F435746
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 404 | 267 | 381 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0392876|Ga0466967_0392876_386_1039 |
| Length | 217 |
| Sequence | MVYASSPDPGRGQGPDAGRRAPGARPAAPRTSVKIVVAGGFGVGKTTLVEAISEIPAVNTEAWMTQAARTVDPLADAGGKTTTTVAMDFGRVTLASDLVLYLFGTPGQPRFWPMWDDLCRGASGALVLVDTRRLDVSFAAVNYFENDSDVPFIVAVNLFDGRQTHTLEQVAEALRLDPGVPVVACDARDRGSVVGTLTATLGHTLDRTAGLGGVASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 3 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 4 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 5 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 6 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 7 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 8 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 9 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 10 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 11 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 12 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 13 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 14 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 15 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 16 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 17 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 18 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 19 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 22 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 23 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 151 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 179 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 214 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 215 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 216 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 217 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 218 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 219 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 220 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 221 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 222 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 225 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 264 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 265 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 266 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 267 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.57 |
| Metatranscriptomes | 1.73 |
| Isolates | 5.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.99 |
| Nodule | 1.73 |
| Rhizoplane | 7.43 |
| Rhizosphere | 81.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10048066 | 3300001989 | Bacteria | 1389 |
| 2 | JGI24737J22298_10048134 | 3300001990 | Bacteria | 1298 |
| 3 | JGI24737J22298_10063229 | 3300001990 | Bacteria | 1111 |
| 4 | JGI24735J21928_10105930 | 3300002067 | Bacteria | 808 |
| 5 | JGI24745J21846_1012350 | 3300002073 | Bacteria | 979 |
| 6 | JGI25406J46586_10002608 | 3300003203 | Bacteria | 8496 |
| 7 | Ga0070658_10096598 | 3300005327 | Bacteria | 2439 |
| 8 | Ga0070658_10662521 | 3300005327 | Bacteria | 906 |
| 9 | Ga0070683_100078499 | 3300005329 | Bacteria | 3088 |
| 10 | Ga0070683_100144083 | 3300005329 | Bacteria | 2257 |
| 11 | Ga0070683_100255347 | 3300005329 | Bacteria | 1667 |
| 12 | Ga0070670_100411660 | 3300005331 | Bacteria | 1195 |
| 13 | Ga0068869_100021289 | 3300005334 | Bacteria | 4459 |
| 14 | Ga0068869_100139641 | 3300005334 | Bacteria | 1870 |
| 15 | Ga0070680_100033412 | 3300005336 | Bacteria | 4146 |
| 16 | Ga0070680_100274861 | 3300005336 | Bacteria | 1427 |
| 17 | Ga0070682_100077293 | 3300005337 | Bacteria | 2144 |
| 18 | Ga0070682_100115987 | 3300005337 | Bacteria | 1791 |
| 19 | Ga0068868_100022630 | 3300005338 | Bacteria | 4747 |
| 20 | Ga0070660_100574761 | 3300005339 | Bacteria | 941 |
| 21 | Ga0070691_10183676 | 3300005341 | Bacteria | 1090 |
| 22 | Ga0070661_100393122 | 3300005344 | Bacteria | 1095 |
| 23 | Ga0070692_10126469 | 3300005345 | Bacteria | 1432 |
| 24 | Ga0070669_100124658 | 3300005353 | Bacteria | 1970 |
| 25 | Ga0070673_100085602 | 3300005364 | Bacteria | 2566 |
| 26 | Ga0070688_100165220 | 3300005365 | Bacteria | 1523 |
| 27 | Ga0070659_100102711 | 3300005366 | Bacteria | 2302 |
| 28 | Ga0070667_100340860 | 3300005367 | Bacteria | 1355 |
| 29 | Ga0070709_10030578 | 3300005434 | Bacteria | 3232 |
| 30 | Ga0070714_100006484 | 3300005435 | Bacteria | 9043 |
| 31 | Ga0070714_100085493 | 3300005435 | Bacteria | 2755 |
| 32 | Ga0070713_100003156 | 3300005436 | Bacteria | 10849 |
| 33 | Ga0070713_100571872 | 3300005436 | Bacteria | 1072 |
| 34 | Ga0070713_100651028 | 3300005436 | Bacteria | 1003 |
| 35 | Ga0070713_100666635 | 3300005436 | Bacteria | 991 |
| 36 | Ga0070663_100007830 | 3300005455 | Bacteria | 6533 |
| 37 | Ga0070663_100029927 | 3300005455 | Bacteria | 3726 |
| 38 | Ga0070662_100305970 | 3300005457 | Bacteria | 1293 |
| 39 | Ga0070681_10353984 | 3300005458 | Bacteria | 1378 |
| 40 | Ga0068867_100054425 | 3300005459 | Bacteria | 2956 |
| 41 | Ga0070679_100009721 | 3300005530 | Bacteria | 9098 |
| 42 | Ga0070679_100125631 | 3300005530 | Bacteria | 2547 |
| 43 | Ga0070684_100099296 | 3300005535 | Bacteria | 2598 |
| 44 | Ga0070684_100360954 | 3300005535 | Bacteria | 1337 |
| 45 | Ga0070684_100478413 | 3300005535 | Bacteria | 1152 |
| 46 | Ga0068853_100128809 | 3300005539 | Bacteria | 2264 |
| 47 | Ga0068853_101472031 | 3300005539 | Bacteria | 659 |
| 48 | Ga0070672_100363986 | 3300005543 | Bacteria | 1235 |
| 49 | Ga0070686_100044871 | 3300005544 | Bacteria | 2781 |
| 50 | Ga0070665_100078671 | 3300005548 | Bacteria | 3304 |
| 51 | Ga0070665_100086729 | 3300005548 | Bacteria | 3136 |
| 52 | Ga0070665_100143000 | 3300005548 | Bacteria | 2395 |
| 53 | Ga0070665_100251214 | 3300005548 | Bacteria | 1769 |
| 54 | Ga0068855_100002257 | 3300005563 | Bacteria | 23802 |
| 55 | Ga0068857_100049739 | 3300005577 | Bacteria | 3719 |
| 56 | Ga0068857_100102424 | 3300005577 | Bacteria | 2570 |
| 57 | Ga0068854_100003083 | 3300005578 | Bacteria | 10378 |
| 58 | Ga0068854_100011904 | 3300005578 | Bacteria | 5684 |
| 59 | Ga0068854_100224592 | 3300005578 | Bacteria | 1487 |
| 60 | Ga0068856_100021934 | 3300005614 | Bacteria | 6208 |
| 61 | Ga0068856_100356064 | 3300005614 | Bacteria | 1482 |
| 62 | Ga0070702_100052626 | 3300005615 | Bacteria | 2335 |
| 63 | Ga0068852_100031952 | 3300005616 | Bacteria | 4353 |
| 64 | Ga0068852_100064934 | 3300005616 | Bacteria | 3183 |
| 65 | Ga0068852_100860342 | 3300005616 | Bacteria | 922 |
| 66 | Ga0068859_100012910 | 3300005617 | Bacteria | 8391 |
| 67 | Ga0068859_100043138 | 3300005617 | Bacteria | 4533 |
| 68 | Ga0068864_100026900 | 3300005618 | Bacteria | 4852 |
| 69 | Ga0068866_10005193 | 3300005718 | Bacteria | 5363 |
| 70 | Ga0068861_100264167 | 3300005719 | Bacteria | 1475 |
| 71 | Ga0068851_10283091 | 3300005834 | Bacteria | 949 |
| 72 | Ga0068863_100010729 | 3300005841 | Bacteria | 8894 |
| 73 | Ga0068858_100543496 | 3300005842 | Bacteria | 1124 |
| 74 | Ga0068860_100488755 | 3300005843 | Bacteria | 1227 |
| 75 | Ga0068862_100000337 | 3300005844 | Bacteria | 51008 |
| 76 | Ga0068862_100201307 | 3300005844 | Bacteria | 1795 |
| 77 | Ga0081455_10124125 | 3300005937 | Bacteria | 2029 |
| 78 | Ga0081539_10001378 | 3300005985 | Bacteria | 42067 |
| 79 | Ga0081539_10148358 | 3300005985 | Bacteria | 1131 |
| 80 | Ga0070717_10425568 | 3300006028 | Bacteria | 1195 |
| 81 | Ga0070712_100841421 | 3300006175 | Bacteria | 789 |
| 82 | Ga0097621_100203247 | 3300006237 | Bacteria | 1721 |
| 83 | Ga0097620_100012909 | 3300006931 | Bacteria | 8391 |
| 84 | Ga0105240_10061637 | 3300009093 | Bacteria | 4674 |
| 85 | Ga0111539_10223576 | 3300009094 | Bacteria | 2192 |
| 86 | Ga0111539_11946054 | 3300009094 | Bacteria | 682 |
| 87 | Ga0105245_10018853 | 3300009098 | Bacteria | 6038 |
| 88 | Ga0105245_10092929 | 3300009098 | Bacteria | 2779 |
| 89 | Ga0105243_10563958 | 3300009148 | Bacteria | 1090 |
| 90 | Ga0105241_10003503 | 3300009174 | Bacteria | 11673 |
| 91 | Ga0105241_10004168 | 3300009174 | Bacteria | 10674 |
| 92 | Ga0105241_10618765 | 3300009174 | Bacteria | 980 |
| 93 | Ga0105242_11591589 | 3300009176 | Bacteria | 687 |
| 94 | Ga0105237_10013756 | 3300009545 | Bacteria | 8473 |
| 95 | Ga0105237_10016477 | 3300009545 | Bacteria | 7677 |
| 96 | Ga0105237_10351730 | 3300009545 | Bacteria | 1478 |
| 97 | Ga0105237_10902174 | 3300009545 | Bacteria | 891 |
| 98 | Ga0105238_10002336 | 3300009551 | Bacteria | 19078 |
| 99 | Ga0105238_10034820 | 3300009551 | Bacteria | 5122 |
| 100 | Ga0105238_10198868 | 3300009551 | Bacteria | 1980 |
| 101 | Ga0105249_10077841 | 3300009553 | Bacteria | 3076 |
| 102 | Ga0105239_10020841 | 3300010375 | Bacteria | 7231 |
| 103 | Ga0105239_10218672 | 3300010375 | Bacteria | 2136 |
| 104 | Ga0105239_10507868 | 3300010375 | Bacteria | 1371 |
| 105 | Ga0105239_10793098 | 3300010375 | Bacteria | 1085 |
| 106 | Ga0157370_10012112 | 3300013104 | Bacteria | 8971 |
| 107 | Ga0157369_10232037 | 3300013105 | Bacteria | 1929 |
| 108 | Ga0157374_10047076 | 3300013296 | Bacteria | 3997 |
| 109 | Ga0157374_10248005 | 3300013296 | Bacteria | 1752 |
| 110 | Ga0157374_10249998 | 3300013296 | Bacteria | 1745 |
| 111 | Ga0163162_10343990 | 3300013306 | Bacteria | 1624 |
| 112 | Ga0157372_10100217 | 3300013307 | Bacteria | 3305 |
| 113 | Ga0157372_10848105 | 3300013307 | Bacteria | 1061 |
| 114 | Ga0157375_10735353 | 3300013308 | Bacteria | 1139 |
| 115 | Ga0163163_10052021 | 3300014325 | Bacteria | 4039 |
| 116 | Ga0163163_10236072 | 3300014325 | Bacteria | 1878 |
| 117 | Ga0157380_10192877 | 3300014326 | Bacteria | 1800 |
| 118 | Ga0157377_10193235 | 3300014745 | Bacteria | 1287 |
| 119 | Ga0157379_10067044 | 3300014968 | Bacteria | 3209 |
| 120 | Ga0157379_10749028 | 3300014968 | Bacteria | 919 |
| 121 | Ga0197907_10297500 | 3300020069 | Bacteria | 1409 |
| 122 | Ga0206356_10222281 | 3300020070 | Bacteria | 2524 |
| 123 | Ga0206356_11536716 | 3300020070 | Bacteria | 2219 |
| 124 | Ga0206354_10990128 | 3300020081 | Bacteria | 1064 |
| 125 | Ga0206353_10204930 | 3300020082 | Bacteria | 1891 |
| 126 | Ga0206353_10646142 | 3300020082 | Bacteria | 1417 |
| 127 | Ga0213875_10000204 | 3300021388 | Bacteria | 60760 |
| 128 | Ga0224712_10007517 | 3300022467 | Bacteria | 3177 |
| 129 | Ga0207642_10044584 | 3300025899 | Bacteria | 1964 |
| 130 | Ga0207688_10041401 | 3300025901 | Bacteria | 2562 |
| 131 | Ga0207680_10135337 | 3300025903 | Bacteria | 1628 |
| 132 | Ga0207647_10003175 | 3300025904 | Bacteria | 12334 |
| 133 | Ga0207647_10005939 | 3300025904 | Bacteria | 8901 |
| 134 | Ga0207647_10150147 | 3300025904 | Bacteria | 1362 |
| 135 | Ga0207699_10084212 | 3300025906 | Bacteria | 1980 |
| 136 | Ga0207705_10026893 | 3300025909 | Bacteria | 4100 |
| 137 | Ga0207654_10033798 | 3300025911 | Bacteria | 2837 |
| 138 | Ga0207654_10199269 | 3300025911 | Bacteria | 1317 |
| 139 | Ga0207707_10094086 | 3300025912 | Bacteria | 2618 |
| 140 | Ga0207695_10006773 | 3300025913 | Bacteria | 14773 |
| 141 | Ga0207695_10022530 | 3300025913 | Bacteria | 7147 |
| 142 | Ga0207671_10000666 | 3300025914 | Bacteria | 44894 |
| 143 | Ga0207671_10001245 | 3300025914 | Bacteria | 30022 |
| 144 | Ga0207660_10014557 | 3300025917 | Bacteria | 5176 |
| 145 | Ga0207660_10212803 | 3300025917 | Bacteria | 1514 |
| 146 | Ga0207657_10365001 | 3300025919 | Bacteria | 1138 |
| 147 | Ga0207652_10004208 | 3300025921 | Bacteria | 11748 |
| 148 | Ga0207652_10256513 | 3300025921 | Bacteria | 1577 |
| 149 | Ga0207681_10075916 | 3300025923 | Bacteria | 2359 |
| 150 | Ga0207681_10396984 | 3300025923 | Bacteria | 1113 |
| 151 | Ga0207694_10002582 | 3300025924 | Bacteria | 14684 |
| 152 | Ga0207694_10010042 | 3300025924 | Bacteria | 7135 |
| 153 | Ga0207659_10104171 | 3300025926 | Bacteria | 2145 |
| 154 | Ga0207687_10020433 | 3300025927 | Bacteria | 4392 |
| 155 | Ga0207700_10043443 | 3300025928 | Bacteria | 3301 |
| 156 | Ga0207700_10114156 | 3300025928 | Bacteria | 2179 |
| 157 | Ga0207700_10114195 | 3300025928 | Bacteria | 2179 |
| 158 | Ga0207700_10145965 | 3300025928 | Bacteria | 1950 |
| 159 | Ga0207700_10665001 | 3300025928 | Bacteria | 929 |
| 160 | Ga0207664_10050442 | 3300025929 | Bacteria | 3282 |
| 161 | Ga0207664_10102321 | 3300025929 | Bacteria | 2368 |
| 162 | Ga0207664_10242430 | 3300025929 | Bacteria | 1570 |
| 163 | Ga0207690_10162408 | 3300025932 | Bacteria | 1666 |
| 164 | Ga0207690_10345369 | 3300025932 | Bacteria | 1175 |
| 165 | Ga0207690_10345562 | 3300025932 | Bacteria | 1175 |
| 166 | Ga0207706_10101993 | 3300025933 | Bacteria | 2525 |
| 167 | Ga0207704_10623489 | 3300025938 | Bacteria | 885 |
| 168 | Ga0207691_10223263 | 3300025940 | Bacteria | 1633 |
| 169 | Ga0207689_10021795 | 3300025942 | Bacteria | 5387 |
| 170 | Ga0207661_10099196 | 3300025944 | Bacteria | 2442 |
| 171 | Ga0207661_10111258 | 3300025944 | Bacteria | 2317 |
| 172 | Ga0207661_10493092 | 3300025944 | Bacteria | 1119 |
| 173 | Ga0207667_10084682 | 3300025949 | Bacteria | 3282 |
| 174 | Ga0207667_10091828 | 3300025949 | Bacteria | 3136 |
| 175 | Ga0207712_10143895 | 3300025961 | Bacteria | 1833 |
| 176 | Ga0207640_10010265 | 3300025981 | Bacteria | 5269 |
| 177 | Ga0207640_10014998 | 3300025981 | Bacteria | 4474 |
| 178 | Ga0207658_10004559 | 3300025986 | Bacteria | 9611 |
| 179 | Ga0207658_10711465 | 3300025986 | Bacteria | 908 |
| 180 | Ga0207703_10045814 | 3300026035 | Bacteria | 3519 |
| 181 | Ga0207703_10423742 | 3300026035 | Bacteria | 1239 |
| 182 | Ga0207639_10033757 | 3300026041 | Bacteria | 3777 |
| 183 | Ga0207639_10216022 | 3300026041 | Bacteria | 1653 |
| 184 | Ga0207678_10006493 | 3300026067 | Bacteria | 10380 |
| 185 | Ga0207678_10014807 | 3300026067 | Bacteria | 6862 |
| 186 | Ga0207678_10046933 | 3300026067 | Bacteria | 3736 |
| 187 | Ga0207678_10142534 | 3300026067 | Bacteria | 2045 |
| 188 | Ga0207678_10255239 | 3300026067 | Bacteria | 1502 |
| 189 | Ga0207708_10223713 | 3300026075 | Bacteria | 1509 |
| 190 | Ga0207702_10107771 | 3300026078 | Bacteria | 2471 |
| 191 | Ga0207702_10147236 | 3300026078 | Bacteria | 2138 |
| 192 | Ga0207702_10228483 | 3300026078 | Bacteria | 1738 |
| 193 | Ga0207702_10984046 | 3300026078 | Bacteria | 837 |
| 194 | Ga0207648_10048058 | 3300026089 | Bacteria | 3737 |
| 195 | Ga0207676_10139180 | 3300026095 | Bacteria | 2075 |
| 196 | Ga0207674_10014824 | 3300026116 | Bacteria | 8597 |
| 197 | Ga0207674_10049110 | 3300026116 | Bacteria | 4317 |
| 198 | Ga0207675_100080852 | 3300026118 | Bacteria | 3047 |
| 199 | Ga0207698_10301962 | 3300026142 | Bacteria | 1490 |
| 200 | Ga0268266_10022863 | 3300028379 | Bacteria | 5321 |
| 201 | Ga0268266_10054811 | 3300028379 | Bacteria | 3427 |
| 202 | Ga0268266_10153286 | 3300028379 | Bacteria | 2079 |
| 203 | Ga0268265_10000057 | 3300028380 | Bacteria | 155346 |
| 204 | Ga0268265_10038386 | 3300028380 | Bacteria | 3523 |
| 205 | Ga0268264_10457659 | 3300028381 | Bacteria | 1237 |
| 206 | Ga0265337_1000724 | 3300028556 | Bacteria | 17359 |
| 207 | Ga0265326_10000766 | 3300028558 | Bacteria | 11914 |
| 208 | Ga0265319_1000344 | 3300028563 | Bacteria | 34100 |
| 209 | Ga0265334_10000169 | 3300028573 | Bacteria | 39242 |
| 210 | Ga0265323_10015591 | 3300028653 | Bacteria | 2986 |
| 211 | Ga0265338_10001043 | 3300028800 | Bacteria | 46320 |
| 212 | Ga0265338_10003552 | 3300028800 | Bacteria | 21794 |
| 213 | Ga0265338_10025091 | 3300028800 | Bacteria | 6065 |
| 214 | Ga0265324_10001071 | 3300029957 | Bacteria | 16485 |
| 215 | Ga0307512_10073283 | 3300030522 | Bacteria | 2524 |
| 216 | Ga0316181_1098672 | 3300030744 | Bacteria | 2055 |
| 217 | Ga0265332_10000552 | 3300031238 | Bacteria | 25311 |
| 218 | Ga0265320_10000904 | 3300031240 | Bacteria | 22273 |
| 219 | Ga0265325_10001947 | 3300031241 | Bacteria | 14242 |
| 220 | Ga0265340_10006823 | 3300031247 | Bacteria | 6247 |
| 221 | Ga0265316_10029134 | 3300031344 | Bacteria | 4544 |
| 222 | Ga0307513_10069726 | 3300031456 | Bacteria | 3678 |
| 223 | Ga0265313_10011900 | 3300031595 | Bacteria | 5370 |
| 224 | Ga0265314_10074529 | 3300031711 | Bacteria | 2260 |
| 225 | Ga0265342_10004560 | 3300031712 | Bacteria | 10837 |
| 226 | Ga0307405_10007908 | 3300031731 | Bacteria | 5358 |
| 227 | Ga0307405_10278990 | 3300031731 | Bacteria | 1257 |
| 228 | Ga0307413_10201841 | 3300031824 | Bacteria | 1437 |
| 229 | Ga0307413_10227776 | 3300031824 | Bacteria | 1366 |
| 230 | Ga0307410_10042319 | 3300031852 | Bacteria | 3010 |
| 231 | Ga0307407_10163504 | 3300031903 | Bacteria | 1459 |
| 232 | Ga0307412_10646975 | 3300031911 | Bacteria | 901 |
| 233 | Ga0307409_100024767 | 3300031995 | Bacteria | 4193 |
| 234 | Ga0307409_100277396 | 3300031995 | Bacteria | 1547 |
| 235 | Ga0307409_100748021 | 3300031995 | Bacteria | 981 |
| 236 | Ga0307416_100119124 | 3300032002 | Bacteria | 2348 |
| 237 | Ga0307416_100403912 | 3300032002 | Bacteria | 1405 |
| 238 | Ga0307414_10368621 | 3300032004 | Bacteria | 1238 |
| 239 | Ga0307507_10030660 | 3300033179 | Bacteria | 5663 |
| 240 | Ga0307507_10133450 | 3300033179 | Bacteria | 1933 |
| 241 | Ga0307507_10231093 | 3300033179 | Bacteria | 1226 |
| 242 | Ga0373926_0002542 | 3300035083 | Bacteria | 5797 |
| 243 | Ga0373946_0170847 | 3300035171 | Bacteria | 1026 |
| 244 | Ga0373935_0000832 | 3300035692 | Bacteria | 16609 |
| 245 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 246 | Ga0373925_0000237 | 3300037068 | Bacteria | 58351 |
| 247 | Ga0373925_0252213 | 3300037068 | Bacteria | 1415 |
| 248 | Ga0436364_0232790 | 3300037853 | Bacteria | 45876 |
| 249 | Ga0395901_0099270 | 3300038443 | Bacteria | 3053 |
| 250 | Ga0395901_0112842 | 3300038443 | Bacteria | 2854 |
| 251 | Ga0451802_0832920 | 3300041460 | Bacteria | 1265 |
| 252 | Ga0451837_1540203 | 3300041494 | Bacteria | 841 |
| 253 | Ga0451843_0089849 | 3300041509 | Bacteria | 2379 |
| 254 | Ga0466969_0022174 | 3300044656 | Bacteria | 3280 |
| 255 | Ga0466972_0309299 | 3300044658 | Bacteria | 738 |
| 256 | Ga0466965_0106881 | 3300044683 | Bacteria | 1436 |
| 257 | Ga0466965_0176043 | 3300044683 | Bacteria | 1127 |
| 258 | Ga0466966_0000168 | 3300044684 | Bacteria | 43039 |
| 259 | Ga0466961_0133115 | 3300044693 | Bacteria | 1558 |
| 260 | Ga0466961_0220536 | 3300044693 | Bacteria | 1169 |
| 261 | Ga0466963_0030122 | 3300044694 | Bacteria | 3499 |
| 262 | Ga0466971_0016695 | 3300044719 | Bacteria | 3243 |
| 263 | Ga0466968_0034983 | 3300044735 | Bacteria | 2100 |
| 264 | Ga0466970_0003133 | 3300044765 | Bacteria | 8036 |
| 265 | Ga0466970_0123953 | 3300044765 | Bacteria | 1416 |
| 266 | Ga0466970_0427674 | 3300044765 | Bacteria | 757 |
| 267 | Ga0466957_0001221 | 3300044842 | Bacteria | 13404 |
| 268 | Ga0466959_0002276 | 3300045049 | Bacteria | 12244 |
| 269 | Ga0466958_0005413 | 3300045836 | Bacteria | 6865 |
| 270 | Ga0466958_0306200 | 3300045836 | Bacteria | 1020 |
| 271 | Ga0466967_0287996 | 3300045976 | Bacteria | 1577 |
| 272 | Ga0466967_0392876 | 3300045976 | Bacteria | 1348 |
| 273 | Ga0466967_0557607 | 3300045976 | Bacteria | 1128 |
| 274 | Ga0466967_0909363 | 3300045976 | Bacteria | 875 |
| 275 | Ga0495592_0369689 | 3300046454 | Bacteria | 915 |
| 276 | Ga0495651_0000122 | 3300046462 | Bacteria | 57344 |
| 277 | Ga0495651_0003361 | 3300046462 | Bacteria | 12278 |
| 278 | Ga0495651_0187914 | 3300046462 | Bacteria | 1456 |
| 279 | Ga0495651_0588130 | 3300046462 | Bacteria | 703 |
| 280 | Ga0495628_0042558 | 3300046516 | Bacteria | 3622 |
| 281 | Ga0495652_0003273 | 3300046529 | Bacteria | 16134 |
| 282 | Ga0495652_0004906 | 3300046529 | Bacteria | 12690 |
| 283 | Ga0495645_0465499 | 3300046543 | Bacteria | 795 |
| 284 | Ga0495622_0040330 | 3300046557 | Bacteria | 2173 |
| 285 | Ga0495657_0030374 | 3300046675 | Bacteria | 3785 |
| 286 | Ga0495600_0022017 | 3300046809 | Bacteria | 4089 |
| 287 | Ga0495600_0052645 | 3300046809 | Bacteria | 2658 |
| 288 | Ga0495604_0137004 | 3300047317 | Bacteria | 1753 |
| 289 | Ga0495680_0089152 | 3300047322 | Bacteria | 2316 |
| 290 | Ga0495675_0068015 | 3300047444 | Bacteria | 2251 |
| 291 | Ga0496100_0000225 | 3300048903 | Bacteria | 30548 |
| 292 | Ga0496100_0079311 | 3300048903 | Bacteria | 2212 |
| 293 | Ga0496101_0000118 | 3300048904 | Bacteria | 77684 |
| 294 | Ga0496101_0032683 | 3300048904 | Bacteria | 3665 |
| 295 | Ga0496102_0002661 | 3300048905 | Bacteria | 15200 |
| 296 | Ga0496102_0027469 | 3300048905 | Bacteria | 5082 |
| 297 | Ga0496102_0107636 | 3300048905 | Bacteria | 2596 |
| 298 | Ga0496103_0003979 | 3300048906 | Bacteria | 8973 |
| 299 | Ga0496103_0010087 | 3300048906 | Bacteria | 5585 |
| 300 | Ga0496104_0070051 | 3300048907 | Bacteria | 3334 |
| 301 | Ga0496107_0000106 | 3300048910 | Bacteria | 40710 |
| 302 | Ga0496107_0536938 | 3300048910 | Bacteria | 867 |
| 303 | Ga0496108_0000157 | 3300048911 | Bacteria | 64803 |
| 304 | Ga0496108_0005477 | 3300048911 | Bacteria | 10264 |
| 305 | Ga0496108_0139537 | 3300048911 | Bacteria | 2088 |
| 306 | Ga0496109_0000077 | 3300048912 | Bacteria | 103492 |
| 307 | Ga0496109_0719927 | 3300048912 | Bacteria | 935 |
| 308 | Ga0496109_1230668 | 3300048912 | Bacteria | 685 |
| 309 | Ga0496110_0000645 | 3300048913 | Bacteria | 23879 |
| 310 | Ga0496110_0516771 | 3300048913 | Bacteria | 1086 |
| 311 | Ga0496111_0000485 | 3300048914 | Bacteria | 20417 |
| 312 | Ga0496111_0300802 | 3300048914 | Bacteria | 1189 |
| 313 | Ga0496112_0427457 | 3300048915 | Bacteria | 1263 |
| 314 | Ga0496112_1005510 | 3300048915 | Bacteria | 754 |
| 315 | Ga0496113_0085985 | 3300048916 | Bacteria | 2416 |
| 316 | Ga0496114_0000880 | 3300048917 | Bacteria | 22492 |
| 317 | Ga0496114_0388835 | 3300048917 | Bacteria | 1235 |
| 318 | Ga0496115_0006185 | 3300048918 | Bacteria | 8757 |
| 319 | Ga0496115_0533487 | 3300048918 | Bacteria | 940 |
| 320 | Ga0496116_0010526 | 3300048919 | Bacteria | 7735 |
| 321 | Ga0496117_0038502 | 3300048920 | Bacteria | 3543 |
| 322 | Ga0496118_0020141 | 3300048921 | Bacteria | 5928 |
| 323 | Ga0496119_0002123 | 3300048922 | Bacteria | 22312 |
| 324 | Ga0496120_0040545 | 3300048923 | Bacteria | 2735 |
| 325 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 326 | Ga0496122_0000051 | 3300048925 | Bacteria | 265104 |
| 327 | Ga0496123_0013856 | 3300048926 | Bacteria | 6726 |
| 328 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 329 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 330 | Ga0496126_0000011 | 3300048929 | Bacteria | 744275 |
| 331 | Ga0496126_0018314 | 3300048929 | Bacteria | 6945 |
| 332 | Ga0496126_0084178 | 3300048929 | Bacteria | 2805 |
| 333 | Ga0501031_0023300 | 3300049568 | Bacteria | 4037 |
| 334 | Ga0501031_0062734 | 3300049568 | Bacteria | 2422 |
| 335 | Ga0501031_0598915 | 3300049568 | Bacteria | 709 |
| 336 | Ga0501032_0052722 | 3300049569 | Bacteria | 2741 |
| 337 | Ga0501033_0057188 | 3300049570 | Bacteria | 2883 |
| 338 | Ga0501034_0156641 | 3300049571 | Bacteria | 2251 |
| 339 | Ga0501036_0003842 | 3300049572 | Bacteria | 12048 |
| 340 | Ga0501036_0193044 | 3300049572 | Bacteria | 1713 |
| 341 | Ga0501037_0076312 | 3300049573 | Bacteria | 2433 |
| 342 | Ga0501037_0085874 | 3300049573 | Bacteria | 2278 |
| 343 | Ga0501038_0010696 | 3300049574 | Bacteria | 8391 |
| 344 | Ga0501039_0000717 | 3300049575 | Bacteria | 23864 |
| 345 | Ga0501039_0209083 | 3300049575 | Bacteria | 1534 |
| 346 | Ga0501039_0633535 | 3300049575 | Bacteria | 837 |
| 347 | Ga0501040_0013400 | 3300049576 | Bacteria | 5388 |
| 348 | Ga0501041_0027410 | 3300049577 | Bacteria | 3432 |
| 349 | Ga0501043_0686732 | 3300049579 | Bacteria | 749 |
| 350 | Ga0501046_0042031 | 3300049580 | Bacteria | 3645 |
| 351 | Ga0501047_0029184 | 3300049581 | Bacteria | 5320 |
| 352 | Ga0501047_0065254 | 3300049581 | Bacteria | 3509 |
| 353 | Ga0501048_0044768 | 3300049582 | Bacteria | 3162 |
| 354 | Ga0501048_0208857 | 3300049582 | Bacteria | 1385 |
| 355 | Ga0501069_0077151 | 3300049585 | Bacteria | 1874 |
| 356 | Ga0501071_0001787 | 3300049587 | Bacteria | 12693 |
| 357 | Ga0501073_0206314 | 3300049589 | Bacteria | 1358 |
| 358 | Ga0501074_0016898 | 3300049590 | Bacteria | 5294 |
| 359 | Ga0501075_0000388 | 3300049591 | Bacteria | 25410 |
| 360 | Ga0501075_0344419 | 3300049591 | Bacteria | 1136 |
| 361 | Ga0501076_0013718 | 3300049592 | Bacteria | 6080 |
| 362 | Ga0501076_0161428 | 3300049592 | Bacteria | 1826 |
| 363 | Ga0501079_0033130 | 3300049741 | Bacteria | 3973 |
| 364 | Ga0501081_0059326 | 3300049743 | Bacteria | 2648 |
| 365 | Ga0501035_0109792 | 3300049822 | Bacteria | 2418 |
| 366 | Ga0501045_0009408 | 3300049824 | Bacteria | 6834 |
| 367 | nmdc:mga00v17_213389_c1 | 3300050491 | Bacteria | 1249 |
| 368 | nmdc:mga07m45_362222_c1 | 3300050496 | Bacteria | 842 |
| 369 | nmdc:mga06r32_201213_c1 | 3300050510 | Bacteria | 1979 |
| 370 | nmdc:mga08x19_567976_c1 | 3300050514 | Bacteria | 803 |
| 371 | Ga0495601_0066887 | 3300053077 | Bacteria | 2288 |
| 372 | Ga0495601_0102643 | 3300053077 | Bacteria | 1848 |
| 373 | Ga0495612_0030343 | 3300053078 | Bacteria | 2177 |
| 374 | Ga0495619_0043777 | 3300053085 | Bacteria | 2936 |
| 375 | Ga0495619_0198556 | 3300053085 | Bacteria | 1389 |
| 376 | Ga0500644_0015388 | 3300053088 | Bacteria | 2180 |
| 377 | Ga0500644_0191575 | 3300053088 | Bacteria | 842 |
| 378 | Ga0501084_0014115 | 3300054114 | Bacteria | 6616 |
| 379 | Ga0501084_0423587 | 3300054114 | Bacteria | 1125 |
| 380 | Ga0466962_0004994 | 3300061719 | Bacteria | 6380 |
| 381 | Ga0530510_0026476 | 3300061734 | Bacteria | 4151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050510 | nmdc:mga06r32_201213_c1 | nmdc:mga06r32_201213_c1_15_557 | 172 |
| 2 | iso_pu_bacteria | 2687453743 | 2689994481 | 178 |
| 3 | 3300033179 | Ga0307507_10030660 | Ga0307507_100306603 | 179 |
| 4 | iso_pu_bacteria | 2687453737 | 2689961575 | 179 |
| 5 | 3300041460 | Ga0451802_0832920 | Ga0451802_0832920_169_735 | 180 |
| 6 | 3300048912 | Ga0496109_1230668 | Ga0496109_1230668_117_674 | 180 |
| 7 | iso_pu_bacteria | 2684623035 | 2686536192 | 180 |
| 8 | iso_pu_bacteria | 2773857762 | 2774396418 | 180 |
| 9 | iso_pu_bacteria | 2808606439 | 2809198075 | 180 |
| 10 | iso_pu_bacteria | 2811994878 | 2812353235 | 180 |
| 11 | iso_pu_bacteria | 2891968417 | 2891969137 | 180 |
| 12 | iso_pu_bacteria | 2895880812 | 2895886807 | 180 |
| 13 | 3300048918 | Ga0496115_0533487 | Ga0496115_0533487_161_715 | 181 |
| 14 | iso_pu_bacteria | 2671180195 | 2671832511 | 181 |
| 15 | iso_pu_bacteria | 2773857922 | 2774850667 | 181 |
| 16 | iso_pu_bacteria | 2837183177 | 2837187413 | 181 |
| 17 | iso_pu_bacteria | 2891326441 | 2891329574 | 181 |
| 18 | 3300046675 | Ga0495657_0030374 | Ga0495657_0030374_2852_3448 | 182 |
| 19 | 3300053088 | Ga0500644_0015388 | Ga0500644_0015388_899_1495 | 182 |
| 20 | 3300009094 | Ga0111539_11946054 | Ga0111539_119460541 | 183 |
| 21 | 3300030744 | Ga0316181_1098672 | Ga0316181_10986724 | 183 |
| 22 | 3300031824 | Ga0307413_10227776 | Ga0307413_102277763 | 183 |
| 23 | 3300031903 | Ga0307407_10163504 | Ga0307407_101635042 | 183 |
| 24 | 3300031995 | Ga0307409_100277396 | Ga0307409_1002773962 | 183 |
| 25 | 3300032004 | Ga0307414_10368621 | Ga0307414_103686212 | 183 |
| 26 | 3300045976 | Ga0466967_0909363 | Ga0466967_0909363_271_843 | 183 |
| 27 | 3300053088 | Ga0500644_0191575 | Ga0500644_0191575_18_608 | 183 |
| 28 | iso_pu_bacteria | 2861520306 | 2861525924 | 183 |
| 29 | 3300003203 | JGI25406J46586_10002608 | JGI25406J46586_100026083 | 184 |
| 30 | 3300005329 | Ga0070683_100078499 | Ga0070683_1000784992 | 184 |
| 31 | 3300005329 | Ga0070683_100255347 | Ga0070683_1002553473 | 184 |
| 32 | 3300005336 | Ga0070680_100033412 | Ga0070680_1000334124 | 184 |
| 33 | 3300005337 | Ga0070682_100077293 | Ga0070682_1000772932 | 184 |
| 34 | 3300005339 | Ga0070660_100574761 | Ga0070660_1005747611 | 184 |
| 35 | 3300005366 | Ga0070659_100102711 | Ga0070659_1001027114 | 184 |
| 36 | 3300005434 | Ga0070709_10030578 | Ga0070709_100305784 | 184 |
| 37 | 3300005435 | Ga0070714_100006484 | Ga0070714_1000064845 | 184 |
| 38 | 3300005435 | Ga0070714_100085493 | Ga0070714_1000854934 | 184 |
| 39 | 3300005436 | Ga0070713_100003156 | Ga0070713_1000031564 | 184 |
| 40 | 3300005436 | Ga0070713_100571872 | Ga0070713_1005718722 | 184 |
| 41 | 3300005436 | Ga0070713_100651028 | Ga0070713_1006510282 | 184 |
| 42 | 3300005436 | Ga0070713_100666635 | Ga0070713_1006666352 | 184 |
| 43 | 3300005455 | Ga0070663_100007830 | Ga0070663_1000078304 | 184 |
| 44 | 3300005457 | Ga0070662_100305970 | Ga0070662_1003059702 | 184 |
| 45 | 3300005458 | Ga0070681_10353984 | Ga0070681_103539843 | 184 |
| 46 | 3300005530 | Ga0070679_100009721 | Ga0070679_1000097215 | 184 |
| 47 | 3300005530 | Ga0070679_100125631 | Ga0070679_1001256311 | 184 |
| 48 | 3300005535 | Ga0070684_100099296 | Ga0070684_1000992961 | 184 |
| 49 | 3300005539 | Ga0068853_101472031 | Ga0068853_1014720311 | 184 |
| 50 | 3300005548 | Ga0070665_100078671 | Ga0070665_1000786712 | 184 |
| 51 | 3300005577 | Ga0068857_100102424 | Ga0068857_1001024241 | 184 |
| 52 | 3300005985 | Ga0081539_10001378 | Ga0081539_1000137816 | 184 |
| 53 | 3300005985 | Ga0081539_10148358 | Ga0081539_101483581 | 184 |
| 54 | 3300006028 | Ga0070717_10425568 | Ga0070717_104255681 | 184 |
| 55 | 3300006175 | Ga0070712_100841421 | Ga0070712_1008414212 | 184 |
| 56 | 3300009148 | Ga0105243_10563958 | Ga0105243_105639582 | 184 |
| 57 | 3300010375 | Ga0105239_10507868 | Ga0105239_105078682 | 184 |
| 58 | 3300013104 | Ga0157370_10012112 | Ga0157370_100121127 | 184 |
| 59 | 3300020069 | Ga0197907_10297500 | Ga0197907_102975003 | 184 |
| 60 | 3300020070 | Ga0206356_10222281 | Ga0206356_102222814 | 184 |
| 61 | 3300020081 | Ga0206354_10990128 | Ga0206354_109901282 | 184 |
| 62 | 3300020082 | Ga0206353_10646142 | Ga0206353_106461423 | 184 |
| 63 | 3300022467 | Ga0224712_10007517 | Ga0224712_100075174 | 184 |
| 64 | 3300025906 | Ga0207699_10084212 | Ga0207699_100842123 | 184 |
| 65 | 3300025909 | Ga0207705_10026893 | Ga0207705_100268934 | 184 |
| 66 | 3300025912 | Ga0207707_10094086 | Ga0207707_100940864 | 184 |
| 67 | 3300025917 | Ga0207660_10014557 | Ga0207660_100145574 | 184 |
| 68 | 3300025921 | Ga0207652_10004208 | Ga0207652_100042086 | 184 |
| 69 | 3300025921 | Ga0207652_10256513 | Ga0207652_102565132 | 184 |
| 70 | 3300025928 | Ga0207700_10043443 | Ga0207700_100434434 | 184 |
| 71 | 3300025928 | Ga0207700_10114195 | Ga0207700_101141954 | 184 |
| 72 | 3300025928 | Ga0207700_10145965 | Ga0207700_101459652 | 184 |
| 73 | 3300025929 | Ga0207664_10050442 | Ga0207664_100504422 | 184 |
| 74 | 3300025929 | Ga0207664_10102321 | Ga0207664_101023212 | 184 |
| 75 | 3300025929 | Ga0207664_10242430 | Ga0207664_102424302 | 184 |
| 76 | 3300025932 | Ga0207690_10345369 | Ga0207690_103453691 | 184 |
| 77 | 3300025944 | Ga0207661_10099196 | Ga0207661_100991961 | 184 |
| 78 | 3300025944 | Ga0207661_10111258 | Ga0207661_101112583 | 184 |
| 79 | 3300026035 | Ga0207703_10423742 | Ga0207703_104237422 | 184 |
| 80 | 3300026067 | Ga0207678_10014807 | Ga0207678_100148075 | 184 |
| 81 | 3300026116 | Ga0207674_10049110 | Ga0207674_100491104 | 184 |
| 82 | 3300028379 | Ga0268266_10054811 | Ga0268266_100548112 | 184 |
| 83 | 3300028556 | Ga0265337_1000724 | Ga0265337_10007244 | 184 |
| 84 | 3300028558 | Ga0265326_10000766 | Ga0265326_100007663 | 184 |
| 85 | 3300028563 | Ga0265319_1000344 | Ga0265319_100034419 | 184 |
| 86 | 3300028573 | Ga0265334_10000169 | Ga0265334_1000016941 | 184 |
| 87 | 3300028653 | Ga0265323_10015591 | Ga0265323_100155914 | 184 |
| 88 | 3300028800 | Ga0265338_10001043 | Ga0265338_1000104311 | 184 |
| 89 | 3300028800 | Ga0265338_10003552 | Ga0265338_1000355214 | 184 |
| 90 | 3300028800 | Ga0265338_10025091 | Ga0265338_100250916 | 184 |
| 91 | 3300029957 | Ga0265324_10001071 | Ga0265324_100010713 | 184 |
| 92 | 3300030522 | Ga0307512_10073283 | Ga0307512_100732834 | 184 |
| 93 | 3300031238 | Ga0265332_10000552 | Ga0265332_1000055229 | 184 |
| 94 | 3300031240 | Ga0265320_10000904 | Ga0265320_1000090424 | 184 |
| 95 | 3300031241 | Ga0265325_10001947 | Ga0265325_100019477 | 184 |
| 96 | 3300031247 | Ga0265340_10006823 | Ga0265340_100068235 | 184 |
| 97 | 3300031344 | Ga0265316_10029134 | Ga0265316_100291342 | 184 |
| 98 | 3300031595 | Ga0265313_10011900 | Ga0265313_100119004 | 184 |
| 99 | 3300031711 | Ga0265314_10074529 | Ga0265314_100745294 | 184 |
| 100 | 3300031712 | Ga0265342_10004560 | Ga0265342_100045605 | 184 |
| 101 | 3300037068 | Ga0373925_0000237 | Ga0373925_0000237_4247_4843 | 184 |
| 102 | 3300044694 | Ga0466963_0030122 | Ga0466963_0030122_907_1506 | 184 |
| 103 | 3300044735 | Ga0466968_0034983 | Ga0466968_0034983_1361_1960 | 184 |
| 104 | 3300045976 | Ga0466967_0287996 | Ga0466967_0287996_126_725 | 184 |
| 105 | 3300048929 | Ga0496126_0018314 | Ga0496126_0018314_1324_1920 | 184 |
| 106 | 3300048929 | Ga0496126_0084178 | Ga0496126_0084178_1310_1906 | 184 |
| 107 | 3300050514 | nmdc:mga08x19_567976_c1 | nmdc:mga08x19_567976_c1_33_632 | 184 |
| 108 | iso_pu_bacteria | 8047710418 | 8047717277 | 184 |
| 109 | 3300005327 | Ga0070658_10662521 | Ga0070658_106625212 | 185 |
| 110 | 3300005455 | Ga0070663_100029927 | Ga0070663_1000299273 | 185 |
| 111 | 3300005539 | Ga0068853_100128809 | Ga0068853_1001288092 | 185 |
| 112 | 3300005548 | Ga0070665_100143000 | Ga0070665_1001430002 | 185 |
| 113 | 3300005578 | Ga0068854_100003083 | Ga0068854_1000030837 | 185 |
| 114 | 3300009093 | Ga0105240_10061637 | Ga0105240_100616374 | 185 |
| 115 | 3300009174 | Ga0105241_10004168 | Ga0105241_100041684 | 185 |
| 116 | 3300009545 | Ga0105237_10013756 | Ga0105237_100137567 | 185 |
| 117 | 3300009545 | Ga0105237_10902174 | Ga0105237_109021742 | 185 |
| 118 | 3300009551 | Ga0105238_10034820 | Ga0105238_100348203 | 185 |
| 119 | 3300010375 | Ga0105239_10020841 | Ga0105239_100208413 | 185 |
| 120 | 3300013105 | Ga0157369_10232037 | Ga0157369_102320371 | 185 |
| 121 | 3300013296 | Ga0157374_10047076 | Ga0157374_100470763 | 185 |
| 122 | 3300020070 | Ga0206356_11536716 | Ga0206356_115367162 | 185 |
| 123 | 3300025904 | Ga0207647_10003175 | Ga0207647_1000317513 | 185 |
| 124 | 3300025911 | Ga0207654_10199269 | Ga0207654_101992691 | 185 |
| 125 | 3300025913 | Ga0207695_10006773 | Ga0207695_100067738 | 185 |
| 126 | 3300025914 | Ga0207671_10001245 | Ga0207671_100012458 | 185 |
| 127 | 3300025924 | Ga0207694_10002582 | Ga0207694_100025827 | 185 |
| 128 | 3300025928 | Ga0207700_10665001 | Ga0207700_106650012 | 185 |
| 129 | 3300025949 | Ga0207667_10091828 | Ga0207667_100918283 | 185 |
| 130 | 3300025981 | Ga0207640_10014998 | Ga0207640_100149984 | 185 |
| 131 | 3300026041 | Ga0207639_10033757 | Ga0207639_100337573 | 185 |
| 132 | 3300026067 | Ga0207678_10046933 | Ga0207678_100469333 | 185 |
| 133 | 3300028379 | Ga0268266_10153286 | Ga0268266_101532863 | 185 |
| 134 | 3300033179 | Ga0307507_10133450 | Ga0307507_101334502 | 185 |
| 135 | 3300037853 | Ga0436364_0232790 | Ga0436364_0232790_39498_40082 | 185 |
| 136 | 3300044656 | Ga0466969_0022174 | Ga0466969_0022174_92_676 | 185 |
| 137 | 3300044693 | Ga0466961_0133115 | Ga0466961_0133115_231_818 | 185 |
| 138 | 3300044765 | Ga0466970_0003133 | Ga0466970_0003133_4655_5242 | 185 |
| 139 | 3300044765 | Ga0466970_0123953 | Ga0466970_0123953_148_732 | 185 |
| 140 | 3300045836 | Ga0466958_0306200 | Ga0466958_0306200_388_972 | 185 |
| 141 | 3300046454 | Ga0495592_0369689 | Ga0495592_0369689_265_846 | 185 |
| 142 | 3300046462 | Ga0495651_0000122 | Ga0495651_0000122_25486_26073 | 185 |
| 143 | 3300046462 | Ga0495651_0003361 | Ga0495651_0003361_8861_9445 | 185 |
| 144 | 3300046462 | Ga0495651_0187914 | Ga0495651_0187914_415_1002 | 185 |
| 145 | 3300046516 | Ga0495628_0042558 | Ga0495628_0042558_1133_1720 | 185 |
| 146 | 3300046529 | Ga0495652_0003273 | Ga0495652_0003273_10138_10722 | 185 |
| 147 | 3300046529 | Ga0495652_0004906 | Ga0495652_0004906_2292_2879 | 185 |
| 148 | 3300046543 | Ga0495645_0465499 | Ga0495645_0465499_140_724 | 185 |
| 149 | 3300046557 | Ga0495622_0040330 | Ga0495622_0040330_24_611 | 185 |
| 150 | 3300046809 | Ga0495600_0022017 | Ga0495600_0022017_941_1528 | 185 |
| 151 | 3300046809 | Ga0495600_0052645 | Ga0495600_0052645_2045_2629 | 185 |
| 152 | 3300047317 | Ga0495604_0137004 | Ga0495604_0137004_303_878 | 185 |
| 153 | 3300047444 | Ga0495675_0068015 | Ga0495675_0068015_1263_1838 | 185 |
| 154 | 3300048911 | Ga0496108_0000157 | Ga0496108_0000157_6882_7463 | 185 |
| 155 | 3300053077 | Ga0495601_0066887 | Ga0495601_0066887_271_858 | 185 |
| 156 | iso_pu_bacteria | 2508501039 | 2508676158 | 185 |
| 157 | iso_pu_bacteria | 8002775197 | 8002777967 | 185 |
| 158 | 3300005548 | Ga0070665_100086729 | Ga0070665_1000867293 | 186 |
| 159 | 3300005563 | Ga0068855_100002257 | Ga0068855_1000022573 | 186 |
| 160 | 3300005578 | Ga0068854_100011904 | Ga0068854_1000119044 | 186 |
| 161 | 3300005614 | Ga0068856_100021934 | Ga0068856_1000219344 | 186 |
| 162 | 3300005616 | Ga0068852_100064934 | Ga0068852_1000649343 | 186 |
| 163 | 3300005937 | Ga0081455_10124125 | Ga0081455_101241253 | 186 |
| 164 | 3300009174 | Ga0105241_10003503 | Ga0105241_1000350311 | 186 |
| 165 | 3300009545 | Ga0105237_10016477 | Ga0105237_100164776 | 186 |
| 166 | 3300009551 | Ga0105238_10002336 | Ga0105238_100023363 | 186 |
| 167 | 3300013296 | Ga0157374_10248005 | Ga0157374_102480052 | 186 |
| 168 | 3300025904 | Ga0207647_10005939 | Ga0207647_100059394 | 186 |
| 169 | 3300025911 | Ga0207654_10033798 | Ga0207654_100337983 | 186 |
| 170 | 3300025913 | Ga0207695_10022530 | Ga0207695_100225303 | 186 |
| 171 | 3300025914 | Ga0207671_10000666 | Ga0207671_1000066639 | 186 |
| 172 | 3300025924 | Ga0207694_10010042 | Ga0207694_100100426 | 186 |
| 173 | 3300025949 | Ga0207667_10084682 | Ga0207667_100846823 | 186 |
| 174 | 3300025981 | Ga0207640_10010265 | Ga0207640_100102653 | 186 |
| 175 | 3300026067 | Ga0207678_10255239 | Ga0207678_102552392 | 186 |
| 176 | 3300026078 | Ga0207702_10107771 | Ga0207702_101077713 | 186 |
| 177 | 3300026142 | Ga0207698_10301962 | Ga0207698_103019623 | 186 |
| 178 | 3300033179 | Ga0307507_10231093 | Ga0307507_102310932 | 186 |
| 179 | 3300046462 | Ga0495651_0588130 | Ga0495651_0588130_91_672 | 186 |
| 180 | 3300048910 | Ga0496107_0536938 | Ga0496107_0536938_84_662 | 186 |
| 181 | 3300049568 | Ga0501031_0062734 | Ga0501031_0062734_419_997 | 186 |
| 182 | 3300049571 | Ga0501034_0156641 | Ga0501034_0156641_832_1410 | 186 |
| 183 | 3300049572 | Ga0501036_0193044 | Ga0501036_0193044_859_1437 | 186 |
| 184 | 3300049573 | Ga0501037_0085874 | Ga0501037_0085874_1006_1584 | 186 |
| 185 | 3300049574 | Ga0501038_0010696 | Ga0501038_0010696_1874_2452 | 186 |
| 186 | 3300049575 | Ga0501039_0209083 | Ga0501039_0209083_806_1384 | 186 |
| 187 | 3300049581 | Ga0501047_0065254 | Ga0501047_0065254_2655_3233 | 186 |
| 188 | 3300049582 | Ga0501048_0208857 | Ga0501048_0208857_120_698 | 186 |
| 189 | 3300049585 | Ga0501069_0077151 | Ga0501069_0077151_695_1273 | 186 |
| 190 | 3300049589 | Ga0501073_0206314 | Ga0501073_0206314_211_789 | 186 |
| 191 | 3300049822 | Ga0501035_0109792 | Ga0501035_0109792_475_1053 | 186 |
| 192 | 3300053077 | Ga0495601_0102643 | Ga0495601_0102643_221_802 | 186 |
| 193 | 3300053078 | Ga0495612_0030343 | Ga0495612_0030343_1553_2134 | 186 |
| 194 | 3300053085 | Ga0495619_0043777 | Ga0495619_0043777_1446_2027 | 186 |
| 195 | 3300054114 | Ga0501084_0423587 | Ga0501084_0423587_285_863 | 186 |
| 196 | iso_pu_bacteria | 8023623736 | 8023624367 | 186 |
| 197 | 3300002073 | JGI24745J21846_1012350 | JGI24745J21846_10123502 | 187 |
| 198 | 3300005327 | Ga0070658_10096598 | Ga0070658_100965982 | 187 |
| 199 | 3300005329 | Ga0070683_100144083 | Ga0070683_1001440832 | 187 |
| 200 | 3300005331 | Ga0070670_100411660 | Ga0070670_1004116602 | 187 |
| 201 | 3300005334 | Ga0068869_100021289 | Ga0068869_1000212894 | 187 |
| 202 | 3300005334 | Ga0068869_100139641 | Ga0068869_1001396411 | 187 |
| 203 | 3300005337 | Ga0070682_100115987 | Ga0070682_1001159872 | 187 |
| 204 | 3300005338 | Ga0068868_100022630 | Ga0068868_1000226305 | 187 |
| 205 | 3300005341 | Ga0070691_10183676 | Ga0070691_101836761 | 187 |
| 206 | 3300005353 | Ga0070669_100124658 | Ga0070669_1001246583 | 187 |
| 207 | 3300005364 | Ga0070673_100085602 | Ga0070673_1000856022 | 187 |
| 208 | 3300005459 | Ga0068867_100054425 | Ga0068867_1000544251 | 187 |
| 209 | 3300005544 | Ga0070686_100044871 | Ga0070686_1000448712 | 187 |
| 210 | 3300005614 | Ga0068856_100356064 | Ga0068856_1003560642 | 187 |
| 211 | 3300005616 | Ga0068852_100031952 | Ga0068852_1000319523 | 187 |
| 212 | 3300005718 | Ga0068866_10005193 | Ga0068866_100051934 | 187 |
| 213 | 3300005719 | Ga0068861_100264167 | Ga0068861_1002641672 | 187 |
| 214 | 3300005834 | Ga0068851_10283091 | Ga0068851_102830912 | 187 |
| 215 | 3300005842 | Ga0068858_100543496 | Ga0068858_1005434962 | 187 |
| 216 | 3300005843 | Ga0068860_100488755 | Ga0068860_1004887551 | 187 |
| 217 | 3300005844 | Ga0068862_100201307 | Ga0068862_1002013072 | 187 |
| 218 | 3300009094 | Ga0111539_10223576 | Ga0111539_102235762 | 187 |
| 219 | 3300009098 | Ga0105245_10018853 | Ga0105245_100188532 | 187 |
| 220 | 3300009176 | Ga0105242_11591589 | Ga0105242_115915891 | 187 |
| 221 | 3300009553 | Ga0105249_10077841 | Ga0105249_100778414 | 187 |
| 222 | 3300010375 | Ga0105239_10218672 | Ga0105239_102186723 | 187 |
| 223 | 3300013296 | Ga0157374_10249998 | Ga0157374_102499984 | 187 |
| 224 | 3300013306 | Ga0163162_10343990 | Ga0163162_103439902 | 187 |
| 225 | 3300013307 | Ga0157372_10100217 | Ga0157372_101002174 | 187 |
| 226 | 3300014325 | Ga0163163_10236072 | Ga0163163_102360724 | 187 |
| 227 | 3300014326 | Ga0157380_10192877 | Ga0157380_101928773 | 187 |
| 228 | 3300014745 | Ga0157377_10193235 | Ga0157377_101932352 | 187 |
| 229 | 3300014968 | Ga0157379_10067044 | Ga0157379_100670443 | 187 |
| 230 | 3300025899 | Ga0207642_10044584 | Ga0207642_100445841 | 187 |
| 231 | 3300025901 | Ga0207688_10041401 | Ga0207688_100414013 | 187 |
| 232 | 3300025903 | Ga0207680_10135337 | Ga0207680_101353373 | 187 |
| 233 | 3300025904 | Ga0207647_10150147 | Ga0207647_101501472 | 187 |
| 234 | 3300025923 | Ga0207681_10075916 | Ga0207681_100759164 | 187 |
| 235 | 3300025926 | Ga0207659_10104171 | Ga0207659_101041712 | 187 |
| 236 | 3300025927 | Ga0207687_10020433 | Ga0207687_100204334 | 187 |
| 237 | 3300025932 | Ga0207690_10162408 | Ga0207690_101624084 | 187 |
| 238 | 3300025933 | Ga0207706_10101993 | Ga0207706_101019934 | 187 |
| 239 | 3300025938 | Ga0207704_10623489 | Ga0207704_106234892 | 187 |
| 240 | 3300025940 | Ga0207691_10223263 | Ga0207691_102232632 | 187 |
| 241 | 3300025942 | Ga0207689_10021795 | Ga0207689_100217954 | 187 |
| 242 | 3300026035 | Ga0207703_10045814 | Ga0207703_100458142 | 187 |
| 243 | 3300026041 | Ga0207639_10216022 | Ga0207639_102160224 | 187 |
| 244 | 3300026067 | Ga0207678_10006493 | Ga0207678_100064939 | 187 |
| 245 | 3300026075 | Ga0207708_10223713 | Ga0207708_102237132 | 187 |
| 246 | 3300026078 | Ga0207702_10147236 | Ga0207702_101472362 | 187 |
| 247 | 3300026118 | Ga0207675_100080852 | Ga0207675_1000808523 | 187 |
| 248 | 3300028379 | Ga0268266_10022863 | Ga0268266_100228635 | 187 |
| 249 | 3300028380 | Ga0268265_10038386 | Ga0268265_100383862 | 187 |
| 250 | 3300031456 | Ga0307513_10069726 | Ga0307513_100697264 | 187 |
| 251 | 3300048905 | Ga0496102_0107636 | Ga0496102_0107636_1221_1802 | 187 |
| 252 | 3300048911 | Ga0496108_0139537 | Ga0496108_0139537_1023_1604 | 187 |
| 253 | 3300048912 | Ga0496109_0719927 | Ga0496109_0719927_59_640 | 187 |
| 254 | 3300048913 | Ga0496110_0516771 | Ga0496110_0516771_212_793 | 187 |
| 255 | 3300048915 | Ga0496112_1005510 | Ga0496112_1005510_98_679 | 187 |
| 256 | 3300005548 | Ga0070665_100251214 | Ga0070665_1002512144 | 188 |
| 257 | 3300044683 | Ga0466965_0176043 | Ga0466965_0176043_329_937 | 188 |
| 258 | 3300044684 | Ga0466966_0000168 | Ga0466966_0000168_5639_6247 | 188 |
| 259 | 3300044693 | Ga0466961_0220536 | Ga0466961_0220536_545_1153 | 188 |
| 260 | 3300044719 | Ga0466971_0016695 | Ga0466971_0016695_367_975 | 188 |
| 261 | 3300044842 | Ga0466957_0001221 | Ga0466957_0001221_1421_2029 | 188 |
| 262 | 3300045049 | Ga0466959_0002276 | Ga0466959_0002276_2223_2831 | 188 |
| 263 | 3300045836 | Ga0466958_0005413 | Ga0466958_0005413_900_1508 | 188 |
| 264 | 3300061719 | Ga0466962_0004994 | Ga0466962_0004994_4653_5261 | 188 |
| 265 | iso_pu_bacteria | 2773857921 | 2774843278 | 188 |
| 266 | iso_pu_bacteria | 8056447290 | 8056453316 | 188 |
| 267 | 3300025923 | Ga0207681_10396984 | Ga0207681_103969842 | 189 |
| 268 | 3300025986 | Ga0207658_10004559 | Ga0207658_100045591 | 189 |
| 269 | 3300028381 | Ga0268264_10457659 | Ga0268264_104576592 | 189 |
| 270 | 3300035083 | Ga0373926_0002542 | Ga0373926_0002542_1481_2095 | 189 |
| 271 | 3300035171 | Ga0373946_0170847 | Ga0373946_0170847_43_657 | 189 |
| 272 | 3300035692 | Ga0373935_0000832 | Ga0373935_0000832_11193_11807 | 189 |
| 273 | 3300035725 | Ga0373947_0000002 | Ga0373947_0000002_12567_13181 | 189 |
| 274 | 3300037068 | Ga0373925_0252213 | Ga0373925_0252213_458_1060 | 189 |
| 275 | 3300045976 | Ga0466967_0557607 | Ga0466967_0557607_446_1039 | 189 |
| 276 | 3300048903 | Ga0496100_0000225 | Ga0496100_0000225_7629_8207 | 189 |
| 277 | 3300048904 | Ga0496101_0000118 | Ga0496101_0000118_14807_15385 | 189 |
| 278 | 3300048905 | Ga0496102_0027469 | Ga0496102_0027469_1990_2568 | 189 |
| 279 | 3300048906 | Ga0496103_0010087 | Ga0496103_0010087_267_845 | 189 |
| 280 | 3300048910 | Ga0496107_0000106 | Ga0496107_0000106_25340_25918 | 189 |
| 281 | 3300048911 | Ga0496108_0005477 | Ga0496108_0005477_8630_9208 | 189 |
| 282 | 3300048912 | Ga0496109_0000077 | Ga0496109_0000077_80022_80600 | 189 |
| 283 | 3300048913 | Ga0496110_0000645 | Ga0496110_0000645_6244_6822 | 189 |
| 284 | 3300048914 | Ga0496111_0000485 | Ga0496111_0000485_4414_4992 | 189 |
| 285 | 3300048915 | Ga0496112_0427457 | Ga0496112_0427457_264_842 | 189 |
| 286 | 3300048916 | Ga0496113_0085985 | Ga0496113_0085985_372_950 | 189 |
| 287 | 3300048917 | Ga0496114_0000880 | Ga0496114_0000880_2260_2838 | 189 |
| 288 | 3300048918 | Ga0496115_0006185 | Ga0496115_0006185_6878_7456 | 189 |
| 289 | 3300048919 | Ga0496116_0010526 | Ga0496116_0010526_4030_4608 | 189 |
| 290 | 3300048920 | Ga0496117_0038502 | Ga0496117_0038502_2186_2764 | 189 |
| 291 | 3300048921 | Ga0496118_0020141 | Ga0496118_0020141_1449_2027 | 189 |
| 292 | 3300048922 | Ga0496119_0002123 | Ga0496119_0002123_12811_13389 | 189 |
| 293 | 3300048923 | Ga0496120_0040545 | Ga0496120_0040545_404_982 | 189 |
| 294 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_1131912_1132490 | 189 |
| 295 | 3300048925 | Ga0496122_0000051 | Ga0496122_0000051_226723_227301 | 189 |
| 296 | 3300048926 | Ga0496123_0013856 | Ga0496123_0013856_926_1504 | 189 |
| 297 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_362099_362677 | 189 |
| 298 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_1131912_1132490 | 189 |
| 299 | 3300048929 | Ga0496126_0000011 | Ga0496126_0000011_362099_362677 | 189 |
| 300 | 3300050491 | nmdc:mga00v17_213389_c1 | nmdc:mga00v17_213389_c1_518_1102 | 189 |
| 301 | iso_pu_bacteria | 2808606365 | 2808874121 | 189 |
| 302 | 3300021388 | Ga0213875_10000204 | Ga0213875_1000020437 | 190 |
| 303 | iso_pu_bacteria | 2643221567 | 2643851444 | 190 |
| 304 | iso_pu_bacteria | 2643221624 | 2644137963 | 190 |
| 305 | iso_pu_bacteria | 2919446982 | 2919449069 | 190 |
| 306 | 3300026078 | Ga0207702_10984046 | Ga0207702_109840462 | 191 |
| 307 | 3300038443 | Ga0395901_0099270 | Ga0395901_0099270_493_1080 | 191 |
| 308 | 3300049568 | Ga0501031_0023300 | Ga0501031_0023300_1925_2503 | 191 |
| 309 | 3300049569 | Ga0501032_0052722 | Ga0501032_0052722_1775_2353 | 191 |
| 310 | 3300049570 | Ga0501033_0057188 | Ga0501033_0057188_191_769 | 191 |
| 311 | 3300049572 | Ga0501036_0003842 | Ga0501036_0003842_3058_3636 | 191 |
| 312 | 3300049573 | Ga0501037_0076312 | Ga0501037_0076312_848_1426 | 191 |
| 313 | 3300049575 | Ga0501039_0000717 | Ga0501039_0000717_19543_20121 | 191 |
| 314 | 3300049576 | Ga0501040_0013400 | Ga0501040_0013400_3931_4509 | 191 |
| 315 | 3300049577 | Ga0501041_0027410 | Ga0501041_0027410_1345_1923 | 191 |
| 316 | 3300049579 | Ga0501043_0686732 | Ga0501043_0686732_69_647 | 191 |
| 317 | 3300049580 | Ga0501046_0042031 | Ga0501046_0042031_1152_1730 | 191 |
| 318 | 3300049582 | Ga0501048_0044768 | Ga0501048_0044768_1907_2485 | 191 |
| 319 | 3300049587 | Ga0501071_0001787 | Ga0501071_0001787_8500_9078 | 191 |
| 320 | 3300049590 | Ga0501074_0016898 | Ga0501074_0016898_3176_3754 | 191 |
| 321 | 3300049591 | Ga0501075_0000388 | Ga0501075_0000388_2408_2986 | 191 |
| 322 | 3300049592 | Ga0501076_0013718 | Ga0501076_0013718_3497_4075 | 191 |
| 323 | 3300049741 | Ga0501079_0033130 | Ga0501079_0033130_1466_2044 | 191 |
| 324 | 3300049824 | Ga0501045_0009408 | Ga0501045_0009408_3501_4079 | 191 |
| 325 | 3300054114 | Ga0501084_0014115 | Ga0501084_0014115_3051_3629 | 191 |
| 326 | 3300061734 | Ga0530510_0026476 | Ga0530510_0026476_676_1254 | 191 |
| 327 | 3300005345 | Ga0070692_10126469 | Ga0070692_101264692 | 192 |
| 328 | 3300005365 | Ga0070688_100165220 | Ga0070688_1001652202 | 192 |
| 329 | 3300005367 | Ga0070667_100340860 | Ga0070667_1003408603 | 192 |
| 330 | 3300005535 | Ga0070684_100478413 | Ga0070684_1004784133 | 192 |
| 331 | 3300005543 | Ga0070672_100363986 | Ga0070672_1003639862 | 192 |
| 332 | 3300005578 | Ga0068854_100224592 | Ga0068854_1002245922 | 192 |
| 333 | 3300005615 | Ga0070702_100052626 | Ga0070702_1000526264 | 192 |
| 334 | 3300005618 | Ga0068864_100026900 | Ga0068864_1000269003 | 192 |
| 335 | 3300006237 | Ga0097621_100203247 | Ga0097621_1002032472 | 192 |
| 336 | 3300009098 | Ga0105245_10092929 | Ga0105245_100929294 | 192 |
| 337 | 3300009174 | Ga0105241_10618765 | Ga0105241_106187651 | 192 |
| 338 | 3300009545 | Ga0105237_10351730 | Ga0105237_103517303 | 192 |
| 339 | 3300009551 | Ga0105238_10198868 | Ga0105238_101988682 | 192 |
| 340 | 3300010375 | Ga0105239_10793098 | Ga0105239_107930982 | 192 |
| 341 | 3300013308 | Ga0157375_10735353 | Ga0157375_107353531 | 192 |
| 342 | 3300014968 | Ga0157379_10749028 | Ga0157379_107490282 | 192 |
| 343 | 3300025928 | Ga0207700_10114156 | Ga0207700_101141562 | 192 |
| 344 | 3300025932 | Ga0207690_10345562 | Ga0207690_103455622 | 192 |
| 345 | 3300025986 | Ga0207658_10711465 | Ga0207658_107114652 | 192 |
| 346 | 3300026067 | Ga0207678_10142534 | Ga0207678_101425343 | 192 |
| 347 | 3300026078 | Ga0207702_10228483 | Ga0207702_102284832 | 192 |
| 348 | 3300026089 | Ga0207648_10048058 | Ga0207648_100480582 | 192 |
| 349 | 3300026095 | Ga0207676_10139180 | Ga0207676_101391802 | 192 |
| 350 | 3300048907 | Ga0496104_0070051 | Ga0496104_0070051_1171_1770 | 192 |
| 351 | 3300048914 | Ga0496111_0300802 | Ga0496111_0300802_176_775 | 192 |
| 352 | 3300048917 | Ga0496114_0388835 | Ga0496114_0388835_28_627 | 192 |
| 353 | 3300005617 | Ga0068859_100012910 | Ga0068859_1000129104 | 193 |
| 354 | 3300005617 | Ga0068859_100043138 | Ga0068859_1000431385 | 193 |
| 355 | 3300005841 | Ga0068863_100010729 | Ga0068863_1000107293 | 193 |
| 356 | 3300005844 | Ga0068862_100000337 | Ga0068862_1000003375 | 193 |
| 357 | 3300006931 | Ga0097620_100012909 | Ga0097620_1000129094 | 193 |
| 358 | 3300014325 | Ga0163163_10052021 | Ga0163163_100520214 | 193 |
| 359 | 3300025961 | Ga0207712_10143895 | Ga0207712_101438952 | 193 |
| 360 | 3300028380 | Ga0268265_10000057 | Ga0268265_10000057110 | 193 |
| 361 | 3300031731 | Ga0307405_10007908 | Ga0307405_100079084 | 193 |
| 362 | 3300031824 | Ga0307413_10201841 | Ga0307413_102018413 | 193 |
| 363 | 3300031852 | Ga0307410_10042319 | Ga0307410_100423194 | 193 |
| 364 | 3300031911 | Ga0307412_10646975 | Ga0307412_106469752 | 193 |
| 365 | 3300031995 | Ga0307409_100024767 | Ga0307409_1000247674 | 193 |
| 366 | 3300032002 | Ga0307416_100119124 | Ga0307416_1001191244 | 193 |
| 367 | 3300044765 | Ga0466970_0427674 | Ga0466970_0427674_76_717 | 193 |
| 368 | 3300045976 | Ga0466967_0392876 | Ga0466967_0392876_386_1039 | 193 |
| 369 | 3300049568 | Ga0501031_0598915 | Ga0501031_0598915_26_610 | 193 |
| 370 | 3300049575 | Ga0501039_0633535 | Ga0501039_0633535_147_731 | 193 |
| 371 | 3300049581 | Ga0501047_0029184 | Ga0501047_0029184_1662_2309 | 193 |
| 372 | 3300049591 | Ga0501075_0344419 | Ga0501075_0344419_100_684 | 193 |
| 373 | 3300049592 | Ga0501076_0161428 | Ga0501076_0161428_54_638 | 193 |
| 374 | 3300049743 | Ga0501081_0059326 | Ga0501081_0059326_48_632 | 193 |
| 375 | 3300001989 | JGI24739J22299_10048066 | JGI24739J22299_100480661 | 194 |
| 376 | 3300001990 | JGI24737J22298_10048134 | JGI24737J22298_100481343 | 194 |
| 377 | 3300001990 | JGI24737J22298_10063229 | JGI24737J22298_100632292 | 194 |
| 378 | 3300002067 | JGI24735J21928_10105930 | JGI24735J21928_101059302 | 194 |
| 379 | 3300005336 | Ga0070680_100274861 | Ga0070680_1002748612 | 194 |
| 380 | 3300005344 | Ga0070661_100393122 | Ga0070661_1003931222 | 194 |
| 381 | 3300005535 | Ga0070684_100360954 | Ga0070684_1003609543 | 194 |
| 382 | 3300005577 | Ga0068857_100049739 | Ga0068857_1000497392 | 194 |
| 383 | 3300005616 | Ga0068852_100860342 | Ga0068852_1008603421 | 194 |
| 384 | 3300013307 | Ga0157372_10848105 | Ga0157372_108481051 | 194 |
| 385 | 3300020082 | Ga0206353_10204930 | Ga0206353_102049303 | 194 |
| 386 | 3300025917 | Ga0207660_10212803 | Ga0207660_102128033 | 194 |
| 387 | 3300025919 | Ga0207657_10365001 | Ga0207657_103650012 | 194 |
| 388 | 3300025944 | Ga0207661_10493092 | Ga0207661_104930922 | 194 |
| 389 | 3300026116 | Ga0207674_10014824 | Ga0207674_100148242 | 194 |
| 390 | 3300031731 | Ga0307405_10278990 | Ga0307405_102789902 | 194 |
| 391 | 3300031995 | Ga0307409_100748021 | Ga0307409_1007480212 | 194 |
| 392 | 3300032002 | Ga0307416_100403912 | Ga0307416_1004039122 | 194 |
| 393 | 3300038443 | Ga0395901_0112842 | Ga0395901_0112842_23_607 | 194 |
| 394 | 3300041494 | Ga0451837_1540203 | Ga0451837_1540203_118_702 | 194 |
| 395 | 3300041509 | Ga0451843_0089849 | Ga0451843_0089849_1425_2009 | 194 |
| 396 | 3300044658 | Ga0466972_0309299 | Ga0466972_0309299_92_679 | 194 |
| 397 | 3300044683 | Ga0466965_0106881 | Ga0466965_0106881_394_978 | 194 |
| 398 | 3300047322 | Ga0495680_0089152 | Ga0495680_0089152_1376_1960 | 194 |
| 399 | 3300048903 | Ga0496100_0079311 | Ga0496100_0079311_1018_1602 | 194 |
| 400 | 3300048904 | Ga0496101_0032683 | Ga0496101_0032683_2767_3351 | 194 |
| 401 | 3300048905 | Ga0496102_0002661 | Ga0496102_0002661_1702_2286 | 194 |
| 402 | 3300048906 | Ga0496103_0003979 | Ga0496103_0003979_2629_3213 | 194 |
| 403 | 3300050496 | nmdc:mga07m45_362222_c1 | nmdc:mga07m45_362222_c1_73_657 | 194 |
| 404 | 3300053085 | Ga0495619_0198556 | Ga0495619_0198556_690_1274 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4w29-assembly1.cif.gz_AY | 70s ribosome translocation intermediate containing elongation factor efg/gdp/fusidic acid, mrna, and trnas trapped in the ap/ap pe/e chimeric hybrid state. | 0.7804 | 13 | 150 |
| 4wqu-assembly1.cif.gz_BZ | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g trapped by the antibiotic dityromycin | 0.7617 | 12 | 155 |
| 5kh0-assembly2.cif.gz_D | crystal structure of hydf from thermosipho melanesiensis in complex with a [4fe-4s] cluster | 0.7592 | 13 | 182 |
| 6fae-assembly1.cif.gz_B | the sec7 domain of iqsec2 (brag1) in complex with the small gtpase arf1 | 0.7583 | 12 | 180 |
| 2om7-assembly1.cif.gz_L | structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors | 0.7556 | 12 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50391_4_190_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8536 | 4 | 188 | 3.40.50.300 |
| af_O50391_4_190_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8405 | 4 | 188 | 3.40.50.300 |
| af_Q58735_1_154_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8162 | 12 | 182 | 3.40.50.300 |
| af_Q58735_1_154_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7876 | 12 | 182 | 3.40.50.300 |
| af_Q9QXJ4_75_231_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7676 | 11 | 168 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N6EKQ0-F1-model_v4 | deleted | 0.9878 | 94 | 184 |
|
| AF-A0A3D5DX43-F1-model_v4 | ATP-binding protein | 0.9749 | 90 | 189 |
GO:0005525
GO:0016787 |
| AF-A0A1C4QYZ4-F1-model_v4 | Conserved hypothetical ATP binding protein | 0.9746 | 104 | 189 |
GO:0005525
GO:0016787 |
| AF-A0A510TK95-F1-model_v4 | ATP-binding protein | 0.9705 | 94 | 188 |
GO:0005525
GO:0016787 |
| AF-A0A6G3ADK0-F1-model_v4 | ATP-binding protein | 0.9704 | 91 | 189 |
GO:0005524
GO:0005525 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar