 Ga0466958_0306200 3300045836 Bacteria 1020
271 Ga0466967_0287996 3300045976 Bacteria 1577
272 Ga0466967_0392876 3300045976 Bacteria 1348
273 Ga0466967_0557607 3300045976 Bacteria 1128
274 Ga0466967_0909363 3300045976 Bacteria 875
275 Ga0495592_0369689 3300046454 Bacteria 915
276 Ga0495651_0000122 3300046462 Bacteria 57344
277 Ga0495651_0003361 3300046462 Bacteria 12278
278 Ga0495651_0187914 3300046462 Bacteria 1456
279 Ga0495651_0588130 3300046462 Bacteria 703
280 Ga0495628_0042558 3300046516 Bacteria 3622
281 Ga0495652_0003273 3300046529 Bacteria 16134
282 Ga0495652_0004906 3300046529 Bacteria 12690
283 Ga0495645_0465499 3300046543 Bacteria 795
284 Ga0495622_0040330 3300046557 Bacteria 2173
285 Ga0495657_0030374 3300046675 Bacteria 3785
286 Ga0495600_0022017 3300046809 Bacteria 4089
287 Ga0495600_0052645 3300046809 Bacteria 2658
288 Ga0495604_0137004 3300047317 Bacteria 1753
289 Ga0495680_0089152 3300047322 Bacteria 2316
290 Ga0495675_0068015 3300047444 Bacteria 2251
291 Ga0496100_0000225 3300048903 Bacteria 30548
292 Ga0496100_0079311 3300048903 Bacteria 2212
293 Ga0496101_0000118 3300048904 Bacteria 77684
294 Ga0496101_0032683 3300048904 Bacteria 3665
295 Ga0496102_0002661 3300048905 Bacteria 15200
296 Ga0496102_0027469 3300048905 Bacteria 5082
297 Ga0496102_0107636 3300048905 Bacteria 2596
298 Ga0496103_0003979 3300048906 Bacteria 8973
299 Ga0496103_0010087 3300048906 Bacteria 5585
300 Ga0496104_0070051 3300048907 Bacteria 3334
301 Ga0496107_0000106 3300048910 Bacteria 40710
302 Ga0496107_0536938 3300048910 Bacteria 867
303 Ga0496108_0000157 3300048911 Bacteria 64803
304 Ga0496108_0005477 3300048911 Bacteria 10264
305 Ga0496108_0139537 3300048911 Bacteria 2088
306 Ga0496109_0000077 3300048912 Bacteria 103492
307 Ga0496109_0719927 3300048912 Bacteria 935
308 Ga0496109_1230668 3300048912 Bacteria 685
309 Ga0496110_0000645 3300048913 Bacteria 23879
310 Ga0496110_0516771 3300048913 Bacteria 1086
311 Ga0496111_0000485 3300048914 Bacteria 20417
312 Ga0496111_0300802 3300048914 Bacteria 1189
313 Ga0496112_0427457 3300048915 Bacteria 1263
314 Ga0496112_1005510 3300048915 Bacteria 754
315 Ga0496113_0085985 3300048916 Bacteria 2416
316 Ga0496114_0000880 3300048917 Bacteria 22492
317 Ga0496114_0388835 3300048917 Bacteria 1235
318 Ga0496115_0006185 3300048918 Bacteria 8757
319 Ga0496115_0533487 3300048918 Bacteria 940
320 Ga0496116_0010526 3300048919 Bacteria 7735
321 Ga0496117_0038502 3300048920 Bacteria 3543
322 Ga0496118_0020141 3300048921 Bacteria 5928
323 Ga0496119_0002123 3300048922 Bacteria 22312
324 Ga0496120_0040545 3300048923 Bacteria 2735
325 Ga0496121_0000002 3300048924 Bacteria 1494588
326 Ga0496122_0000051 3300048925 Bacteria 265104
327 Ga0496123_0013856 3300048926 Bacteria 6726
328 Ga0496124_0000002 3300048927 Bacteria 1494588
329 Ga0496125_0000002 3300048928 Bacteria 1480920
330 Ga0496126_0000011 3300048929 Bacteria 744275
331 Ga0496126_0018314 3300048929 Bacteria 6945
332 Ga0496126_0084178 3300048929 Bacteria 2805
333 Ga0501031_0023300 3300049568 Bacteria 4037
334 Ga0501031_0062734 3300049568 Bacteria 2422
335 Ga0501031_0598915 3300049568 Bacteria 709
336 Ga0501032_0052722 3300049569 Bacteria 2741
337 Ga0501033_0057188 3300049570 Bacteria 2883
338 Ga0501034_0156641 3300049571 Bacteria 2251
339 Ga0501036_0003842 3300049572 Bacteria 12048
340 Ga0501036_0193044 3300049572 Bacteria 1713
341 Ga0501037_0076312 3300049573 Bacteria 2433
342 Ga0501037_0085874 3300049573 Bacteria 2278
343 Ga0501038_0010696 3300049574 Bacteria 8391
344 Ga0501039_0000717 3300049575 Bacteria 23864
345 Ga0501039_0209083 3300049575 Bacteria 1534
346 Ga0501039_0633535 3300049575 Bacteria 837
347 Ga0501040_0013400 3300049576 Bacteria 5388
348 Ga0501041_0027410 3300049577 Bacteria 3432
349 Ga0501043_0686732 3300049579 Bacteria 749
350 Ga0501046_0042031 3300049580 Bacteria 3645
351 Ga0501047_0029184 3300049581 Bacteria 5320
352 Ga0501047_0065254 3300049581 Bacteria 3509
353 Ga0501048_0044768 3300049582 Bacteria 3162
354 Ga0501048_0208857 3300049582 Bacteria 1385
355 Ga0501069_0077151 3300049585 Bacteria 1874
356 Ga0501071_0001787 3300049587 Bacteria 12693
357 Ga0501073_0206314 3300049589 Bacteria 1358
358 Ga0501074_0016898 3300049590 Bacteria 5294
359 Ga0501075_0000388 3300049591 Bacteria 25410
360 Ga0501075_0344419 3300049591 Bacteria 1136
361 Ga0501076_0013718 3300049592 Bacteria 6080
362 Ga0501076_0161428 3300049592 Bacteria 1826
363 Ga0501079_0033130 3300049741 Bacteria 3973
364 Ga0501081_0059326 3300049743 Bacteria 2648
365 Ga0501035_0109792 3300049822 Bacteria 2418
366 Ga0501045_0009408 3300049824 Bacteria 6834
367 nmdc:mga00v17_213389_c1 3300050491 Bacteria 1249
368 nmdc:mga07m45_362222_c1 3300050496 Bacteria 842
369 nmdc:mga06r32_201213_c1 3300050510 Bacteria 1979
370 nmdc:mga08x19_567976_c1 3300050514 Bacteria 803
371 Ga0495601_0066887 3300053077 Bacteria 2288
372 Ga0495601_0102643 3300053077 Bacteria 1848
373 Ga0495612_0030343 3300053078 Bacteria 2177
374 Ga0495619_0043777 3300053085 Bacteria 2936
375 Ga0495619_0198556 3300053085 Bacteria 1389
376 Ga0500644_0015388 3300053088 Bacteria 2180
377 Ga0500644_0191575 3300053088 Bacteria 842
378 Ga0501084_0014115 3300054114 Bacteria 6616
379 Ga0501084_0423587 3300054114 Bacteria 1125
380 Ga0466962_0004994 3300061719 Bacteria 6380
381 Ga0530510_0026476 3300061734 Bacteria 4151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_201213_c1 nmdc:mga06r32_201213_c1_15_557 172
2 iso_pu_bacteria 2687453743 2689994481 178
3 3300033179 Ga0307507_10030660 Ga0307507_100306603 179
4 iso_pu_bacteria 2687453737 2689961575 179
5 3300041460 Ga0451802_0832920 Ga0451802_0832920_169_735 180
6 3300048912 Ga0496109_1230668 Ga0496109_1230668_117_674 180
7 iso_pu_bacteria 2684623035 2686536192 180
8 iso_pu_bacteria 2773857762 2774396418 180
9 iso_pu_bacteria 2808606439 2809198075 180
10 iso_pu_bacteria 2811994878 2812353235 180
11 iso_pu_bacteria 2891968417 2891969137 180
12 iso_pu_bacteria 2895880812 2895886807 180
13 3300048918 Ga0496115_0533487 Ga0496115_0533487_161_715 181
14 iso_pu_bacteria 2671180195 2671832511 181
15 iso_pu_bacteria 2773857922 2774850667 181
16 iso_pu_bacteria 2837183177 2837187413 181
17 iso_pu_bacteria 2891326441 2891329574 181
18 3300046675 Ga0495657_0030374 Ga0495657_0030374_2852_3448 182
19 3300053088 Ga0500644_0015388 Ga0500644_0015388_899_1495 182
20 3300009094 Ga0111539_11946054 Ga0111539_119460541 183
21 3300030744 Ga0316181_1098672 Ga0316181_10986724 183
22 3300031824 Ga0307413_10227776 Ga0307413_102277763 183
23 3300031903 Ga0307407_10163504 Ga0307407_101635042 183
24 3300031995 Ga0307409_100277396 Ga0307409_1002773962 183
25 3300032004 Ga0307414_10368621 Ga0307414_103686212 183
26 3300045976 Ga0466967_0909363 Ga0466967_0909363_271_843 183
27 3300053088 Ga0500644_0191575 Ga0500644_0191575_18_608 183
28 iso_pu_bacteria 2861520306 2861525924 183
29 3300003203 JGI25406J46586_10002608 JGI25406J46586_100026083 184
30 3300005329 Ga0070683_100078499 Ga0070683_1000784992 184
31 3300005329 Ga0070683_100255347 Ga0070683_1002553473 184
32 3300005336 Ga0070680_100033412 Ga0070680_1000334124 184
33 3300005337 Ga0070682_100077293 Ga0070682_1000772932 184
34 3300005339 Ga0070660_100574761 Ga0070660_1005747611 184
35 3300005366 Ga0070659_100102711 Ga0070659_1001027114 184
36 3300005434 Ga0070709_10030578 Ga0070709_100305784 184
37 3300005435 Ga0070714_100006484 Ga0070714_1000064845 184
38 3300005435 Ga0070714_100085493 Ga0070714_1000854934 184
39 3300005436 Ga0070713_100003156 Ga0070713_1000031564 184
40 3300005436 Ga0070713_100571872 Ga0070713_1005718722 184
41 3300005436 Ga0070713_100651028 Ga0070713_1006510282 184
42 3300005436 Ga0070713_100666635 Ga0070713_1006666352 184
43 3300005455 Ga0070663_100007830 Ga0070663_1000078304 184
44 3300005457 Ga0070662_100305970 Ga0070662_1003059702 184
45 3300005458 Ga0070681_10353984 Ga0070681_103539843 184
46 3300005530 Ga0070679_100009721 Ga0070679_1000097215 184
47 3300005530 Ga0070679_100125631 Ga0070679_1001256311 184
48 3300005535 Ga0070684_100099296 Ga0070684_1000992961 184
49 3300005539 Ga0068853_101472031 Ga0068853_1014720311 184
50 3300005548 Ga0070665_100078671 Ga0070665_1000786712 184
51 3300005577 Ga0068857_100102424 Ga0068857_1001024241 184
52 3300005985 Ga0081539_10001378 Ga0081539_1000137816 184
53 3300005985 Ga0081539_10148358 Ga0081539_101483581 184
54 3300006028 Ga0070717_10425568 Ga0070717_104255681 184
55 3300006175 Ga0070712_100841421 Ga0070712_1008414212 184
56 3300009148 Ga0105243_10563958 Ga0105243_105639582 184
57 3300010375 Ga0105239_10507868 Ga0105239_105078682 184
58 3300013104 Ga0157370_10012112 Ga0157370_100121127 184
59 3300020069 Ga0197907_10297500 Ga0197907_102975003 184
60 3300020070 Ga0206356_10222281 Ga0206356_102222814 184
61 3300020081 Ga0206354_10990128 Ga0206354_109901282 184
62 3300020082 Ga0206353_10646142 Ga0206353_106461423 184
63 3300022467 Ga0224712_10007517 Ga0224712_100075174 184
64 3300025906 Ga0207699_10084212 Ga0207699_100842123 184
65 3300025909 Ga0207705_10026893 Ga0207705_100268934 184
66 3300025912 Ga0207707_10094086 Ga0207707_100940864 184
67 3300025917 Ga0207660_10014557 Ga0207660_100145574 184
68 3300025921 Ga0207652_10004208 Ga0207652_100042086 184
69 3300025921 Ga0207652_10256513 Ga0207652_102565132 184
70 3300025928 Ga0207700_10043443 Ga0207700_100434434 184
71 3300025928 Ga0207700_10114195 Ga0207700_101141954 184
72 3300025928 Ga0207700_10145965 Ga0207700_101459652 184
73 3300025929 Ga0207664_10050442 Ga0207664_100504422 184
74 3300025929 Ga0207664_10102321 Ga0207664_101023212 184
75 3300025929 Ga0207664_10242430 Ga0207664_102424302 184
76 3300025932 Ga0207690_10345369 Ga0207690_103453691 184
77 3300025944 Ga0207661_10099196 Ga0207661_100991961 184
78 3300025944 Ga0207661_10111258 Ga0207661_101112583 184
79 3300026035 Ga0207703_10423742 Ga0207703_104237422 184
80 3300026067 Ga0207678_10014807 Ga0207678_100148075 184
81 3300026116 Ga0207674_10049110 Ga0207674_100491104 184
82 3300028379 Ga0268266_10054811 Ga0268266_100548112 184
83 3300028556 Ga0265337_1000724 Ga0265337_10007244 184
84 3300028558 Ga0265326_10000766 Ga0265326_100007663 184
85 3300028563 Ga0265319_1000344 Ga0265319_100034419 184
86 3300028573 Ga0265334_10000169 Ga0265334_1000016941 184
87 3300028653 Ga0265323_10015591 Ga0265323_100155914 184
88 3300028800 Ga0265338_10001043 Ga0265338_1000104311 184
89 3300028800 Ga0265338_10003552 Ga0265338_1000355214 184
90 3300028800 Ga0265338_10025091 Ga0265338_100250916 184
91 3300029957 Ga0265324_10001071 Ga0265324_100010713 184
92 3300030522 Ga0307512_10073283 Ga0307512_100732834 184
93 3300031238 Ga0265332_10000552 Ga0265332_1000055229 184
94 3300031240 Ga0265320_10000904 Ga0265320_1000090424 184
95 3300031241 Ga0265325_10001947 Ga0265325_100019477 184
96 3300031247 Ga0265340_10006823 Ga0265340_100068235 184
97 3300031344 Ga0265316_10029134 Ga0265316_100291342 184
98 3300031595 Ga0265313_10011900 Ga0265313_100119004 184
99 3300031711 Ga0265314_10074529 Ga0265314_100745294 184
100 3300031712 Ga0265342_10004560 Ga0265342_100045605 184
101 3300037068 Ga0373925_0000237 Ga0373925_0000237_4247_4843 184
102 3300044694 Ga0466963_0030122 Ga0466963_0030122_907_1506 184
103 3300044735 Ga0466968_0034983 Ga0466968_0034983_1361_1960 184
104 3300045976 Ga0466967_0287996 Ga0466967_0287996_126_725 184
105 3300048929 Ga0496126_0018314 Ga0496126_0018314_1324_1920 184
106 3300048929 Ga0496126_0084178 Ga0496126_0084178_1310_1906 184
107 3300050514 nmdc:mga08x19_567976_c1 nmdc:mga08x19_567976_c1_33_632 184
108 iso_pu_bacteria 8047710418 8047717277 184
109 3300005327 Ga0070658_10662521 Ga0070658_106625212 185
110 3300005455 Ga0070663_100029927 Ga0070663_1000299273 185
111 3300005539 Ga0068853_100128809 Ga0068853_1001288092 185
112 3300005548 Ga0070665_100143000 Ga0070665_1001430002 185
113 3300005578 Ga0068854_100003083 Ga0068854_1000030837 185
114 3300009093 Ga0105240_10061637 Ga0105240_100616374 185
115 3300009174 Ga0105241_10004168 Ga0105241_100041684 185
116 3300009545 Ga0105237_10013756 Ga0105237_100137567 185
117 3300009545 Ga0105237_10902174 Ga0105237_109021742 185
118 3300009551 Ga0105238_10034820 Ga0105238_100348203 185
119 3300010375 Ga0105239_10020841 Ga0105239_100208413 185
120 3300013105 Ga0157369_10232037 Ga0157369_102320371 185
121 3300013296 Ga0157374_10047076 Ga0157374_100470763 185
122 3300020070 Ga0206356_11536716 Ga0206356_115367162 185
123 3300025904 Ga0207647_10003175 Ga0207647_1000317513 185
124 3300025911 Ga0207654_10199269 Ga0207654_101992691 185
125 3300025913 Ga0207695_10006773 Ga0207695_100067738 185
126 3300025914 Ga0207671_10001245 Ga0207671_100012458 185
127 3300025924 Ga0207694_10002582 Ga0207694_100025827 185
128 3300025928 Ga0207700_10665001 Ga0207700_106650012 185
129 3300025949 Ga0207667_10091828 Ga0207667_100918283 185
130 3300025981 Ga0207640_10014998 Ga0207640_100149984 185
131 3300026041 Ga0207639_10033757 Ga0207639_100337573 185
132 3300026067 Ga0207678_10046933 Ga0207678_100469333 185
133 3300028379 Ga0268266_10153286 Ga0268266_101532863 185
134 3300033179 Ga0307507_10133450 Ga0307507_101334502 185
135 3300037853 Ga0436364_0232790 Ga0436364_0232790_39498_40082 185
136 3300044656 Ga0466969_0022174 Ga0466969_0022174_92_676 185
137 3300044693 Ga0466961_0133115 Ga0466961_0133115_231_818 185
138 3300044765 Ga0466970_0003133 Ga0466970_0003133_4655_5242 185
139 3300044765 Ga0466970_0123953 Ga0466970_0123953_148_732 185
140 3300045836 Ga0466958_0306200 Ga0466958_0306200_388_972 185
141 3300046454 Ga0495592_0369689 Ga0495592_0369689_265_846 185
142 3300046462 Ga0495651_0000122 Ga0495651_0000122_25486_26073 185
143 3300046462 Ga0495651_0003361 Ga0495651_0003361_8861_9445 185
144 3300046462 Ga0495651_0187914 Ga0495651_0187914_415_1002 185
145 3300046516 Ga0495628_0042558 Ga0495628_0042558_1133_1720 185
146 3300046529 Ga0495652_0003273 Ga0495652_0003273_10138_10722 185
147 3300046529 Ga0495652_0004906 Ga0495652_0004906_2292_2879 185
148 3300046543 Ga0495645_0465499 Ga0495645_0465499_140_724 185
149 3300046557 Ga0495622_0040330 Ga0495622_0040330_24_611 185
150 3300046809 Ga0495600_0022017 Ga0495600_0022017_941_1528 185
151 3300046809 Ga0495600_0052645 Ga0495600_0052645_2045_2629 185
152 3300047317 Ga0495604_0137004 Ga0495604_0137004_303_878 185
153 3300047444 Ga0495675_0068015 Ga0495675_0068015_1263_1838 185
154 3300048911 Ga0496108_0000157 Ga0496108_0000157_6882_7463 185
155 3300053077 Ga0495601_0066887 Ga0495601_0066887_271_858 185
156 iso_pu_bacteria 2508501039 2508676158 185
157 iso_pu_bacteria 8002775197 8002777967 185
158 3300005548 Ga0070665_100086729 Ga0070665_1000867293 186
159 3300005563 Ga0068855_100002257 Ga0068855_1000022573 186
160 3300005578 Ga0068854_100011904 Ga0068854_1000119044 186
161 3300005614 Ga0068856_100021934 Ga0068856_1000219344 186
162 3300005616 Ga0068852_100064934 Ga0068852_1000649343 186
163 3300005937 Ga0081455_10124125 Ga0081455_101241253 186
164 3300009174 Ga0105241_10003503 Ga0105241_1000350311 186
165 3300009545 Ga0105237_10016477 Ga0105237_100164776 186
166 3300009551 Ga0105238_10002336 Ga0105238_100023363 186
167 3300013296 Ga0157374_10248005 Ga0157374_102480052 186
168 3300025904 Ga0207647_10005939 Ga0207647_100059394 186
169 3300025911 Ga0207654_10033798 Ga0207654_100337983 186
170 3300025913 Ga0207695_10022530 Ga0207695_100225303 186
171 3300025914 Ga0207671_10000666 Ga0207671_1000066639 186
172 3300025924 Ga0207694_10010042 Ga0207694_100100426 186
173 3300025949 Ga0207667_10084682 Ga0207667_100846823 186
174 3300025981 Ga0207640_10010265 Ga0207640_100102653 186
175 3300026067 Ga0207678_10255239 Ga0207678_102552392 186
176 3300026078 Ga0207702_10107771 Ga0207702_101077713 186
177 3300026142 Ga0207698_10301962 Ga0207698_103019623 186
178 3300033179 Ga0307507_10231093 Ga0307507_102310932 186
179 3300046462 Ga0495651_0588130 Ga0495651_0588130_91_672 186
180 3300048910 Ga0496107_0536938 Ga0496107_0536938_84_662 186
181 3300049568 Ga0501031_0062734 Ga0501031_0062734_419_997 186
182 3300049571 Ga0501034_0156641 Ga0501034_0156641_832_1410 186
183 3300049572 Ga0501036_0193044 Ga0501036_0193044_859_1437 186
184 3300049573 Ga0501037_0085874 Ga0501037_0085874_1006_1584 186
185 3300049574 Ga0501038_0010696 Ga0501038_0010696_1874_2452 186
186 3300049575 Ga0501039_0209083 Ga0501039_0209083_806_1384 186
187 3300049581 Ga0501047_0065254 Ga0501047_0065254_2655_3233 186
188 3300049582 Ga0501048_0208857 Ga0501048_0208857_120_698 186
189 3300049585 Ga0501069_0077151 Ga0501069_0077151_695_1273 186
190 3300049589 Ga0501073_0206314 Ga0501073_0206314_211_789 186
191 3300049822 Ga0501035_0109792 Ga0501035_0109792_475_1053 186
192 3300053077 Ga0495601_0102643 Ga0495601_0102643_221_802 186
193 3300053078 Ga0495612_0030343 Ga0495612_0030343_1553_2134 186
194 3300053085 Ga0495619_0043777 Ga0495619_0043777_1446_2027 186
195 3300054114 Ga0501084_0423587 Ga0501084_0423587_285_863 186
196 iso_pu_bacteria 8023623736 8023624367 186
197 3300002073 JGI24745J21846_1012350 JGI24745J21846_10123502 187
198 3300005327 Ga0070658_10096598 Ga0070658_100965982 187
199 3300005329 Ga0070683_100144083 Ga0070683_1001440832 187
200 3300005331 Ga0070670_100411660 Ga0070670_1004116602 187
201 3300005334 Ga0068869_100021289 Ga0068869_1000212894 187
202 3300005334 Ga0068869_100139641 Ga0068869_1001396411 187
203 3300005337 Ga0070682_100115987 Ga0070682_1001159872 187
204 3300005338 Ga0068868_100022630 Ga0068868_1000226305 187
205 3300005341 Ga0070691_10183676 Ga0070691_101836761 187
206 3300005353 Ga0070669_100124658 Ga0070669_1001246583 187
207 3300005364 Ga0070673_100085602 Ga0070673_1000856022 187
208 3300005459 Ga0068867_100054425 Ga0068867_1000544251 187
209 3300005544 Ga0070686_100044871 Ga0070686_1000448712 187
210 3300005614 Ga0068856_100356064 Ga0068856_1003560642 187
211 3300005616 Ga0068852_100031952 Ga0068852_1000319523 187
212 3300005718 Ga0068866_10005193 Ga0068866_100051934 187
213 3300005719 Ga0068861_100264167 Ga0068861_1002641672 187
214 3300005834 Ga0068851_10283091 Ga0068851_102830912 187
215 3300005842 Ga0068858_100543496 Ga0068858_1005434962 187
216 3300005843 Ga0068860_100488755 Ga0068860_1004887551 187
217 3300005844 Ga0068862_100201307 Ga0068862_1002013072 187
218 3300009094 Ga0111539_10223576 Ga0111539_102235762 187
219 3300009098 Ga0105245_10018853 Ga0105245_100188532 187
220 3300009176 Ga0105242_11591589 Ga0105242_115915891 187
221 3300009553 Ga0105249_10077841 Ga0105249_100778414 187
222 3300010375 Ga0105239_10218672 Ga0105239_102186723 187
223 3300013296 Ga0157374_10249998 Ga0157374_102499984 187
224 3300013306 Ga0163162_10343990 Ga0163162_103439902 187
225 3300013307 Ga0157372_10100217 Ga0157372_101002174 187
226 3300014325 Ga0163163_10236072 Ga0163163_102360724 187
227 3300014326 Ga0157380_10192877 Ga0157380_101928773 187
228 3300014745 Ga0157377_10193235 Ga0157377_101932352 187
229 3300014968 Ga0157379_10067044 Ga0157379_100670443 187
230 3300025899 Ga0207642_10044584 Ga0207642_100445841 187
231 3300025901 Ga0207688_10041401 Ga0207688_100414013 187
232 3300025903 Ga0207680_10135337 Ga0207680_101353373 187
233 3300025904 Ga0207647_10150147 Ga0207647_101501472 187
234 3300025923 Ga0207681_10075916 Ga0207681_100759164 187
235 3300025926 Ga0207659_10104171 Ga0207659_101041712 187
236 3300025927 Ga0207687_10020433 Ga0207687_100204334 187
237 3300025932 Ga0207690_10162408 Ga0207690_101624084 187
238 3300025933 Ga0207706_10101993 Ga0207706_101019934 187
239 3300025938 Ga0207704_10623489 Ga0207704_106234892 187
240 3300025940 Ga0207691_10223263 Ga0207691_102232632 187
241 3300025942 Ga0207689_10021795 Ga0207689_100217954 187
242 3300026035 Ga0207703_10045814 Ga0207703_100458142 187
243 3300026041 Ga0207639_10216022 Ga0207639_102160224 187
244 3300026067 Ga0207678_10006493 Ga0207678_100064939 187
245 3300026075 Ga0207708_10223713 Ga0207708_102237132 187
246 3300026078 Ga0207702_10147236 Ga0207702_101472362 187
247 3300026118 Ga0207675_100080852 Ga0207675_1000808523 187
248 3300028379 Ga0268266_10022863 Ga0268266_100228635 187
249 3300028380 Ga0268265_10038386 Ga0268265_100383862 187
250 3300031456 Ga0307513_10069726 Ga0307513_100697264 187
251 3300048905 Ga0496102_0107636 Ga0496102_0107636_1221_1802 187
252 3300048911 Ga0496108_0139537 Ga0496108_0139537_1023_1604 187
253 3300048912 Ga0496109_0719927 Ga0496109_0719927_59_640 187
254 3300048913 Ga0496110_0516771 Ga0496110_0516771_212_793 187
255 3300048915 Ga0496112_1005510 Ga0496112_1005510_98_679 187
256 3300005548 Ga0070665_100251214 Ga0070665_1002512144 188
257 3300044683 Ga0466965_0176043 Ga0466965_0176043_329_937 188
258 3300044684 Ga0466966_0000168 Ga0466966_0000168_5639_6247 188
259 3300044693 Ga0466961_0220536 Ga0466961_0220536_545_1153 188
260 3300044719 Ga0466971_0016695 Ga0466971_0016695_367_975 188
261 3300044842 Ga0466957_0001221 Ga0466957_0001221_1421_2029 188
262 3300045049 Ga0466959_0002276 Ga0466959_0002276_2223_2831 188
263 3300045836 Ga0466958_0005413 Ga0466958_0005413_900_1508 188
264 3300061719 Ga0466962_0004994 Ga0466962_0004994_4653_5261 188
265 iso_pu_bacteria 2773857921 2774843278 188
266 iso_pu_bacteria 8056447290 8056453316 188
267 3300025923 Ga0207681_10396984 Ga0207681_103969842 189
268 3300025986 Ga0207658_10004559 Ga0207658_100045591 189
269 3300028381 Ga0268264_10457659 Ga0268264_104576592 189
270 3300035083 Ga0373926_0002542 Ga0373926_0002542_1481_2095 189
271 3300035171 Ga0373946_0170847 Ga0373946_0170847_43_657 189
272 3300035692 Ga0373935_0000832 Ga0373935_0000832_11193_11807 189
273 3300035725 Ga0373947_0000002 Ga0373947_0000002_12567_13181 189
274 3300037068 Ga0373925_0252213 Ga0373925_0252213_458_1060 189
275 3300045976 Ga0466967_0557607 Ga0466967_0557607_446_1039 189
276 3300048903 Ga0496100_0000225 Ga0496100_0000225_7629_8207 189
277 3300048904 Ga0496101_0000118 Ga0496101_0000118_14807_15385 189
278 3300048905 Ga0496102_0027469 Ga0496102_0027469_1990_2568 189
279 3300048906 Ga0496103_0010087 Ga0496103_0010087_267_845 189
280 3300048910 Ga0496107_0000106 Ga0496107_0000106_25340_25918 189
281 3300048911 Ga0496108_0005477 Ga0496108_0005477_8630_9208 189
282 3300048912 Ga0496109_0000077 Ga0496109_0000077_80022_80600 189
283 3300048913 Ga0496110_0000645 Ga0496110_0000645_6244_6822 189
284 3300048914 Ga0496111_0000485 Ga0496111_0000485_4414_4992 189
285 3300048915 Ga0496112_0427457 Ga0496112_0427457_264_842 189
286 3300048916 Ga0496113_0085985 Ga0496113_0085985_372_950 189
287 3300048917 Ga0496114_0000880 Ga0496114_0000880_2260_2838 189
288 3300048918 Ga0496115_0006185 Ga0496115_0006185_6878_7456 189
289 3300048919 Ga0496116_0010526 Ga0496116_0010526_4030_4608 189
290 3300048920 Ga0496117_0038502 Ga0496117_0038502_2186_2764 189
291 3300048921 Ga0496118_0020141 Ga0496118_0020141_1449_2027 189
292 3300048922 Ga0496119_0002123 Ga0496119_0002123_12811_13389 189
293 3300048923 Ga0496120_0040545 Ga0496120_0040545_404_982 189
294 3300048924 Ga0496121_0000002 Ga0496121_0000002_1131912_1132490 189
295 3300048925 Ga0496122_0000051 Ga0496122_0000051_226723_227301 189
296 3300048926 Ga0496123_0013856 Ga0496123_0013856_926_1504 189
297 3300048927 Ga0496124_0000002 Ga0496124_0000002_362099_362677 189
298 3300048928 Ga0496125_0000002 Ga0496125_0000002_1131912_1132490 189
299 3300048929 Ga0496126_0000011 Ga0496126_0000011_362099_362677 189
300 3300050491 nmdc:mga00v17_213389_c1 nmdc:mga00v17_213389_c1_518_1102 189
301 iso_pu_bacteria 2808606365 2808874121 189
302 3300021388 Ga0213875_10000204 Ga0213875_1000020437 190
303 iso_pu_bacteria 2643221567 2643851444 190
304 iso_pu_bacteria 2643221624 2644137963 190
305 iso_pu_bacteria 2919446982 2919449069 190
306 3300026078 Ga0207702_10984046 Ga0207702_109840462 191
307 3300038443 Ga0395901_0099270 Ga0395901_0099270_493_1080 191
308 3300049568 Ga0501031_0023300 Ga0501031_0023300_1925_2503 191
309 3300049569 Ga0501032_0052722 Ga0501032_0052722_1775_2353 191
310 3300049570 Ga0501033_0057188 Ga0501033_0057188_191_769 191
311 3300049572 Ga0501036_0003842 Ga0501036_0003842_3058_3636 191
312 3300049573 Ga0501037_0076312 Ga0501037_0076312_848_1426 191
313 3300049575 Ga0501039_0000717 Ga0501039_0000717_19543_20121 191
314 3300049576 Ga0501040_0013400 Ga0501040_0013400_3931_4509 191
315 3300049577 Ga0501041_0027410 Ga0501041_0027410_1345_1923 191
316 3300049579 Ga0501043_0686732 Ga0501043_0686732_69_647 191
317 3300049580 Ga0501046_0042031 Ga0501046_0042031_1152_1730 191
318 3300049582 Ga0501048_0044768 Ga0501048_0044768_1907_2485 191
319 3300049587 Ga0501071_0001787 Ga0501071_0001787_8500_9078 191
320 3300049590 Ga0501074_0016898 Ga0501074_0016898_3176_3754 191
321 3300049591 Ga0501075_0000388 Ga0501075_0000388_2408_2986 191
322 3300049592 Ga0501076_0013718 Ga0501076_0013718_3497_4075 191
323 3300049741 Ga0501079_0033130 Ga0501079_0033130_1466_2044 191
324 3300049824 Ga0501045_0009408 Ga0501045_0009408_3501_4079 191
325 3300054114 Ga0501084_0014115 Ga0501084_0014115_3051_3629 191
326 3300061734 Ga0530510_0026476 Ga0530510_0026476_676_1254 191
327 3300005345 Ga0070692_10126469 Ga0070692_101264692 192
328 3300005365 Ga0070688_100165220 Ga0070688_1001652202 192
329 3300005367 Ga0070667_100340860 Ga0070667_1003408603 192
330 3300005535 Ga0070684_100478413 Ga0070684_1004784133 192
331 3300005543 Ga0070672_100363986 Ga0070672_1003639862 192
332 3300005578 Ga0068854_100224592 Ga0068854_1002245922 192
333 3300005615 Ga0070702_100052626 Ga0070702_1000526264 192
334 3300005618 Ga0068864_100026900 Ga0068864_1000269003 192
335 3300006237 Ga0097621_100203247 Ga0097621_1002032472 192
336 3300009098 Ga0105245_10092929 Ga0105245_100929294 192
337 3300009174 Ga0105241_10618765 Ga0105241_106187651 192
338 3300009545 Ga0105237_10351730 Ga0105237_103517303 192
339 3300009551 Ga0105238_10198868 Ga0105238_101988682 192
340 3300010375 Ga0105239_10793098 Ga0105239_107930982 192
341 3300013308 Ga0157375_10735353 Ga0157375_107353531 192
342 3300014968 Ga0157379_10749028 Ga0157379_107490282 192
343 3300025928 Ga0207700_10114156 Ga0207700_101141562 192
344 3300025932 Ga0207690_10345562 Ga0207690_103455622 192
345 3300025986 Ga0207658_10711465 Ga0207658_107114652 192
346 3300026067 Ga0207678_10142534 Ga0207678_101425343 192
347 3300026078 Ga0207702_10228483 Ga0207702_102284832 192
348 3300026089 Ga0207648_10048058 Ga0207648_100480582 192
349 3300026095 Ga0207676_10139180 Ga0207676_101391802 192
350 3300048907 Ga0496104_0070051 Ga0496104_0070051_1171_1770 192
351 3300048914 Ga0496111_0300802 Ga0496111_0300802_176_775 192
352 3300048917 Ga0496114_0388835 Ga0496114_0388835_28_627 192
353 3300005617 Ga0068859_100012910 Ga0068859_1000129104 193
354 3300005617 Ga0068859_100043138 Ga0068859_1000431385 193
355 3300005841 Ga0068863_100010729 Ga0068863_1000107293 193
356 3300005844 Ga0068862_100000337 Ga0068862_1000003375 193
357 3300006931 Ga0097620_100012909 Ga0097620_1000129094 193
358 3300014325 Ga0163163_10052021 Ga0163163_100520214 193
359 3300025961 Ga0207712_10143895 Ga0207712_101438952 193
360 3300028380 Ga0268265_10000057 Ga0268265_10000057110 193
361 3300031731 Ga0307405_10007908 Ga0307405_100079084 193
362 3300031824 Ga0307413_10201841 Ga0307413_102018413 193
363 3300031852 Ga0307410_10042319 Ga0307410_100423194 193
364 3300031911 Ga0307412_10646975 Ga0307412_106469752 193
365 3300031995 Ga0307409_100024767 Ga0307409_1000247674 193
366 3300032002 Ga0307416_100119124 Ga0307416_1001191244 193
367 3300044765 Ga0466970_0427674 Ga0466970_0427674_76_717 193
368 3300045976 Ga0466967_0392876 Ga0466967_0392876_386_1039 193
369 3300049568 Ga0501031_0598915 Ga0501031_0598915_26_610 193
370 3300049575 Ga0501039_0633535 Ga0501039_0633535_147_731 193
371 3300049581 Ga0501047_0029184 Ga0501047_0029184_1662_2309 193
372 3300049591 Ga0501075_0344419 Ga0501075_0344419_100_684 193
373 3300049592 Ga0501076_0161428 Ga0501076_0161428_54_638 193
374 3300049743 Ga0501081_0059326 Ga0501081_0059326_48_632 193
375 3300001989 JGI24739J22299_10048066 JGI24739J22299_100480661 194
376 3300001990 JGI24737J22298_10048134 JGI24737J22298_100481343 194
377 3300001990 JGI24737J22298_10063229 JGI24737J22298_100632292 194
378 3300002067 JGI24735J21928_10105930 JGI24735J21928_101059302 194
379 3300005336 Ga0070680_100274861 Ga0070680_1002748612 194
380 3300005344 Ga0070661_100393122 Ga0070661_1003931222 194
381 3300005535 Ga0070684_100360954 Ga0070684_1003609543 194
382 3300005577 Ga0068857_100049739 Ga0068857_1000497392 194
383 3300005616 Ga0068852_100860342 Ga0068852_1008603421 194
384 3300013307 Ga0157372_10848105 Ga0157372_108481051 194
385 3300020082 Ga0206353_10204930 Ga0206353_102049303 194
386 3300025917 Ga0207660_10212803 Ga0207660_102128033 194
387 3300025919 Ga0207657_10365001 Ga0207657_103650012 194
388 3300025944 Ga0207661_10493092 Ga0207661_104930922 194
389 3300026116 Ga0207674_10014824 Ga0207674_100148242 194
390 3300031731 Ga0307405_10278990 Ga0307405_102789902 194
391 3300031995 Ga0307409_100748021 Ga0307409_1007480212 194
392 3300032002 Ga0307416_100403912 Ga0307416_1004039122 194
393 3300038443 Ga0395901_0112842 Ga0395901_0112842_23_607 194
394 3300041494 Ga0451837_1540203 Ga0451837_1540203_118_702 194
395 3300041509 Ga0451843_0089849 Ga0451843_0089849_1425_2009 194
396 3300044658 Ga0466972_0309299 Ga0466972_0309299_92_679 194
397 3300044683 Ga0466965_0106881 Ga0466965_0106881_394_978 194
398 3300047322 Ga0495680_0089152 Ga0495680_0089152_1376_1960 194
399 3300048903 Ga0496100_0079311 Ga0496100_0079311_1018_1602 194
400 3300048904 Ga0496101_0032683 Ga0496101_0032683_2767_3351 194
401 3300048905 Ga0496102_0002661 Ga0496102_0002661_1702_2286 194
402 3300048906 Ga0496103_0003979 Ga0496103_0003979_2629_3213 194
403 3300050496 nmdc:mga07m45_362222_c1 nmdc:mga07m45_362222_c1_73_657 194
404 3300053085 Ga0495619_0198556 Ga0495619_0198556_690_1274 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03029

ATP_bind_1

Conserved hypothetical ATP binding protein

37

207

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w29-assembly1.cif.gz_AY 70s ribosome translocation intermediate containing elongation factor efg/gdp/fusidic acid, mrna, and trnas trapped in the ap/ap pe/e chimeric hybrid state. 0.7804 13 150
4wqu-assembly1.cif.gz_BZ crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g trapped by the antibiotic dityromycin 0.7617 12 155
5kh0-assembly2.cif.gz_D crystal structure of hydf from thermosipho melanesiensis in complex with a [4fe-4s] cluster 0.7592 13 182
6fae-assembly1.cif.gz_B the sec7 domain of iqsec2 (brag1) in complex with the small gtpase arf1 0.7583 12 180
2om7-assembly1.cif.gz_L structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors 0.7556 12 143
ID Description Score Start End Superfamily
af_O50391_4_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8536 4 188 3.40.50.300
af_O50391_4_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8405 4 188 3.40.50.300
af_Q58735_1_154_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8162 12 182 3.40.50.300
af_Q58735_1_154_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7876 12 182 3.40.50.300
af_Q9QXJ4_75_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7676 11 168 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3N6EKQ0-F1-model_v4 deleted 0.9878 94 184
AF-A0A3D5DX43-F1-model_v4 ATP-binding protein 0.9749 90 189 GO:0005525
GO:0016787
AF-A0A1C4QYZ4-F1-model_v4 Conserved hypothetical ATP binding protein 0.9746 104 189 GO:0005525
GO:0016787
AF-A0A510TK95-F1-model_v4 ATP-binding protein 0.9705 94 188 GO:0005525
GO:0016787
AF-A0A6G3ADK0-F1-model_v4 ATP-binding protein 0.9704 91 189 GO:0005524
GO:0005525
GO:0016787

Feature Viewer

pLDDT pTM Quality
81.51 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map