F435714

General Info

Members Datasets Scaffolds Average Seq Length
404 207 808 264

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0218087|Ga0373935_0218087_45_794
Length 249
Sequence MINCKSQSELAKMKRSGQIVRHVLDAVKALVAPGVSTMDLENAAEEKIREFGAKPAFKGYCDYPCVLCTSVNNEIIHGIPSEKRVLKEGDIVSIDCGVVLDGYYGDSAITVPVGKAIAPELQKLLDVTETSLKKAIAEVRLGKTVGDVGAAVQEYVEANGFSVVREFVGHGIGTRLHEDPQVPNFGTRGHXXRLREGMVIAIEPMVNIGKPGARVLDDKWTAVTEDGSYSAHFEHTVAVTRNGPLVLTE

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0.74
Rhizoplane 2.48
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0218087 3300035692 Bacteria 1324
2 JGI25406J46586_10008229 3300003203 Bacteria 4732
3 Ga0058859_10010860 3300004798 Bacteria 2408
4 Ga0058860_12241898 3300004801 Bacteria 1366
5 Ga0065704_10122897 3300005289 Bacteria 1726
6 Ga0065712_10004459 3300005290 Bacteria 5924
7 Ga0065712_10081754 3300005290 Bacteria 2978
8 Ga0065712_10091841 3300005290 Bacteria 2354
9 Ga0065715_10017653 3300005293 Bacteria 2099
10 Ga0065707_10115799 3300005295 Bacteria 2226
11 Ga0070690_100092913 3300005330 Bacteria 1990
12 Ga0070690_100130517 3300005330 Bacteria 1697
13 Ga0070690_100300620 3300005330 Bacteria 1151
14 Ga0070670_100010048 3300005331 Bacteria 8078
15 Ga0070670_100014500 3300005331 Bacteria 6766
16 Ga0070677_10046119 3300005333 Bacteria 1741
17 Ga0068869_100286620 3300005334 Bacteria 1326
18 Ga0070682_100308641 3300005337 Bacteria 1164
19 Ga0070689_100026719 3300005340 Bacteria 4347
20 Ga0070689_100137120 3300005340 Bacteria 1965
21 Ga0070689_100298172 3300005340 Bacteria 1341
22 Ga0070691_10027136 3300005341 Bacteria 2671
23 Ga0070691_10045496 3300005341 Bacteria 2083
24 Ga0070687_100140086 3300005343 Bacteria 1407
25 Ga0070692_10076271 3300005345 Bacteria 1797
26 Ga0070669_100000040 3300005353 Bacteria 130277
27 Ga0070669_100247075 3300005353 Bacteria 1419
28 Ga0070669_100263677 3300005353 Bacteria 1375
29 Ga0070675_100002333 3300005354 Bacteria 14108
30 Ga0070675_100004981 3300005354 Bacteria 10137
31 Ga0070675_100027751 3300005354 Bacteria 4552
32 Ga0070675_100031686 3300005354 Bacteria 4276
33 Ga0070675_100229426 3300005354 Bacteria 1619
34 Ga0070671_100006715 3300005355 Bacteria 9208
35 Ga0070671_100009894 3300005355 Bacteria 7658
36 Ga0070674_100013521 3300005356 Bacteria 5049
37 Ga0070674_100361486 3300005356 Bacteria 1175
38 Ga0070673_100064206 3300005364 Bacteria 2924
39 Ga0070673_100072993 3300005364 Bacteria 2761
40 Ga0070673_100117234 3300005364 Bacteria 2216
41 Ga0070673_100193534 3300005364 Bacteria 1748
42 Ga0070673_100347588 3300005364 Bacteria 1315
43 Ga0070688_100005572 3300005365 Bacteria 6645
44 Ga0070688_100075918 3300005365 Bacteria 2161
45 Ga0070659_100191079 3300005366 Bacteria 1683
46 Ga0070667_100082713 3300005367 Bacteria 2749
47 Ga0070713_100335613 3300005436 Bacteria 1399
48 Ga0070713_100707877 3300005436 Bacteria 962
49 Ga0070701_10017325 3300005438 Bacteria 3365
50 Ga0070705_100008402 3300005440 Bacteria 5115
51 Ga0070700_100103268 3300005441 Bacteria 1882
52 Ga0070700_100154351 3300005441 Bacteria 1573
53 Ga0070700_100202523 3300005441 Bacteria 1395
54 Ga0070694_100013457 3300005444 Bacteria 5110
55 Ga0070694_100040901 3300005444 Bacteria 3090
56 Ga0070694_100073082 3300005444 Bacteria 2368
57 Ga0070678_100084159 3300005456 Bacteria 2420
58 Ga0070678_100103681 3300005456 Bacteria 2210
59 Ga0070681_10006387 3300005458 Bacteria 11462
60 Ga0070681_10194760 3300005458 Bacteria 1946
61 Ga0068867_100308735 3300005459 Bacteria 1306
62 Ga0070685_10025024 3300005466 Bacteria 3285
63 Ga0070685_10027287 3300005466 Bacteria 3155
64 Ga0070685_10174563 3300005466 Bacteria 1379
65 Ga0070707_100164360 3300005468 Bacteria 2163
66 Ga0070707_100220620 3300005468 Bacteria 1847
67 Ga0070698_100216581 3300005471 Bacteria 1849
68 Ga0070699_100000410 3300005518 Bacteria 41278
69 Ga0070699_100042106 3300005518 Bacteria 3951
70 Ga0070672_100056622 3300005543 Bacteria 3075
71 Ga0070672_100095105 3300005543 Bacteria 2409
72 Ga0070695_100006902 3300005545 Bacteria 6724
73 Ga0070696_100052550 3300005546 Bacteria 2834
74 Ga0070665_100001128 3300005548 Bacteria 32835
75 Ga0070665_100055927 3300005548 Bacteria 3957
76 Ga0070704_100000751 3300005549 Bacteria 15957
77 Ga0070704_100177508 3300005549 Bacteria 1700
78 Ga0070664_100093794 3300005564 Bacteria 2602
79 Ga0068857_100278746 3300005577 Bacteria 1537
80 Ga0070702_100259726 3300005615 Bacteria 1182
81 Ga0068859_100102171 3300005617 Bacteria 2924
82 Ga0068859_100174928 3300005617 Bacteria 2228
83 Ga0068859_100387137 3300005617 Bacteria 1494
84 Ga0068859_100649922 3300005617 Bacteria 1147
85 Ga0068864_100002899 3300005618 Bacteria 14178
86 Ga0068864_100309076 3300005618 Bacteria 1482
87 Ga0068861_100005736 3300005719 Bacteria 8418
88 Ga0068861_100499325 3300005719 Bacteria 1099
89 Ga0068861_100582127 3300005719 Bacteria 1025
90 Ga0068870_10031206 3300005840 Bacteria 2699
91 Ga0068870_10036964 3300005840 Bacteria 2514
92 Ga0068863_100003338 3300005841 Bacteria 15848
93 Ga0068863_100101210 3300005841 Bacteria 2739
94 Ga0068863_100220484 3300005841 Bacteria 1827
95 Ga0068858_100220884 3300005842 Bacteria 1794
96 Ga0068858_100466381 3300005842 Bacteria 1218
97 Ga0068862_100003082 3300005844 Bacteria 14534
98 Ga0068862_100122010 3300005844 Bacteria 2298
99 Ga0068862_100254030 3300005844 Bacteria 1603
100 Ga0081538_10022420 3300005981 Bacteria 4576
101 Ga0081538_10057053 3300005981 Bacteria 2281
102 Ga0081539_10000142 3300005985 Bacteria 165444
103 Ga0081539_10003297 3300005985 Bacteria 20197
104 Ga0075364_10205195 3300006051 Bacteria 1336
105 Ga0075366_10004275 3300006195 Bacteria 7664
106 Ga0075366_10023474 3300006195 Bacteria 3593
107 Ga0068871_100043411 3300006358 Bacteria 3611
108 Ga0068871_100240735 3300006358 Bacteria 1573
109 Ga0075428_100002605 3300006844 Bacteria 19618
110 Ga0075428_100045925 3300006844 Bacteria 4798
111 Ga0075428_100241770 3300006844 Bacteria 1947
112 Ga0075428_100547796 3300006844 Bacteria 1237
113 Ga0075430_100005705 3300006846 Bacteria 10502
114 Ga0075430_100074719 3300006846 Bacteria 2841
115 Ga0075430_100129548 3300006846 Bacteria 2103
116 Ga0075430_100168654 3300006846 Bacteria 1821
117 Ga0075431_100065606 3300006847 Bacteria 3749
118 Ga0075431_100196407 3300006847 Bacteria 2065
119 Ga0075431_100315614 3300006847 Bacteria 1577
120 Ga0075431_100585357 3300006847 Bacteria 1101
121 Ga0075433_10078295 3300006852 Bacteria 2913
122 Ga0075433_10088148 3300006852 Bacteria 2741
123 Ga0075434_100617440 3300006871 Bacteria 1103
124 Ga0075429_100004639 3300006880 Bacteria 11815
125 Ga0075429_100245799 3300006880 Bacteria 1567
126 Ga0075429_100400724 3300006880 Bacteria 1202
127 Ga0075429_100401814 3300006880 Bacteria 1200
128 Ga0097620_100102184 3300006931 Bacteria 2924
129 Ga0097620_100174923 3300006931 Bacteria 2228
130 Ga0097620_100387092 3300006931 Bacteria 1494
131 Ga0097620_100649885 3300006931 Bacteria 1147
132 Ga0079104_1007697 3300006946 Bacteria 3860
133 Ga0075435_100086492 3300007076 Bacteria 2582
134 Ga0075435_100284885 3300007076 Bacteria 1411
135 Ga0111539_10199271 3300009094 Bacteria 2335
136 Ga0111539_10294008 3300009094 Bacteria 1890
137 Ga0111539_10377854 3300009094 Bacteria 1649
138 Ga0111539_10601545 3300009094 Bacteria 1280
139 Ga0111539_10696416 3300009094 Bacteria 1183
140 Ga0114129_10006513 3300009147 Bacteria 16568
141 Ga0114129_10064928 3300009147 Bacteria 5095
142 Ga0114129_10074308 3300009147 Bacteria 4735
143 Ga0114129_10114512 3300009147 Bacteria 3718
144 Ga0114129_10173483 3300009147 Bacteria 2938
145 Ga0114129_10211024 3300009147 Bacteria 2625
146 Ga0114129_10349934 3300009147 Bacteria 1958
147 Ga0105243_10307547 3300009148 Bacteria 1439
148 Ga0105243_10635686 3300009148 Bacteria 1032
149 Ga0105241_10257206 3300009174 Bacteria 1483
150 Ga0105248_10015209 3300009177 Bacteria 8480
151 Ga0105248_10083290 3300009177 Bacteria 3598
152 Ga0105248_10621829 3300009177 Bacteria 1218
153 Ga0105249_10105935 3300009553 Bacteria 2652
154 Ga0105249_10132010 3300009553 Bacteria 2385
155 Ga0105249_10507428 3300009553 Bacteria 1252
156 Ga0157378_10144298 3300013297 Bacteria 2213
157 Ga0163162_10143079 3300013306 Bacteria 2506
158 Ga0163162_11084331 3300013306 Bacteria 907
159 Ga0163163_10048003 3300014325 Bacteria 4197
160 Ga0163163_10057133 3300014325 Bacteria 3858
161 Ga0163163_10370567 3300014325 Bacteria 1489
162 Ga0163163_10620602 3300014325 Bacteria 1145
163 Ga0157380_10012295 3300014326 Bacteria 6206
164 Ga0157380_10103529 3300014326 Bacteria 2376
165 Ga0157380_10463229 3300014326 Bacteria 1221
166 Ga0157377_10051349 3300014745 Bacteria 2325
167 Ga0157377_10111871 3300014745 Bacteria 1642
168 Ga0207653_10043769 3300025885 Bacteria 1475
169 Ga0207682_10011234 3300025893 Bacteria 3499
170 Ga0207682_10048166 3300025893 Bacteria 1757
171 Ga0207682_10118142 3300025893 Bacteria 1174
172 Ga0207642_10012323 3300025899 Bacteria 3084
173 Ga0207688_10042453 3300025901 Bacteria 2532
174 Ga0207645_10025151 3300025907 Bacteria 3854
175 Ga0207645_10049218 3300025907 Bacteria 2691
176 Ga0207643_10003397 3300025908 Bacteria 8582
177 Ga0207643_10019352 3300025908 Bacteria 3730
178 Ga0207643_10042111 3300025908 Bacteria 2574
179 Ga0207643_10085462 3300025908 Bacteria 1832
180 Ga0207707_10006304 3300025912 Bacteria 10359
181 Ga0207660_10426623 3300025917 Bacteria 1070
182 Ga0207662_10024685 3300025918 Bacteria 3459
183 Ga0207662_10119130 3300025918 Bacteria 1654
184 Ga0207681_10000015 3300025923 Bacteria 352892
185 Ga0207681_10022322 3300025923 Bacteria 4036
186 Ga0207681_10100427 3300025923 Bacteria 2085
187 Ga0207650_10028565 3300025925 Bacteria 4001
188 Ga0207650_10059070 3300025925 Bacteria 2857
189 Ga0207650_10086028 3300025925 Bacteria 2393
190 Ga0207659_10000672 3300025926 Bacteria 20255
191 Ga0207659_10012024 3300025926 Bacteria 5485
192 Ga0207659_10018460 3300025926 Bacteria 4574
193 Ga0207659_10123587 3300025926 Bacteria 1987
194 Ga0207687_10383432 3300025927 Bacteria 1152
195 Ga0207644_10006450 3300025931 Bacteria 7646
196 Ga0207690_10373205 3300025932 Bacteria 1132
197 Ga0207706_10118936 3300025933 Bacteria 2323
198 Ga0207686_10025544 3300025934 Bacteria 3437
199 Ga0207709_10217554 3300025935 Bacteria 1375
200 Ga0207670_10007706 3300025936 Bacteria 6033
201 Ga0207670_10369459 3300025936 Bacteria 1140
202 Ga0207669_10001534 3300025937 Bacteria 9841
203 Ga0207669_10132565 3300025937 Bacteria 1715
204 Ga0207704_10046220 3300025938 Bacteria 2593
205 Ga0207704_10146399 3300025938 Bacteria 1660
206 Ga0207704_10287608 3300025938 Bacteria 1253
207 Ga0207691_10094962 3300025940 Bacteria 2667
208 Ga0207691_10103934 3300025940 Bacteria 2532
209 Ga0207691_10158219 3300025940 Bacteria 1988
210 Ga0207711_10074378 3300025941 Bacteria 2954
211 Ga0207711_10082626 3300025941 Bacteria 2808
212 Ga0207711_10380079 3300025941 Bacteria 1310
213 Ga0207689_10074340 3300025942 Bacteria 2792
214 Ga0207689_10125292 3300025942 Bacteria 2113
215 Ga0207689_10380852 3300025942 Bacteria 1175
216 Ga0207679_10055153 3300025945 Bacteria 2928
217 Ga0207679_10116016 3300025945 Bacteria 2122
218 Ga0207679_10435451 3300025945 Bacteria 1160
219 Ga0207712_10066586 3300025961 Bacteria 2575
220 Ga0207712_10166626 3300025961 Bacteria 1718
221 Ga0207703_10188359 3300026035 Bacteria 1826
222 Ga0207678_10092212 3300026067 Bacteria 2589
223 Ga0207708_10028812 3300026075 Bacteria 4204
224 Ga0207708_10095663 3300026075 Bacteria 2294
225 Ga0207708_10213177 3300026075 Bacteria 1544
226 Ga0207641_10039508 3300026088 Bacteria 3947
227 Ga0207641_10593138 3300026088 Bacteria 1084
228 Ga0207641_10632188 3300026088 Bacteria 1050
229 Ga0207648_10009527 3300026089 Bacteria 9295
230 Ga0207648_10089189 3300026089 Bacteria 2693
231 Ga0207676_10003998 3300026095 Bacteria 10405
232 Ga0207674_10237408 3300026116 Bacteria 1770
233 Ga0207675_100018398 3300026118 Bacteria 6515
234 Ga0207675_100082544 3300026118 Bacteria 3014
235 Ga0207675_100084061 3300026118 Bacteria 2986
236 Ga0207683_10008746 3300026121 Bacteria 8645
237 Ga0207683_10070545 3300026121 Bacteria 3087
238 Ga0207683_10071502 3300026121 Bacteria 3067
239 Ga0209281_1000059 3300027111 Bacteria 295913
240 Ga0209281_1000435 3300027111 Bacteria 61761
241 Ga0209813_10047568 3300027866 Bacteria 1329
242 Ga0207428_10003291 3300027907 Bacteria 15710
243 Ga0207428_10004189 3300027907 Bacteria 13815
244 Ga0207428_10018444 3300027907 Bacteria 5960
245 Ga0207428_10026133 3300027907 Bacteria 4876
246 Ga0207428_10126748 3300027907 Bacteria 1955
247 Ga0207428_10359364 3300027907 Bacteria 1070
248 Ga0268266_10000745 3300028379 Bacteria 43623
249 Ga0268266_10082656 3300028379 Bacteria 2802
250 Ga0268265_10037657 3300028380 Bacteria 3551
251 Ga0268265_10133188 3300028380 Bacteria 2069
252 Ga0268265_10315307 3300028380 Bacteria 1414
253 Ga0268265_10757367 3300028380 Bacteria 943
254 Ga0268264_10027385 3300028381 Bacteria 4656
255 Ga0265331_10036324 3300031250 Bacteria 2419
256 Ga0307408_100214572 3300031548 Bacteria 1566
257 Ga0307408_100277897 3300031548 Bacteria 1393
258 Ga0265313_10013300 3300031595 Bacteria 4949
259 Ga0307405_10124710 3300031731 Bacteria 1769
260 Ga0307405_10211030 3300031731 Bacteria 1417
261 Ga0307405_10404273 3300031731 Bacteria 1070
262 Ga0307410_10033939 3300031852 Bacteria 3299
263 Ga0307410_10045369 3300031852 Bacteria 2926
264 Ga0307406_10181075 3300031901 Bacteria 1534
265 Ga0307407_10003307 3300031903 Bacteria 6582
266 Ga0307409_100013659 3300031995 Bacteria 5241
267 Ga0307409_100115521 3300031995 Bacteria 2260
268 Ga0307416_100012107 3300032002 Bacteria 5792
269 Ga0307416_100037206 3300032002 Bacteria 3742
270 Ga0307414_10052710 3300032004 Bacteria 2833
271 Ga0307414_10099500 3300032004 Bacteria 2185
272 Ga0307411_10048866 3300032005 Bacteria 2745
273 Ga0307411_10465119 3300032005 Bacteria 1061
274 Ga0307415_100006073 3300032126 Bacteria 6475
275 Ga0316593_10060492 3300032168 Bacteria 1294
276 Ga0373950_0007650 3300034818 Bacteria 1683
277 Ga0373940_0046852 3300035088 Bacteria 1204
278 Ga0373942_0017461 3300035207 Bacteria 1769
279 Ga0395900_0446729 3300037418 Bacteria 1250
280 Ga0395901_0582361 3300038443 Bacteria 1130
281 Ga0439436_0067601 3300041404 Bacteria 997
282 Ga0451843_0281964 3300041509 Bacteria 2124
283 Ga0439433_0004591 3300041999 Bacteria 2969
284 Ga0439448_0079707 3300042005 Bacteria 1098
285 Ga0439462_0014108 3300042015 Bacteria 2051
286 Ga0439462_0025006 3300042015 Bacteria 1571
287 Ga0450923_028390 3300042125 Bacteria 1130
288 Ga0439446_0078182 3300042156 Bacteria 1021
289 Ga0450908_001966 3300042184 Bacteria 4028
290 Ga0439434_0105991 3300042435 Bacteria 908
291 Ga0439435_0005174 3300042436 Bacteria 2857
292 Ga0439460_0025209 3300042461 Bacteria 1654
293 Ga0439460_0036138 3300042461 Bacteria 1432
294 Ga0451577_0247716 3300042876 Bacteria 1613
295 Ga0451576_0030744 3300045051 Bacteria 5734
296 Ga0451576_0552812 3300045051 Unclassified 1209
297 Ga0495603_0038804 3300046455 Bacteria 2855
298 Ga0495629_0062123 3300046459 Bacteria 2610
299 Ga0495639_0112539 3300046475 Bacteria 1293
300 Ga0495584_0006905 3300046491 Bacteria 5932
301 Ga0495594_0020851 3300046499 Bacteria 3494
302 Ga0495594_0030252 3300046499 Bacteria 2928
303 Ga0495620_0013727 3300046515 Bacteria 4140
304 Ga0495644_0021517 3300046523 Bacteria 2461
305 Ga0495642_0003089 3300046528 Bacteria 6619
306 Ga0495642_0049031 3300046528 Bacteria 1734
307 Ga0495654_0010951 3300046530 Bacteria 4927
308 Ga0495654_0017802 3300046530 Bacteria 3729
309 Ga0495609_0058061 3300046538 Bacteria 1712
310 Ga0495621_0008021 3300046539 Bacteria 3148
311 Ga0495659_0007665 3300046664 Bacteria 3421
312 Ga0495659_0008434 3300046664 Bacteria 3279
313 Ga0495659_0009384 3300046664 Bacteria 3121
314 Ga0495659_0031516 3300046664 Bacteria 1850
315 Ga0495670_0114468 3300046691 Bacteria 1398
316 Ga0495649_0206060 3300046694 Bacteria 1020
317 Ga0495636_0001627 3300047318 Bacteria 8550
318 Ga0495636_0027327 3300047318 Bacteria 2325
319 Ga0495672_0009184 3300047320 Bacteria 7200
320 Ga0496101_0227218 3300048904 Bacteria 1450
321 Ga0496104_0023213 3300048907 Bacteria 5703
322 Ga0496104_0029719 3300048907 Bacteria 5071
323 Ga0496105_0204913 3300048908 Bacteria 1609
324 Ga0496108_0121192 3300048911 Bacteria 2243
325 Ga0496109_0003238 3300048912 Bacteria 13560
326 Ga0496110_0012596 3300048913 Bacteria 6956
327 Ga0496112_0003156 3300048915 Bacteria 13543
328 Ga0496113_0016849 3300048916 Bacteria 5057
329 Ga0496114_0302737 3300048917 Bacteria 1411
330 Ga0496126_0000190 3300048929 Bacteria 137687
331 Ga0501036_0212122 3300049572 Bacteria 1627
332 Ga0501036_0258704 3300049572 Bacteria 1458
333 Ga0501038_0475757 3300049574 Bacteria 958
334 Ga0501039_0035714 3300049575 Bacteria 3837
335 Ga0501039_0065666 3300049575 Bacteria 2815
336 Ga0501041_0053916 3300049577 Bacteria 2453
337 Ga0501042_0010868 3300049578 Bacteria 6124
338 Ga0501042_0078410 3300049578 Bacteria 2366
339 Ga0501042_0448346 3300049578 Bacteria 936
340 Ga0501046_0079440 3300049580 Bacteria 2536
341 Ga0501048_0021930 3300049582 Bacteria 4675
342 Ga0501071_0019590 3300049587 Bacteria 4696
343 Ga0501072_0126749 3300049588 Bacteria 2034
344 Ga0501072_0174860 3300049588 Bacteria 1713
345 Ga0501073_0001115 3300049589 Bacteria 19500
346 Ga0501074_0087542 3300049590 Bacteria 2231
347 Ga0501075_0022188 3300049591 Bacteria 4635
348 Ga0501075_0028162 3300049591 Bacteria 4145
349 Ga0501076_0015697 3300049592 Bacteria 5729
350 Ga0501076_0076910 3300049592 Bacteria 2677
351 Ga0501079_0042351 3300049741 Bacteria 3517
352 Ga0501079_0264619 3300049741 Bacteria 1344
353 Ga0501079_0356077 3300049741 Bacteria 1147
354 Ga0501081_0023666 3300049743 Bacteria 4119
355 Ga0501081_0034664 3300049743 Bacteria 3434
356 Ga0501081_0039583 3300049743 Bacteria 3227
357 Ga0501081_0285487 3300049743 Bacteria 1209
358 Ga0501044_0218578 3300049823 Bacteria 1857
359 Ga0501045_0026713 3300049824 Bacteria 4155
360 Ga0501045_0038275 3300049824 Bacteria 3488
361 Ga0501045_0431527 3300049824 Bacteria 980
362 nmdc:mga0k408_38299_c1 3300050493 Bacteria 2752
363 nmdc:mga0k408_63601_c1 3300050493 Bacteria 2147
364 nmdc:mga0k408_88205_c1 3300050493 Bacteria 1822
365 nmdc:mga06z11_36810_c1 3300050494 Bacteria 2419
366 nmdc:mga05p37_118311_c1 3300050507 Bacteria 3256
367 nmdc:mga05p37_14374_c1 3300050507 Bacteria 8615
368 nmdc:mga05p37_15912_c1 3300050507 Bacteria 6518
369 nmdc:mga05p37_17560_c2 3300050507 Bacteria 7255
370 nmdc:mga05p37_181505_c1 3300050507 Bacteria 2560
371 nmdc:mga05p37_232562_c1 3300050507 Bacteria 2220
372 nmdc:mga09592_12720_c1 3300050508 Bacteria 6859
373 nmdc:mga09592_212321_c1 3300050508 Bacteria 1677
374 nmdc:mga09592_278490_c1 3300050508 Bacteria 1451
375 nmdc:mga09592_7680_c1 3300050508 Bacteria 8767
376 nmdc:mga0qj67_10318_c1 3300050509 Bacteria 6976
377 nmdc:mga0qj67_297370_c1 3300050509 Bacteria 1308
378 nmdc:mga0qj67_4157_c1 3300050509 Bacteria 10490
379 nmdc:mga0qj67_8629_c1 3300050509 Bacteria 7562
380 nmdc:mga06r32_131228_c1 3300050510 Bacteria 2477
381 nmdc:mga06r32_150207_c1 3300050510 Bacteria 2308
382 nmdc:mga06r32_248852_c1 3300050510 Bacteria 1765
383 nmdc:mga06r32_438023_c1 3300050510 Bacteria 1287
384 nmdc:mga06r32_882084_c1 3300050510 Bacteria 852
385 nmdc:mga08y16_13623_c1 3300050511 Bacteria 8559
386 nmdc:mga08y16_24663_c1 3300050511 Bacteria 6348
387 nmdc:mga08y16_298016_c1 3300050511 Bacteria 1662
388 nmdc:mga08y16_29936_c1 3300050511 Bacteria 5733
389 nmdc:mga08y16_302531_c1 3300050511 Bacteria 1648
390 nmdc:mga08y16_340898_c1 3300050511 Bacteria 1541
391 nmdc:mga08y16_94087_c1 3300050511 Bacteria 3122
392 nmdc:mga0n895_317741_c1 3300050512 Bacteria 1578
393 nmdc:mga0rr50_154962_c1 3300050513 Bacteria 1855
394 nmdc:mga0rr50_55237_c2 3300050513 Bacteria 2355
395 nmdc:mga0a205_117078_c1 3300050515 Bacteria 2563
396 nmdc:mga0a205_70179_c1 3300050515 Bacteria 3382
397 Ga0500556_0001889 3300053104 Bacteria 7496
398 Ga0501084_0094485 3300054114 Bacteria 2510
399 Ga0590075_000821 3300059424 Bacteria 8168
400 Ga0501082_0262749 3300060353 Bacteria 1502
401 Ga0501082_0357807 3300060353 Bacteria 1273
402 Ga0530510_0060320 3300061734 Bacteria 2745
403 Ga0530510_0096237 3300061734 Bacteria 2164
404 Ga0530510_0237211 3300061734 Bacteria 1357
405 Ga0373935_0218087
406 JGI25406J46586_10008229
407 Ga0058859_10010860
408 Ga0058860_12241898
409 Ga0065704_10122897
410 Ga0065712_10004459
411 Ga0065712_10081754
412 Ga0065712_10091841
413 Ga0065715_10017653
414 Ga0065707_10115799
415 Ga0070690_100092913
416 Ga0070690_100130517
417 Ga0070690_100300620
418 Ga0070670_100010048
419 Ga0070670_100014500
420 Ga0070677_10046119
421 Ga0068869_100286620
422 Ga0070682_100308641
423 Ga0070689_100026719
424 Ga0070689_100137120
425 Ga0070689_100298172
426 Ga0070691_10027136
427 Ga0070691_10045496
428 Ga0070687_100140086
429 Ga0070692_10076271
430 Ga0070669_100000040
431 Ga0070669_100247075
432 Ga0070669_100263677
433 Ga0070675_100002333
434 Ga0070675_100004981
435 Ga0070675_100027751
436 Ga0070675_100031686
437 Ga0070675_100229426
438 Ga0070671_100006715
439 Ga0070671_100009894
440 Ga0070674_100013521
441 Ga0070674_100361486
442 Ga0070673_100064206
443 Ga0070673_100072993
444 Ga0070673_100117234
445 Ga0070673_100193534
446 Ga0070673_100347588
447 Ga0070688_100005572
448 Ga0070688_100075918
449 Ga0070659_100191079
450 Ga0070667_100082713
451 Ga0070713_100335613
452 Ga0070713_100707877
453 Ga0070701_10017325
454 Ga0070705_100008402
455 Ga0070700_100103268
456 Ga0070700_100154351
457 Ga0070700_100202523
458 Ga0070694_100013457
459 Ga0070694_100040901
460 Ga0070694_100073082
461 Ga0070678_100084159
462 Ga0070678_100103681
463 Ga0070681_10006387
464 Ga0070681_10194760
465 Ga0068867_100308735
466 Ga0070685_10025024
467 Ga0070685_10027287
468 Ga0070685_10174563
469 Ga0070707_100164360
470 Ga0070707_100220620
471 Ga0070698_100216581
472 Ga0070699_100000410
473 Ga0070699_100042106
474 Ga0070672_100056622
475 Ga0070672_100095105
476 Ga0070695_100006902
477 Ga0070696_100052550
478 Ga0070665_100001128
479 Ga0070665_100055927
480 Ga0070704_100000751
481 Ga0070704_100177508
482 Ga0070664_100093794
483 Ga0068857_100278746
484 Ga0070702_100259726
485 Ga0068859_100102171
486 Ga0068859_100174928
487 Ga0068859_100387137
488 Ga0068859_100649922
489 Ga0068864_100002899
490 Ga0068864_100309076
491 Ga0068861_100005736
492 Ga0068861_100499325
493 Ga0068861_100582127
494 Ga0068870_10031206
495 Ga0068870_10036964
496 Ga0068863_100003338
497 Ga0068863_100101210
498 Ga0068863_100220484
499 Ga0068858_100220884
500 Ga0068858_100466381
501 Ga0068862_100003082
502 Ga0068862_100122010
503 Ga0068862_100254030
504 Ga0081538_10022420
505 Ga0081538_10057053
506 Ga0081539_10000142
507 Ga0081539_10003297
508 Ga0075364_10205195
509 Ga0075366_10004275
510 Ga0075366_10023474
511 Ga0068871_100043411
512 Ga0068871_100240735
513 Ga0075428_100002605
514 Ga0075428_100045925
515 Ga0075428_100241770
516 Ga0075428_100547796
517 Ga0075430_100005705
518 Ga0075430_100074719
519 Ga0075430_100129548
520 Ga0075430_100168654
521 Ga0075431_100065606
522 Ga0075431_100196407
523 Ga0075431_100315614
524 Ga0075431_100585357
525 Ga0075433_10078295
526 Ga0075433_10088148
527 Ga0075434_100617440
528 Ga0075429_100004639
529 Ga0075429_100245799
530 Ga0075429_100400724
531 Ga0075429_100401814
532 Ga0097620_100102184
533 Ga0097620_100174923
534 Ga0097620_100387092
535 Ga0097620_100649885
536 Ga0079104_1007697
537 Ga0075435_100086492
538 Ga0075435_100284885
539 Ga0111539_10199271
540 Ga0111539_10294008
541 Ga0111539_10377854
542 Ga0111539_10601545
543 Ga0111539_10696416
544 Ga0114129_10006513
545 Ga0114129_10064928
546 Ga0114129_10074308
547 Ga0114129_10114512
548 Ga0114129_10173483
549 Ga0114129_10211024
550 Ga0114129_10349934
551 Ga0105243_10307547
552 Ga0105243_10635686
553 Ga0105241_10257206
554 Ga0105248_10015209
555 Ga0105248_10083290
556 Ga0105248_10621829
557 Ga0105249_10105935
558 Ga0105249_10132010
559 Ga0105249_10507428
560 Ga0157378_10144298
561 Ga0163162_10143079
562 Ga0163162_11084331
563 Ga0163163_10048003
564 Ga0163163_10057133
565 Ga0163163_10370567
566 Ga0163163_10620602
567 Ga0157380_10012295
568 Ga0157380_10103529
569 Ga0157380_10463229
570 Ga0157377_10051349
571 Ga0157377_10111871
572 Ga0207653_10043769
573 Ga0207682_10011234
574 Ga0207682_10048166
575 Ga0207682_10118142
576 Ga0207642_10012323
577 Ga0207688_10042453
578 Ga0207645_10025151
579 Ga0207645_10049218
580 Ga0207643_10003397
581 Ga0207643_10019352
582 Ga0207643_10042111
583 Ga0207643_10085462
584 Ga0207707_10006304
585 Ga0207660_10426623
586 Ga0207662_10024685
587 Ga0207662_10119130
588 Ga0207681_10000015
589 Ga0207681_10022322
590 Ga0207681_10100427
591 Ga0207650_10028565
592 Ga0207650_10059070
593 Ga0207650_10086028
594 Ga0207659_10000672
595 Ga0207659_10012024
596 Ga0207659_10018460
597 Ga0207659_10123587
598 Ga0207687_10383432
599 Ga0207644_10006450
600 Ga0207690_10373205
601 Ga0207706_10118936
602 Ga0207686_10025544
603 Ga0207709_10217554
604 Ga0207670_10007706
605 Ga0207670_10369459
606 Ga0207669_10001534
607 Ga0207669_10132565
608 Ga0207704_10046220
609 Ga0207704_10146399
610 Ga0207704_10287608
611 Ga0207691_10094962
612 Ga0207691_10103934
613 Ga0207691_10158219
614 Ga0207711_10074378
615 Ga0207711_10082626
616 Ga0207711_10380079
617 Ga0207689_10074340
618 Ga0207689_10125292
619 Ga0207689_10380852
620 Ga0207679_10055153
621 Ga0207679_10116016
622 Ga0207679_10435451
623 Ga0207712_10066586
624 Ga0207712_10166626
625 Ga0207703_10188359
626 Ga0207678_10092212
627 Ga0207708_10028812
628 Ga0207708_10095663
629 Ga0207708_10213177
630 Ga0207641_10039508
631 Ga0207641_10593138
632 Ga0207641_10632188
633 Ga0207648_10009527
634 Ga0207648_10089189
635 Ga0207676_10003998
636 Ga0207674_10237408
637 Ga0207675_100018398
638 Ga0207675_100082544
639 Ga0207675_100084061
640 Ga0207683_10008746
641 Ga0207683_10070545
642 Ga0207683_10071502
643 Ga0209281_1000059
644 Ga0209281_1000435
645 Ga0209813_10047568
646 Ga0207428_10003291
647 Ga0207428_10004189
648 Ga0207428_10018444
649 Ga0207428_10026133
650 Ga0207428_10126748
651 Ga0207428_10359364
652 Ga0268266_10000745
653 Ga0268266_10082656
654 Ga0268265_10037657
655 Ga0268265_10133188
656 Ga0268265_10315307
657 Ga0268265_10757367
658 Ga0268264_10027385
659 Ga0265331_10036324
660 Ga0307408_100214572
661 Ga0307408_100277897
662 Ga0265313_10013300
663 Ga0307405_10124710
664 Ga0307405_10211030
665 Ga0307405_10404273
666 Ga0307410_10033939
667 Ga0307410_10045369
668 Ga0307406_10181075
669 Ga0307407_10003307
670 Ga0307409_100013659
671 Ga0307409_100115521
672 Ga0307416_100012107
673 Ga0307416_100037206
674 Ga0307414_10052710
675 Ga0307414_10099500
676 Ga0307411_10048866
677 Ga0307411_10465119
678 Ga0307415_100006073
679 Ga0316593_10060492
680 Ga0373950_0007650
681 Ga0373940_0046852
682 Ga0373942_0017461
683 Ga0395900_0446729
684 Ga0395901_0582361
685 Ga0439436_0067601
686 Ga0451843_0281964
687 Ga0439433_0004591
688 Ga0439448_0079707
689 Ga0439462_0014108
690 Ga0439462_0025006
691 Ga0450923_028390
692 Ga0439446_0078182
693 Ga0450908_001966
694 Ga0439434_0105991
695 Ga0439435_0005174
696 Ga0439460_0025209
697 Ga0439460_0036138
698 Ga0451577_0247716
699 Ga0451576_0030744
700 Ga0451576_0552812
701 Ga0495603_0038804
702 Ga0495629_0062123
703 Ga0495639_0112539
704 Ga0495584_0006905
705 Ga0495594_0020851
706 Ga0495594_0030252
707 Ga0495620_0013727
708 Ga0495644_0021517
709 Ga0495642_0003089
710 Ga0495642_0049031
711 Ga0495654_0010951
712 Ga0495654_0017802
713 Ga0495609_0058061
714 Ga0495621_0008021
715 Ga0495659_0007665
716 Ga0495659_0008434
717 Ga0495659_0009384
718 Ga0495659_0031516
719 Ga0495670_0114468
720 Ga0495649_0206060
721 Ga0495636_0001627
722 Ga0495636_0027327
723 Ga0495672_0009184
724 Ga0496101_0227218
725 Ga0496104_0023213
726 Ga0496104_0029719
727 Ga0496105_0204913
728 Ga0496108_0121192
729 Ga0496109_0003238
730 Ga0496110_0012596
731 Ga0496112_0003156
732 Ga0496113_0016849
733 Ga0496114_0302737
734 Ga0496126_0000190
735 Ga0501036_0212122
736 Ga0501036_0258704
737 Ga0501038_0475757
738 Ga0501039_0035714
739 Ga0501039_0065666
740 Ga0501041_0053916
741 Ga0501042_0010868
742 Ga0501042_0078410
743 Ga0501042_0448346
744 Ga0501046_0079440
745 Ga0501048_0021930
746 Ga0501071_0019590
747 Ga0501072_0126749
748 Ga0501072_0174860
749 Ga0501073_0001115
750 Ga0501074_0087542
751 Ga0501075_0022188
752 Ga0501075_0028162
753 Ga0501076_0015697
754 Ga0501076_0076910
755 Ga0501079_0042351
756 Ga0501079_0264619
757 Ga0501079_0356077
758 Ga0501081_0023666
759 Ga0501081_0034664
760 Ga0501081_0039583
761 Ga0501081_0285487
762 Ga0501044_0218578
763 Ga0501045_0026713
764 Ga0501045_0038275
765 Ga0501045_0431527
766 nmdc:mga0k408_38299_c1
767 nmdc:mga0k408_63601_c1
768 nmdc:mga0k408_88205_c1
769 nmdc:mga06z11_36810_c1
770 nmdc:mga05p37_118311_c1
771 nmdc:mga05p37_14374_c1
772 nmdc:mga05p37_15912_c1
773 nmdc:mga05p37_17560_c2
774 nmdc:mga05p37_181505_c1
775 nmdc:mga05p37_232562_c1
776 nmdc:mga09592_12720_c1
777 nmdc:mga09592_212321_c1
778 nmdc:mga09592_278490_c1
779 nmdc:mga09592_7680_c1
780 nmdc:mga0qj67_10318_c1
781 nmdc:mga0qj67_297370_c1
782 nmdc:mga0qj67_4157_c1
783 nmdc:mga0qj67_8629_c1
784 nmdc:mga06r32_131228_c1
785 nmdc:mga06r32_150207_c1
786 nmdc:mga06r32_248852_c1
787 nmdc:mga06r32_438023_c1
788 nmdc:mga06r32_882084_c1
789 nmdc:mga08y16_13623_c1
790 nmdc:mga08y16_24663_c1
791 nmdc:mga08y16_298016_c1
792 nmdc:mga08y16_29936_c1
793 nmdc:mga08y16_302531_c1
794 nmdc:mga08y16_340898_c1
795 nmdc:mga08y16_94087_c1
796 nmdc:mga0n895_317741_c1
797 nmdc:mga0rr50_154962_c1
798 nmdc:mga0rr50_55237_c2
799 nmdc:mga0a205_117078_c1
800 nmdc:mga0a205_70179_c1
801 Ga0500556_0001889
802 Ga0501084_0094485
803 Ga0590075_000821
804 Ga0501082_0262749
805 Ga0501082_0357807
806 Ga0530510_0060320
807 Ga0530510_0096237
808 Ga0530510_0237211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

241

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9883 1 247
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9878 1 250
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9867 1 248
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9839 1 247
5yoi-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine 0.9815 4 248
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9939 14 124 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9912 1 247 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9886 1 249 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9883 1 247 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9872 48 248 3.90.230.10
ID Description Score Start End GO Terms
AF-H9GMZ4-F1-model_v4 Methionyl aminopeptidase type 1D, mitochondrial 0.9982 35 150
AF-A0A356ZCU1-F1-model_v4 Type I methionyl aminopeptidase 0.9977 83 188 GO:0005829
GO:0006508
GO:0070006
AF-A0A446LE53-F1-model_v4 deleted 0.9963 45 182
AF-K3YJQ4-F1-model_v4 Peptidase M24 domain-containing protein 0.9959 3 150
AF-A0A250IPK0-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9957 1 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Map